F413083

General Info

Members Datasets Scaffolds Average Seq Length
337 199 674 255

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10171433|Ga0163162_101714332
Length 286
Sequence MALPAACPVPVGFAVAREQQRRHAHILPYASAAMDLGLRDRVCVVTGSTGGIGLETARLLAAEGARVVVTGRDSERVESARQTAGAALGVVADLSEPAAAEAVIGETTTSVGEVDCLVNNVGVTYQASFDEVTQLNVMSFVHAIRAVLPTMRGRGSGVIVNVSSTAAKRPSTGMPNYSVTKAAVLSLSRLVADLYAKDGIRCNAVTPGPTATSAWLGEGGLADQQAQRSGKTREEALDSVAAGRPLGRLAEPDEIASVIAFLCSERASYVTGAAWSADGGTVPIII

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 2.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.04
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10171433 3300013306 Bacteria 2295
2 JGI25407J50210_10006211 3300003373 Bacteria 2969
3 Ga0070658_10188452 3300005327 Bacteria 1738
4 Ga0070683_100035105 3300005329 Bacteria 4583
5 Ga0070683_100190730 3300005329 Bacteria 1946
6 Ga0068869_100158742 3300005334 Bacteria 1759
7 Ga0070682_100010510 3300005337 Bacteria 5252
8 Ga0070660_100005578 3300005339 Bacteria 8723
9 Ga0070689_100305747 3300005340 Bacteria 1325
10 Ga0070687_100307859 3300005343 Bacteria 1007
11 Ga0070673_100181166 3300005364 Bacteria 1804
12 Ga0070673_100294922 3300005364 Bacteria 1426
13 Ga0070714_100044284 3300005435 Bacteria 3767
14 Ga0070714_100141311 3300005435 Bacteria 2162
15 Ga0070701_10062051 3300005438 Bacteria 1973
16 Ga0070700_100676838 3300005441 Bacteria 817
17 Ga0070694_100215896 3300005444 Bacteria 1436
18 Ga0070708_100015864 3300005445 Bacteria 6232
19 Ga0070708_100072736 3300005445 Bacteria 3098
20 Ga0070681_10051357 3300005458 Bacteria 4112
21 Ga0070681_10090639 3300005458 Bacteria 3007
22 Ga0070706_100285669 3300005467 Bacteria 1540
23 Ga0070707_100012768 3300005468 Bacteria 7843
24 Ga0070707_100221848 3300005468 Bacteria 1841
25 Ga0070707_100829563 3300005468 Bacteria 888
26 Ga0070698_100017348 3300005471 Bacteria 7585
27 Ga0070698_100060656 3300005471 Bacteria 3817
28 Ga0070679_100038145 3300005530 Bacteria 4776
29 Ga0070684_100101940 3300005535 Bacteria 2565
30 Ga0070684_100588048 3300005535 Bacteria 1034
31 Ga0070686_100044820 3300005544 Bacteria 2783
32 Ga0070664_100444182 3300005564 Bacteria 1190
33 Ga0068857_100021239 3300005577 Bacteria 5713
34 Ga0068857_100386803 3300005577 Bacteria 1300
35 Ga0068856_100311873 3300005614 Bacteria 1591
36 Ga0068864_100037273 3300005618 Bacteria 4149
37 Ga0068861_100231916 3300005719 Bacteria 1566
38 Ga0068861_100397673 3300005719 Bacteria 1222
39 Ga0068870_10099911 3300005840 Bacteria 1638
40 Ga0068862_100253470 3300005844 Bacteria 1605
41 Ga0081455_10063808 3300005937 Bacteria 3089
42 Ga0081455_10162772 3300005937 Bacteria 1708
43 Ga0081538_10001401 3300005981 Bacteria 24745
44 Ga0081538_10003901 3300005981 Bacteria 13922
45 Ga0081538_10004499 3300005981 Bacteria 12831
46 Ga0081538_10004997 3300005981 Bacteria 12070
47 Ga0081538_10005238 3300005981 Bacteria 11720
48 Ga0081538_10023684 3300005981 Bacteria 4405
49 Ga0081538_10039958 3300005981 Bacteria 3000
50 Ga0081538_10064137 3300005981 Bacteria 2080
51 Ga0081538_10126670 3300005981 Bacteria 1212
52 Ga0070717_10588837 3300006028 Unclassified 1009
53 Ga0075432_10053565 3300006058 Bacteria 1427
54 Ga0075362_10183014 3300006177 Bacteria 1016
55 Ga0075428_100133096 3300006844 Bacteria 2704
56 Ga0075428_100166998 3300006844 Bacteria 2387
57 Ga0075430_100157934 3300006846 Bacteria 1887
58 Ga0075431_100029656 3300006847 Bacteria 5633
59 Ga0075433_10005570 3300006852 Bacteria 9890
60 Ga0075434_100010665 3300006871 Bacteria 8628
61 Ga0075434_100039865 3300006871 Bacteria 4651
62 Ga0075435_100020774 3300007076 Bacteria 5038
63 Ga0075435_100077926 3300007076 Bacteria 2717
64 Ga0105240_10636039 3300009093 Bacteria 1171
65 Ga0111539_10009767 3300009094 Bacteria 12111
66 Ga0111539_10018950 3300009094 Bacteria 8511
67 Ga0111539_10050410 3300009094 Bacteria 4959
68 Ga0111539_10094794 3300009094 Bacteria 3507
69 Ga0111539_10909096 3300009094 Bacteria 1024
70 Ga0105245_10024780 3300009098 Bacteria 5272
71 Ga0105245_10026644 3300009098 Bacteria 5089
72 Ga0105245_10077956 3300009098 Bacteria 3023
73 Ga0114129_10300143 3300009147 Bacteria 2141
74 Ga0114129_10695325 3300009147 Bacteria 1307
75 Ga0105243_10112376 3300009148 Bacteria 2282
76 Ga0105243_10187344 3300009148 Bacteria 1804
77 Ga0105242_10096202 3300009176 Bacteria 2501
78 Ga0105248_10054934 3300009177 Bacteria 4467
79 Ga0105249_10102087 3300009553 Bacteria 2699
80 Ga0105249_10191934 3300009553 Bacteria 1994
81 Ga0105239_10316947 3300010375 Bacteria 1758
82 Ga0105239_10418824 3300010375 Unclassified 1517
83 Ga0105246_10233052 3300011119 Bacteria 1451
84 Ga0157373_10446245 3300013100 Bacteria 931
85 Ga0157369_10005310 3300013105 Bacteria 15015
86 Ga0163162_10145082 3300013306 Bacteria 2489
87 Ga0163162_10709867 3300013306 Bacteria 1127
88 Ga0157375_10529451 3300013308 Bacteria 1341
89 Ga0163163_10121540 3300014325 Bacteria 2646
90 Ga0182008_10009714 3300014497 Bacteria 5181
91 Ga0157377_10062478 3300014745 Bacteria 2131
92 Ga0207688_10013604 3300025901 Bacteria 4423
93 Ga0207688_10078569 3300025901 Bacteria 1881
94 Ga0207699_10254644 3300025906 Bacteria 1211
95 Ga0207643_10021900 3300025908 Bacteria 3516
96 Ga0207643_10195446 3300025908 Bacteria 1229
97 Ga0207707_10234799 3300025912 Bacteria 1595
98 Ga0207693_10009287 3300025915 Bacteria 8024
99 Ga0207693_10012438 3300025915 Bacteria 6876
100 Ga0207693_10419588 3300025915 Bacteria 1046
101 Ga0207660_10083925 3300025917 Bacteria 2347
102 Ga0207660_10154117 3300025917 Bacteria 1768
103 Ga0207657_10017829 3300025919 Bacteria 6796
104 Ga0207652_10005189 3300025921 Bacteria 10580
105 Ga0207646_10221292 3300025922 Bacteria 1710
106 Ga0207687_10040631 3300025927 Bacteria 3189
107 Ga0207687_10219176 3300025927 Bacteria 1497
108 Ga0207664_10008406 3300025929 Bacteria 7197
109 Ga0207664_10009386 3300025929 Bacteria 6864
110 Ga0207664_10220266 3300025929 Bacteria 1645
111 Ga0207690_10053265 3300025932 Bacteria 2714
112 Ga0207709_10127908 3300025935 Bacteria 1726
113 Ga0207709_10322740 3300025935 Bacteria 1156
114 Ga0207669_10265213 3300025937 Bacteria 1287
115 Ga0207689_10184566 3300025942 Bacteria 1720
116 Ga0207661_10114338 3300025944 Bacteria 2288
117 Ga0207661_10653463 3300025944 Bacteria 966
118 Ga0207679_10275777 3300025945 Bacteria 1440
119 Ga0207679_10740846 3300025945 Bacteria 893
120 Ga0207651_10316792 3300025960 Bacteria 1303
121 Ga0207712_10144946 3300025961 Bacteria 1827
122 Ga0207668_10183220 3300025972 Bacteria 1654
123 Ga0207677_10248743 3300026023 Bacteria 1443
124 Ga0207708_10156442 3300026075 Bacteria 1798
125 Ga0207708_10228563 3300026075 Bacteria 1493
126 Ga0207708_10335799 3300026075 Bacteria 1236
127 Ga0207702_10132303 3300026078 Bacteria 2246
128 Ga0207702_10140640 3300026078 Bacteria 2184
129 Ga0207641_10431520 3300026088 Bacteria 1271
130 Ga0207648_10134402 3300026089 Bacteria 2178
131 Ga0207676_10052622 3300026095 Bacteria 3184
132 Ga0207674_10003106 3300026116 Bacteria 20505
133 Ga0207674_10046178 3300026116 Bacteria 4474
134 Ga0207675_100077252 3300026118 Bacteria 3119
135 Ga0207675_100086633 3300026118 Bacteria 2941
136 Ga0207683_10150518 3300026121 Bacteria 2100
137 Ga0207698_10115788 3300026142 Bacteria 2258
138 Ga0207428_10048109 3300027907 Bacteria 3423
139 Ga0207428_10053873 3300027907 Bacteria 3206
140 Ga0207428_10069735 3300027907 Bacteria 2764
141 Ga0207428_10167962 3300027907 Bacteria 1663
142 Ga0207428_10347509 3300027907 Bacteria 1092
143 Ga0268265_10751319 3300028380 Bacteria 947
144 Ga0265319_1003944 3300028563 Bacteria 7531
145 Ga0265319_1097321 3300028563 Unclassified 926
146 Ga0265318_10003898 3300028577 Bacteria 7355
147 Ga0265338_10005979 3300028800 Bacteria 15653
148 Ga0265338_10069539 3300028800 Bacteria 3024
149 Ga0265325_10093428 3300031241 Bacteria 1480
150 Ga0265340_10140802 3300031247 Bacteria 1103
151 Ga0265327_10013171 3300031251 Bacteria 5511
152 Ga0265327_10023668 3300031251 Bacteria 3632
153 Ga0265316_10045589 3300031344 Bacteria 3479
154 Ga0265316_10150787 3300031344 Bacteria 1742
155 Ga0307408_100179441 3300031548 Bacteria 1697
156 Ga0307405_10204127 3300031731 Bacteria 1438
157 Ga0307410_10079289 3300031852 Bacteria 2300
158 Ga0307406_10020396 3300031901 Bacteria 3902
159 Ga0307407_10008218 3300031903 Bacteria 4776
160 Ga0307409_100009182 3300031995 Bacteria 6059
161 Ga0307416_100021423 3300032002 Bacteria 4639
162 Ga0307414_10028613 3300032004 Bacteria 3617
163 Ga0307415_100078336 3300032126 Bacteria 2350
164 Ga0307415_100261128 3300032126 Bacteria 1413
165 Ga0373954_0192756 3300035118 Bacteria 1001
166 Ga0395899_0018803 3300037312 Bacteria 5250
167 Ga0395899_0065718 3300037312 Bacteria 2665
168 Ga0395900_0009498 3300037418 Bacteria 9971
169 Ga0395900_0048446 3300037418 Bacteria 4377
170 Ga0395900_0051464 3300037418 Bacteria 4242
171 Ga0395900_0086176 3300037418 Bacteria 3227
172 Ga0395900_0107212 3300037418 Bacteria 2870
173 Ga0395900_0127738 3300037418 Bacteria 2606
174 Ga0395900_0182922 3300037418 Bacteria 2129
175 Ga0395900_0253470 3300037418 Bacteria 1760
176 Ga0395900_0307204 3300037418 Bacteria 1570
177 Ga0395900_0416837 3300037418 Bacteria 1304
178 Ga0395898_0010765 3300037466 Bacteria 9554
179 Ga0395898_0030813 3300037466 Bacteria 5365
180 Ga0395898_0042853 3300037466 Bacteria 4463
181 Ga0395898_0089725 3300037466 Bacteria 2958
182 Ga0395898_0098281 3300037466 Bacteria 2811
183 Ga0395898_0140441 3300037466 Bacteria 2312
184 Ga0395905_0022548 3300037471 Bacteria 5955
185 Ga0395905_0026531 3300037471 Bacteria 5461
186 Ga0395905_0062535 3300037471 Bacteria 3482
187 Ga0395905_0187159 3300037471 Bacteria 1943
188 Ga0395905_0414361 3300037471 Bacteria 1243
189 Ga0395905_0492577 3300037471 Unclassified 1125
190 Ga0395905_0656983 3300037471 Bacteria 950
191 Ga0395901_0002845 3300038443 Bacteria 17467
192 Ga0395901_0025869 3300038443 Bacteria 6027
193 Ga0395901_0029638 3300038443 Bacteria 5635
194 Ga0395901_0054477 3300038443 Bacteria 4157
195 Ga0395901_0084854 3300038443 Bacteria 3310
196 Ga0395901_0099200 3300038443 Bacteria 3054
197 Ga0395901_0110937 3300038443 Bacteria 2880
198 Ga0395901_0198950 3300038443 Bacteria 2100
199 Ga0395901_0250265 3300038443 Bacteria 1846
200 Ga0395901_0407809 3300038443 Bacteria 1395
201 Ga0395901_0759432 3300038443 Unclassified 962
202 Ga0451793_0837178 3300041452 Bacteria 2639
203 Ga0451853_2664884 3300041512 Bacteria 1178
204 Ga0439448_0016133 3300042005 Bacteria 2271
205 Ga0439451_003341 3300042009 Bacteria 3249
206 Ga0439460_0068373 3300042461 Bacteria 1096
207 Ga0466966_0211861 3300044684 Bacteria 1171
208 Ga0466966_0368204 3300044684 Bacteria 863
209 Ga0466963_0012443 3300044694 Bacteria 5207
210 Ga0466968_0065261 3300044735 Bacteria 1576
211 Ga0451576_0209671 3300045051 Bacteria 2035
212 Ga0466958_0002528 3300045836 Bacteria 9216
213 Ga0466967_0013680 3300045976 Bacteria 6284
214 Ga0466967_0026498 3300045976 Bacteria 4803
215 Ga0466967_0028351 3300045976 Bacteria 4673
216 Ga0495653_0036381 3300046463 Bacteria 3878
217 Ga0495653_0059973 3300046463 Bacteria 2884
218 Ga0495608_0068384 3300046511 Bacteria 2322
219 Ga0495618_0123929 3300046514 Bacteria 1655
220 Ga0495620_0050385 3300046515 Bacteria 1777
221 Ga0495631_0096104 3300046518 Bacteria 1275
222 Ga0495663_0014245 3300046525 Bacteria 2227
223 Ga0495652_0399757 3300046529 Bacteria 973
224 Ga0495587_0047496 3300046536 Bacteria 2545
225 Ga0495609_0081380 3300046538 Bacteria 1416
226 Ga0495667_0015295 3300046559 Bacteria 5182
227 Ga0495656_0106776 3300046615 Bacteria 1303
228 Ga0495634_0173077 3300046642 Bacteria 1356
229 Ga0495635_0018022 3300046663 Bacteria 4929
230 Ga0495635_0068495 3300046663 Bacteria 2434
231 Ga0495659_0018609 3300046664 Bacteria 2316
232 Ga0495669_0322395 3300046684 Bacteria 746
233 Ga0495670_0029435 3300046691 Bacteria 2726
234 Ga0495671_0061684 3300046692 Bacteria 1849
235 Ga0495589_0078777 3300046794 Bacteria 1604
236 Ga0495660_0053026 3300046810 Bacteria 2203
237 Ga0495636_0200662 3300047318 Bacteria 911
238 Ga0495680_0002404 3300047322 Bacteria 19198
239 Ga0495680_0065056 3300047322 Bacteria 2794
240 Ga0495677_0010168 3300047445 Bacteria 3460
241 Ga0495684_0003586 3300047471 Bacteria 12108
242 Ga0496102_0187404 3300048905 Bacteria 1950
243 Ga0496103_0111819 3300048906 Bacteria 1736
244 Ga0496104_0061425 3300048907 Bacteria 3563
245 Ga0496107_0054913 3300048910 Bacteria 2876
246 Ga0496108_0053332 3300048911 Bacteria 3391
247 Ga0496108_0330561 3300048911 Bacteria 1329
248 Ga0496109_0011329 3300048912 Bacteria 7661
249 Ga0496109_0019294 3300048912 Bacteria 6009
250 Ga0496109_0044114 3300048912 Bacteria 4044
251 Ga0496110_0015042 3300048913 Bacteria 6434
252 Ga0496110_0016078 3300048913 Bacteria 6239
253 Ga0496110_0020365 3300048913 Bacteria 5601
254 Ga0496111_0010105 3300048914 Bacteria 6319
255 Ga0496111_0040427 3300048914 Bacteria 3345
256 Ga0496113_0193288 3300048916 Bacteria 1616
257 Ga0496114_0108610 3300048917 Bacteria 2375
258 Ga0501031_0148701 3300049568 Bacteria 1530
259 Ga0501031_0260399 3300049568 Bacteria 1127
260 Ga0501036_0005457 3300049572 Bacteria 10306
261 Ga0501036_0108123 3300049572 Bacteria 2352
262 Ga0501038_0115021 3300049574 Bacteria 2224
263 Ga0501038_0125829 3300049574 Bacteria 2110
264 Ga0501039_0014764 3300049575 Bacteria 5974
265 Ga0501039_0031694 3300049575 Bacteria 4076
266 Ga0501040_0009442 3300049576 Bacteria 6361
267 Ga0501041_0017269 3300049577 Bacteria 4293
268 Ga0501041_0120159 3300049577 Bacteria 1633
269 Ga0501041_0151526 3300049577 Unclassified 1448
270 Ga0501042_0024013 3300049578 Bacteria 4272
271 Ga0501043_0103817 3300049579 Bacteria 2233
272 Ga0501046_0164970 3300049580 Bacteria 1664
273 Ga0501048_0016146 3300049582 Bacteria 5504
274 Ga0501048_0024043 3300049582 Bacteria 4449
275 Ga0501048_0199368 3300049582 Bacteria 1419
276 Ga0501067_0013637 3300049583 Bacteria 4499
277 Ga0501067_0066318 3300049583 Bacteria 1998
278 Ga0501068_0009812 3300049584 Bacteria 5363
279 Ga0501068_0053203 3300049584 Bacteria 2450
280 Ga0501069_0002218 3300049585 Bacteria 9794
281 Ga0501070_0473265 3300049586 Bacteria 1008
282 Ga0501071_0009622 3300049587 Bacteria 6449
283 Ga0501071_0301558 3300049587 Archaea 1215
284 Ga0501072_0024391 3300049588 Bacteria 4704
285 Ga0501072_0026888 3300049588 Bacteria 4489
286 Ga0501072_0295608 3300049588 Bacteria 1287
287 Ga0501072_0328724 3300049588 Bacteria 1215
288 Ga0501074_0022622 3300049590 Bacteria 4570
289 Ga0501075_0019391 3300049591 Bacteria 4933
290 Ga0501075_0023830 3300049591 Bacteria 4482
291 Ga0501075_0298765 3300049591 Bacteria 1227
292 Ga0501076_0009339 3300049592 Bacteria 7238
293 Ga0501076_0051868 3300049592 Bacteria 3247
294 Ga0501076_0081034 3300049592 Bacteria 2606
295 Ga0501077_0003832 3300049593 Bacteria 9059
296 Ga0501077_0087416 3300049593 Bacteria 1976
297 Ga0501079_0017310 3300049741 Bacteria 5503
298 Ga0501079_0027640 3300049741 Bacteria 4351
299 Ga0501079_0137102 3300049741 Bacteria 1906
300 Ga0501080_0108869 3300049742 Bacteria 2568
301 Ga0501080_0125561 3300049742 Bacteria 2377
302 Ga0501081_0039595 3300049743 Bacteria 3226
303 Ga0501081_0066521 3300049743 Bacteria 2506
304 Ga0501035_0030493 3300049822 Bacteria 4915
305 Ga0501044_0201565 3300049823 Bacteria 1948
306 Ga0501045_0014662 3300049824 Bacteria 5557
307 Ga0501045_0453057 3300049824 Unclassified 954
308 Ga0501204_013856 3300049850 Bacteria 984
309 nmdc:mga05p37_255564_c1 3300050507 Bacteria 2100
310 nmdc:mga09592_134825_c1 3300050508 Bacteria 2126
311 nmdc:mga0qj67_193410_c1 3300050509 Bacteria 1653
312 nmdc:mga06r32_141016_c1 3300050510 Bacteria 2386
313 nmdc:mga06r32_98600_c1 3300050510 Bacteria 2865
314 nmdc:mga08y16_151082_c1 3300050511 Bacteria 2414
315 nmdc:mga08y16_18694_c1 3300050511 Bacteria 7300
316 nmdc:mga08y16_29174_c1 3300050511 Bacteria 5814
317 nmdc:mga08y16_75986_c1 3300050511 Bacteria 3501
318 Ga0495655_0045831 3300053083 Bacteria 1137
319 Ga0495655_0111581 3300053083 Unclassified 822
320 Ga0495595_0038453 3300053084 Bacteria 2180
321 Ga0495619_0017485 3300053085 Bacteria 4540
322 Ga0501084_0017813 3300054114 Bacteria 5911
323 Ga0501084_0037624 3300054114 Bacteria 4044
324 Ga0501084_0196702 3300054114 Bacteria 1701
325 Ga0587066_000347 3300059490 Bacteria 3538
326 Ga0587066_000561 3300059490 Bacteria 3120
327 Ga0587073_0002302 3300059492 Bacteria 2417
328 Ga0587091_001567 3300059511 Bacteria 2511
329 Ga0587106_001316 3300059605 Bacteria 2159
330 Ga0587067_000211 3300059640 Bacteria 4380
331 Ga0587107_001785 3300059652 Bacteria 1819
332 Ga0587111_0017418 3300060346 Bacteria 1339
333 Ga0501082_0060619 3300060353 Bacteria 3257
334 Ga0501082_0486336 3300060353 Bacteria 1079
335 Ga0530510_0008187 3300061734 Bacteria 7293
336 Ga0530510_0093208 3300061734 Bacteria 2198
337 Ga0530510_0455259 3300061734 Bacteria 968
338 Ga0163162_10171433
339 JGI25407J50210_10006211
340 Ga0070658_10188452
341 Ga0070683_100035105
342 Ga0070683_100190730
343 Ga0068869_100158742
344 Ga0070682_100010510
345 Ga0070660_100005578
346 Ga0070689_100305747
347 Ga0070687_100307859
348 Ga0070673_100181166
349 Ga0070673_100294922
350 Ga0070714_100044284
351 Ga0070714_100141311
352 Ga0070701_10062051
353 Ga0070700_100676838
354 Ga0070694_100215896
355 Ga0070708_100015864
356 Ga0070708_100072736
357 Ga0070681_10051357
358 Ga0070681_10090639
359 Ga0070706_100285669
360 Ga0070707_100012768
361 Ga0070707_100221848
362 Ga0070707_100829563
363 Ga0070698_100017348
364 Ga0070698_100060656
365 Ga0070679_100038145
366 Ga0070684_100101940
367 Ga0070684_100588048
368 Ga0070686_100044820
369 Ga0070664_100444182
370 Ga0068857_100021239
371 Ga0068857_100386803
372 Ga0068856_100311873
373 Ga0068864_100037273
374 Ga0068861_100231916
375 Ga0068861_100397673
376 Ga0068870_10099911
377 Ga0068862_100253470
378 Ga0081455_10063808
379 Ga0081455_10162772
380 Ga0081538_10001401
381 Ga0081538_10003901
382 Ga0081538_10004499
383 Ga0081538_10004997
384 Ga0081538_10005238
385 Ga0081538_10023684
386 Ga0081538_10039958
387 Ga0081538_10064137
388 Ga0081538_10126670
389 Ga0070717_10588837
390 Ga0075432_10053565
391 Ga0075362_10183014
392 Ga0075428_100133096
393 Ga0075428_100166998
394 Ga0075430_100157934
395 Ga0075431_100029656
396 Ga0075433_10005570
397 Ga0075434_100010665
398 Ga0075434_100039865
399 Ga0075435_100020774
400 Ga0075435_100077926
401 Ga0105240_10636039
402 Ga0111539_10009767
403 Ga0111539_10018950
404 Ga0111539_10050410
405 Ga0111539_10094794
406 Ga0111539_10909096
407 Ga0105245_10024780
408 Ga0105245_10026644
409 Ga0105245_10077956
410 Ga0114129_10300143
411 Ga0114129_10695325
412 Ga0105243_10112376
413 Ga0105243_10187344
414 Ga0105242_10096202
415 Ga0105248_10054934
416 Ga0105249_10102087
417 Ga0105249_10191934
418 Ga0105239_10316947
419 Ga0105239_10418824
420 Ga0105246_10233052
421 Ga0157373_10446245
422 Ga0157369_10005310
423 Ga0163162_10145082
424 Ga0163162_10709867
425 Ga0157375_10529451
426 Ga0163163_10121540
427 Ga0182008_10009714
428 Ga0157377_10062478
429 Ga0207688_10013604
430 Ga0207688_10078569
431 Ga0207699_10254644
432 Ga0207643_10021900
433 Ga0207643_10195446
434 Ga0207707_10234799
435 Ga0207693_10009287
436 Ga0207693_10012438
437 Ga0207693_10419588
438 Ga0207660_10083925
439 Ga0207660_10154117
440 Ga0207657_10017829
441 Ga0207652_10005189
442 Ga0207646_10221292
443 Ga0207687_10040631
444 Ga0207687_10219176
445 Ga0207664_10008406
446 Ga0207664_10009386
447 Ga0207664_10220266
448 Ga0207690_10053265
449 Ga0207709_10127908
450 Ga0207709_10322740
451 Ga0207669_10265213
452 Ga0207689_10184566
453 Ga0207661_10114338
454 Ga0207661_10653463
455 Ga0207679_10275777
456 Ga0207679_10740846
457 Ga0207651_10316792
458 Ga0207712_10144946
459 Ga0207668_10183220
460 Ga0207677_10248743
461 Ga0207708_10156442
462 Ga0207708_10228563
463 Ga0207708_10335799
464 Ga0207702_10132303
465 Ga0207702_10140640
466 Ga0207641_10431520
467 Ga0207648_10134402
468 Ga0207676_10052622
469 Ga0207674_10003106
470 Ga0207674_10046178
471 Ga0207675_100077252
472 Ga0207675_100086633
473 Ga0207683_10150518
474 Ga0207698_10115788
475 Ga0207428_10048109
476 Ga0207428_10053873
477 Ga0207428_10069735
478 Ga0207428_10167962
479 Ga0207428_10347509
480 Ga0268265_10751319
481 Ga0265319_1003944
482 Ga0265319_1097321
483 Ga0265318_10003898
484 Ga0265338_10005979
485 Ga0265338_10069539
486 Ga0265325_10093428
487 Ga0265340_10140802
488 Ga0265327_10013171
489 Ga0265327_10023668
490 Ga0265316_10045589
491 Ga0265316_10150787
492 Ga0307408_100179441
493 Ga0307405_10204127
494 Ga0307410_10079289
495 Ga0307406_10020396
496 Ga0307407_10008218
497 Ga0307409_100009182
498 Ga0307416_100021423
499 Ga0307414_10028613
500 Ga0307415_100078336
501 Ga0307415_100261128
502 Ga0373954_0192756
503 Ga0395899_0018803
504 Ga0395899_0065718
505 Ga0395900_0009498
506 Ga0395900_0048446
507 Ga0395900_0051464
508 Ga0395900_0086176
509 Ga0395900_0107212
510 Ga0395900_0127738
511 Ga0395900_0182922
512 Ga0395900_0253470
513 Ga0395900_0307204
514 Ga0395900_0416837
515 Ga0395898_0010765
516 Ga0395898_0030813
517 Ga0395898_0042853
518 Ga0395898_0089725
519 Ga0395898_0098281
520 Ga0395898_0140441
521 Ga0395905_0022548
522 Ga0395905_0026531
523 Ga0395905_0062535
524 Ga0395905_0187159
525 Ga0395905_0414361
526 Ga0395905_0492577
527 Ga0395905_0656983
528 Ga0395901_0002845
529 Ga0395901_0025869
530 Ga0395901_0029638
531 Ga0395901_0054477
532 Ga0395901_0084854
533 Ga0395901_0099200
534 Ga0395901_0110937
535 Ga0395901_0198950
536 Ga0395901_0250265
537 Ga0395901_0407809
538 Ga0395901_0759432
539 Ga0451793_0837178
540 Ga0451853_2664884
541 Ga0439448_0016133
542 Ga0439451_003341
543 Ga0439460_0068373
544 Ga0466966_0211861
545 Ga0466966_0368204
546 Ga0466963_0012443
547 Ga0466968_0065261
548 Ga0451576_0209671
549 Ga0466958_0002528
550 Ga0466967_0013680
551 Ga0466967_0026498
552 Ga0466967_0028351
553 Ga0495653_0036381
554 Ga0495653_0059973
555 Ga0495608_0068384
556 Ga0495618_0123929
557 Ga0495620_0050385
558 Ga0495631_0096104
559 Ga0495663_0014245
560 Ga0495652_0399757
561 Ga0495587_0047496
562 Ga0495609_0081380
563 Ga0495667_0015295
564 Ga0495656_0106776
565 Ga0495634_0173077
566 Ga0495635_0018022
567 Ga0495635_0068495
568 Ga0495659_0018609
569 Ga0495669_0322395
570 Ga0495670_0029435
571 Ga0495671_0061684
572 Ga0495589_0078777
573 Ga0495660_0053026
574 Ga0495636_0200662
575 Ga0495680_0002404
576 Ga0495680_0065056
577 Ga0495677_0010168
578 Ga0495684_0003586
579 Ga0496102_0187404
580 Ga0496103_0111819
581 Ga0496104_0061425
582 Ga0496107_0054913
583 Ga0496108_0053332
584 Ga0496108_0330561
585 Ga0496109_0011329
586 Ga0496109_0019294
587 Ga0496109_0044114
588 Ga0496110_0015042
589 Ga0496110_0016078
590 Ga0496110_0020365
591 Ga0496111_0010105
592 Ga0496111_0040427
593 Ga0496113_0193288
594 Ga0496114_0108610
595 Ga0501031_0148701
596 Ga0501031_0260399
597 Ga0501036_0005457
598 Ga0501036_0108123
599 Ga0501038_0115021
600 Ga0501038_0125829
601 Ga0501039_0014764
602 Ga0501039_0031694
603 Ga0501040_0009442
604 Ga0501041_0017269
605 Ga0501041_0120159
606 Ga0501041_0151526
607 Ga0501042_0024013
608 Ga0501043_0103817
609 Ga0501046_0164970
610 Ga0501048_0016146
611 Ga0501048_0024043
612 Ga0501048_0199368
613 Ga0501067_0013637
614 Ga0501067_0066318
615 Ga0501068_0009812
616 Ga0501068_0053203
617 Ga0501069_0002218
618 Ga0501070_0473265
619 Ga0501071_0009622
620 Ga0501071_0301558
621 Ga0501072_0024391
622 Ga0501072_0026888
623 Ga0501072_0295608
624 Ga0501072_0328724
625 Ga0501074_0022622
626 Ga0501075_0019391
627 Ga0501075_0023830
628 Ga0501075_0298765
629 Ga0501076_0009339
630 Ga0501076_0051868
631 Ga0501076_0081034
632 Ga0501077_0003832
633 Ga0501077_0087416
634 Ga0501079_0017310
635 Ga0501079_0027640
636 Ga0501079_0137102
637 Ga0501080_0108869
638 Ga0501080_0125561
639 Ga0501081_0039595
640 Ga0501081_0066521
641 Ga0501035_0030493
642 Ga0501044_0201565
643 Ga0501045_0014662
644 Ga0501045_0453057
645 Ga0501204_013856
646 nmdc:mga05p37_255564_c1
647 nmdc:mga09592_134825_c1
648 nmdc:mga0qj67_193410_c1
649 nmdc:mga06r32_141016_c1
650 nmdc:mga06r32_98600_c1
651 nmdc:mga08y16_151082_c1
652 nmdc:mga08y16_18694_c1
653 nmdc:mga08y16_29174_c1
654 nmdc:mga08y16_75986_c1
655 Ga0495655_0045831
656 Ga0495655_0111581
657 Ga0495595_0038453
658 Ga0495619_0017485
659 Ga0501084_0017813
660 Ga0501084_0037624
661 Ga0501084_0196702
662 Ga0587066_000347
663 Ga0587066_000561
664 Ga0587073_0002302
665 Ga0587091_001567
666 Ga0587106_001316
667 Ga0587067_000211
668 Ga0587107_001785
669 Ga0587111_0017418
670 Ga0501082_0060619
671 Ga0501082_0486336
672 Ga0530510_0008187
673 Ga0530510_0093208
674 Ga0530510_0455259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

218

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

282

0.9

PF08659

KR

KR domain

42

196

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhb-assembly1.cif.gz_B-2 crystal structure of nadph and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa 0.9203 1 231
6jha-assembly1.cif.gz_B-2 crystal structure of nadph bound aerf from microcystis aeruginosa 0.9144 1 231
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9135 4 233
4dbz-assembly1.cif.gz_B crystal structure of v151l actinorhodin polyketide ketoreductase with nadph 0.9126 7 234
3wds-assembly1.cif.gz_C crystal structure of 3-quinuclidinone reductase from agrobacterium tumefaciens 0.912 3 233
ID Description Score Start End Superfamily
af_I1NC40_321_496_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 5 58 3.40.50.720
af_Q869Y3_41_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9213 9 164 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9189 5 164 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9171 3 58 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.916 4 155 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B2WW62-F1-model_v4 deleted 0.974 71 209
AF-A0A7V9I513-F1-model_v4 SDR family oxidoreductase 0.9652 1 213 GO:0016491
AF-A0A6B2WW62-F1-model_v4 deleted 0.9605 71 209
AF-A0A3C1N4A3-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase 0.9495 66 230 GO:0016491
AF-A0A1P8YHG4-F1-model_v4 Enoyl-(Acyl carrier) reductase family protein 0.9465 87 236

Map