F413050

General Info

Members Datasets Scaffolds Average Seq Length
337 207 674 262

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10016388|Ga0105245_100163887
Length 292
Sequence MAAGTSPEALRTLQQRYLSKGSSMNSSTLTAPLSKGSDRLLGKKVLVTGSSKGIGRGIAIRLAEEGADVVINYNSDPKGAEEALANVEALGRRGAIIKANLGTVDEVRDLVARSADALGGLDVLVNNAGIEKHAAFWDVTENDFDAVLNVNLKGVFFATQAFVQQCITARLPGKIVNISSVHEELAFPNFAAYCASKGGVRMLTRTLAVELGPLGITINSIAPGAIETPINTKLLNDPVKLNSLVGQIPLSRLGKPNDVAGLAVFLASPDSDYVTGTTYLIDGGLTVFYKEQ

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
201 2818991437 Pedobacter terrae 518 Isolate Unclassified
202 2831426010 Nostoc sp. 106C Isolate Unclassified
203 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
204 2849660919 Nostoc sp. T09 Isolate Unclassified
205 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
206 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
207 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 0.59
Rhizoplane 7.72
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10016388 3300009098 Bacteria 6464
2 rootH2_10024231 3300003320 Bacteria 20882
3 Ga0055537_1000162 3300003773 Bacteria 50062
4 Ga0055537_1001048 3300003773 Bacteria 12394
5 Ga0055534_1000128 3300003784 Bacteria 56698
6 Ga0055528_1000590 3300003790 Bacteria 27346
7 Ga0065712_10001553 3300005290 Bacteria 11090
8 Ga0065712_10185051 3300005290 Unclassified 1174
9 Ga0065715_10000455 3300005293 Bacteria 20802
10 Ga0065707_10126239 3300005295 Bacteria 2007
11 Ga0070670_100001234 3300005331 Bacteria 20344
12 Ga0070670_100064323 3300005331 Bacteria 3147
13 Ga0070677_10074532 3300005333 Unclassified 1436
14 Ga0068869_100222328 3300005334 Bacteria 1497
15 Ga0070666_10028944 3300005335 Bacteria 3639
16 Ga0070666_10224579 3300005335 Bacteria 1325
17 Ga0068868_100058091 3300005338 Bacteria 3057
18 Ga0068868_100180590 3300005338 Bacteria 1751
19 Ga0068868_100276885 3300005338 Bacteria 1419
20 Ga0070687_100187470 3300005343 Bacteria 1244
21 Ga0070668_100127472 3300005347 Bacteria 2040
22 Ga0070669_100040157 3300005353 Bacteria 3401
23 Ga0070669_100134282 3300005353 Bacteria 1902
24 Ga0070669_100380774 3300005353 Bacteria 1150
25 Ga0070675_100000819 3300005354 Bacteria 21941
26 Ga0070675_100020919 3300005354 Bacteria 5224
27 Ga0070675_100138432 3300005354 Bacteria 2079
28 Ga0070675_100182493 3300005354 Bacteria 1815
29 Ga0070671_100057197 3300005355 Bacteria 3245
30 Ga0070671_100385931 3300005355 Bacteria 1197
31 Ga0070674_100032131 3300005356 Bacteria 3483
32 Ga0070674_100210034 3300005356 Bacteria 1508
33 Ga0070674_100286734 3300005356 Unclassified 1307
34 Ga0070674_100631071 3300005356 Bacteria 909
35 Ga0070673_100013628 3300005364 Bacteria 5631
36 Ga0070688_100126238 3300005365 Bacteria 1720
37 Ga0070667_100135598 3300005367 Bacteria 2152
38 Ga0070709_10058705 3300005434 Bacteria 2441
39 Ga0070701_10032437 3300005438 Bacteria 2601
40 Ga0070694_100052653 3300005444 Bacteria 2752
41 Ga0070663_100141108 3300005455 Bacteria 1840
42 Ga0070678_100085095 3300005456 Bacteria 2409
43 Ga0070678_100269252 3300005456 Bacteria 1436
44 Ga0070678_100353746 3300005456 Bacteria 1264
45 Ga0070678_100466766 3300005456 Unclassified 1108
46 Ga0070662_100376846 3300005457 Bacteria 1167
47 Ga0068867_100264031 3300005459 Bacteria 1405
48 Ga0070685_10353747 3300005466 Bacteria 1005
49 Ga0070707_100197307 3300005468 Bacteria 1962
50 Ga0070707_100386584 3300005468 Bacteria 1359
51 Ga0070698_100043189 3300005471 Unclassified 4623
52 Ga0070698_100756160 3300005471 Bacteria 915
53 Ga0070684_100680956 3300005535 Bacteria 958
54 Ga0070697_100063788 3300005536 Unclassified 3009
55 Ga0070672_100260758 3300005543 Bacteria 1462
56 Ga0070695_100133682 3300005545 Bacteria 1712
57 Ga0070696_100339684 3300005546 Bacteria 1160
58 Ga0070665_100009257 3300005548 Bacteria 9974
59 Ga0070665_100012963 3300005548 Bacteria 8396
60 Ga0070665_100013446 3300005548 Bacteria 8234
61 Ga0070664_100233327 3300005564 Bacteria 1650
62 Ga0070664_100452717 3300005564 Bacteria 1179
63 Ga0068854_100157505 3300005578 Bacteria 1756
64 Ga0068852_100390687 3300005616 Bacteria 1366
65 Ga0068859_100004423 3300005617 Bacteria 14339
66 Ga0068859_100010225 3300005617 Bacteria 9442
67 Ga0068859_100015703 3300005617 Bacteria 7610
68 Ga0068859_100544682 3300005617 Bacteria 1255
69 Ga0068864_100016370 3300005618 Bacteria 6173
70 Ga0068864_100044631 3300005618 Bacteria 3801
71 Ga0068866_10060092 3300005718 Bacteria 1969
72 Ga0068866_10229523 3300005718 Bacteria 1125
73 Ga0068861_100048136 3300005719 Bacteria 3222
74 Ga0068863_100191354 3300005841 Bacteria 1966
75 Ga0068858_100001201 3300005842 Bacteria 26865
76 Ga0068858_100005007 3300005842 Bacteria 12982
77 Ga0068858_100163419 3300005842 Bacteria 2097
78 Ga0068860_100297834 3300005843 Bacteria 1579
79 Ga0068860_100792474 3300005843 Bacteria 961
80 Ga0068862_100131240 3300005844 Bacteria 2216
81 Ga0068862_100526363 3300005844 Bacteria 1126
82 Ga0081539_10001514 3300005985 Bacteria 39031
83 Ga0081539_10002390 3300005985 Bacteria 26723
84 Ga0075364_10043265 3300006051 Bacteria 2928
85 Ga0075364_10143043 3300006051 Bacteria 1610
86 Ga0075364_10147352 3300006051 Bacteria 1585
87 Ga0075364_10245324 3300006051 Bacteria 1217
88 Ga0075367_10022703 3300006178 Bacteria 3522
89 Ga0075367_10026856 3300006178 Bacteria 3269
90 Ga0075366_10040780 3300006195 Bacteria 2746
91 Ga0075366_10257089 3300006195 Bacteria 1066
92 Ga0097621_100000043 3300006237 Bacteria 65396
93 Ga0097621_100320407 3300006237 Bacteria 1373
94 Ga0097621_100415012 3300006237 Bacteria 1207
95 Ga0075370_10015433 3300006353 Bacteria 4090
96 Ga0068871_100000775 3300006358 Bacteria 21520
97 Ga0068871_100431287 3300006358 Bacteria 1178
98 Ga0075428_100085843 3300006844 Bacteria 3433
99 Ga0075433_10293368 3300006852 Bacteria 1440
100 Ga0075434_100199321 3300006871 Bacteria 2021
101 Ga0075434_100831620 3300006871 Bacteria 939
102 Ga0068865_100002067 3300006881 Bacteria 11855
103 Ga0068865_100045321 3300006881 Bacteria 3015
104 Ga0068865_100273939 3300006881 Bacteria 1341
105 Ga0075436_100012573 3300006914 Bacteria 5801
106 Ga0097620_100004423 3300006931 Bacteria 14339
107 Ga0097620_100010225 3300006931 Bacteria 9442
108 Ga0097620_100015703 3300006931 Bacteria 7610
109 Ga0097620_100544651 3300006931 Bacteria 1255
110 Ga0099826_10000576 3300006948 Bacteria 18492
111 Ga0075435_100000304 3300007076 Bacteria 30337
112 Ga0075435_100180786 3300007076 Bacteria 1782
113 Ga0099794_10003017 3300007265 Bacteria 6362
114 Ga0099794_10131776 3300007265 Bacteria 1263
115 Ga0105240_10106779 3300009093 Bacteria 3395
116 Ga0105245_10052010 3300009098 Bacteria 3673
117 Ga0105247_10053254 3300009101 Bacteria 2496
118 Ga0114129_10187136 3300009147 Bacteria 2813
119 Ga0114129_10194498 3300009147 Bacteria 2751
120 Ga0114129_10829685 3300009147 Bacteria 1177
121 Ga0105241_10137616 3300009174 Bacteria 1985
122 Ga0105242_10023599 3300009176 Bacteria 4848
123 Ga0105242_10147588 3300009176 Bacteria 2047
124 Ga0105242_10337115 3300009176 Bacteria 1388
125 Ga0105242_10408071 3300009176 Bacteria 1270
126 Ga0105248_10002903 3300009177 Bacteria 19022
127 Ga0105248_10006202 3300009177 Bacteria 13107
128 Ga0105248_10046555 3300009177 Bacteria 4861
129 Ga0105248_10102728 3300009177 Bacteria 3222
130 Ga0105248_10196384 3300009177 Bacteria 2273
131 Ga0105248_10229443 3300009177 Bacteria 2090
132 Ga0105248_10230491 3300009177 Bacteria 2085
133 Ga0105249_10006208 3300009553 Bacteria 10377
134 Ga0105239_10357025 3300010375 Bacteria 1650
135 Ga0105239_10377304 3300010375 Bacteria 1603
136 Ga0105246_10184596 3300011119 Bacteria 1609
137 Ga0105246_10298232 3300011119 Bacteria 1300
138 Ga0157374_10264732 3300013296 Bacteria 1694
139 Ga0163162_10041916 3300013306 Bacteria 4580
140 Ga0163162_10102377 3300013306 Bacteria 2957
141 Ga0163162_10129387 3300013306 Bacteria 2633
142 Ga0157372_10200761 3300013307 Bacteria 2310
143 Ga0157375_10036727 3300013308 Bacteria 4689
144 Ga0157375_10640076 3300013308 Bacteria 1220
145 Ga0163163_10095548 3300014325 Bacteria 2992
146 Ga0163163_10110918 3300014325 Bacteria 2772
147 Ga0163163_10196857 3300014325 Bacteria 2063
148 Ga0163163_10223561 3300014325 Bacteria 1931
149 Ga0163163_10592943 3300014325 Bacteria 1171
150 Ga0157380_10042596 3300014326 Bacteria 3549
151 Ga0182008_10000227 3300014497 Bacteria 44000
152 Ga0157379_10056666 3300014968 Bacteria 3501
153 Ga0157379_10144119 3300014968 Bacteria 2148
154 Ga0157379_10185102 3300014968 Bacteria 1882
155 Ga0157379_10449101 3300014968 Bacteria 1190
156 Ga0157379_10595576 3300014968 Bacteria 1032
157 Ga0157376_10000387 3300014969 Bacteria 28666
158 Ga0157376_10103919 3300014969 Bacteria 2488
159 Ga0163161_10416284 3300017792 Bacteria 1080
160 Ga0209565_1000229 3300025263 Bacteria 61660
161 Ga0209673_1000463 3300025273 Bacteria 68460
162 Ga0209675_1000186 3300025291 Bacteria 68471
163 Ga0209025_1018826 3300025294 Bacteria 3885
164 Ga0209051_1038232 3300025303 Bacteria 1749
165 Ga0207682_10095799 3300025893 Unclassified 1292
166 Ga0207710_10027962 3300025900 Bacteria 2445
167 Ga0207688_10279811 3300025901 Bacteria 1016
168 Ga0207680_10055838 3300025903 Bacteria 2382
169 Ga0207680_10304097 3300025903 Bacteria 1112
170 Ga0207680_10428928 3300025903 Bacteria 937
171 Ga0207654_10165409 3300025911 Bacteria 1432
172 Ga0207662_10003346 3300025918 Bacteria 8231
173 Ga0207646_10016706 3300025922 Bacteria 6884
174 Ga0207681_10075956 3300025923 Bacteria 2358
175 Ga0207681_10533397 3300025923 Bacteria 964
176 Ga0207650_10008209 3300025925 Bacteria 7123
177 Ga0207650_10018162 3300025925 Bacteria 4932
178 Ga0207659_10005105 3300025926 Bacteria 7955
179 Ga0207659_10126838 3300025926 Bacteria 1964
180 Ga0207659_10419365 3300025926 Bacteria 1122
181 Ga0207687_10046083 3300025927 Bacteria 3017
182 Ga0207687_10199687 3300025927 Bacteria 1562
183 Ga0207644_10041646 3300025931 Bacteria 3250
184 Ga0207644_10137330 3300025931 Bacteria 1879
185 Ga0207706_10099454 3300025933 Bacteria 2559
186 Ga0207706_10539917 3300025933 Bacteria 1004
187 Ga0207686_10116234 3300025934 Bacteria 1813
188 Ga0207686_10144481 3300025934 Bacteria 1648
189 Ga0207669_10006695 3300025937 Bacteria 5284
190 Ga0207669_10075275 3300025937 Bacteria 2138
191 Ga0207669_10127579 3300025937 Bacteria 1741
192 Ga0207704_10038930 3300025938 Bacteria 2763
193 Ga0207665_10125592 3300025939 Bacteria 1816
194 Ga0207691_10028011 3300025940 Bacteria 5279
195 Ga0207691_10336350 3300025940 Bacteria 1293
196 Ga0207711_10004047 3300025941 Bacteria 12582
197 Ga0207711_10010740 3300025941 Bacteria 7617
198 Ga0207711_10037851 3300025941 Bacteria 4100
199 Ga0207711_10109326 3300025941 Bacteria 2457
200 Ga0207711_10186268 3300025941 Bacteria 1890
201 Ga0207711_10491833 3300025941 Bacteria 1143
202 Ga0207679_10278172 3300025945 Bacteria 1434
203 Ga0207679_10415079 3300025945 Bacteria 1187
204 Ga0207651_10021379 3300025960 Bacteria 3932
205 Ga0207651_10531519 3300025960 Bacteria 1020
206 Ga0207640_10095282 3300025981 Bacteria 2072
207 Ga0207658_10185338 3300025986 Bacteria 1726
208 Ga0207703_10002676 3300026035 Bacteria 15303
209 Ga0207703_10286027 3300026035 Bacteria 1499
210 Ga0207678_10026521 3300026067 Bacteria 5054
211 Ga0207678_10138928 3300026067 Bacteria 2073
212 Ga0207708_10194285 3300026075 Bacteria 1617
213 Ga0207648_10098912 3300026089 Bacteria 2554
214 Ga0207676_10011943 3300026095 Bacteria 6215
215 Ga0207674_10346424 3300026116 Bacteria 1436
216 Ga0207675_100081984 3300026118 Bacteria 3025
217 Ga0207675_100270370 3300026118 Bacteria 1649
218 Ga0207683_10044999 3300026121 Bacteria 3859
219 Ga0207683_10081805 3300026121 Bacteria 2867
220 Ga0207683_10256799 3300026121 Bacteria 1595
221 Ga0207683_10577557 3300026121 Archaea 1040
222 Ga0209282_1000260 3300027666 Bacteria 26414
223 Ga0209588_1015156 3300027671 Bacteria 2368
224 Ga0268266_10016896 3300028379 Bacteria 6235
225 Ga0268266_10046385 3300028379 Bacteria 3720
226 Ga0268265_10044668 3300028380 Bacteria 3301
227 Ga0268265_10067047 3300028380 Bacteria 2777
228 Ga0268265_10262908 3300028380 Bacteria 1535
229 Ga0268264_10118257 3300028381 Bacteria 2332
230 Ga0307408_100215823 3300031548 Bacteria 1562
231 Ga0307405_10266621 3300031731 Bacteria 1282
232 Ga0307413_10297148 3300031824 Bacteria 1223
233 Ga0307410_10014009 3300031852 Bacteria 4701
234 Ga0307406_10262785 3300031901 Bacteria 1307
235 Ga0307407_10000574 3300031903 Bacteria 11601
236 Ga0307412_10056403 3300031911 Bacteria 2618
237 Ga0307409_100060528 3300031995 Bacteria 2953
238 Ga0307409_100085825 3300031995 Bacteria 2560
239 Ga0307409_100296410 3300031995 Bacteria 1502
240 Ga0307416_100122592 3300032002 Bacteria 2321
241 Ga0307416_100323455 3300032002 Bacteria 1546
242 Ga0307414_10139479 3300032004 Bacteria 1896
243 Ga0307414_10163491 3300032004 Bacteria 1771
244 Ga0307414_10315401 3300032004 Bacteria 1329
245 Ga0373935_0153017 3300035692 Bacteria 1567
246 Ga0436364_0806130 3300037853 Bacteria 1600
247 Ga0436360_0369913 3300039438 Bacteria 1096
248 Ga0436361_0792253 3300039447 Bacteria 3904
249 Ga0436363_1530451 3300039450 Bacteria 1321
250 Ga0439439_0010499 3300041406 Bacteria 2215
251 Ga0439462_0005900 3300042015 Bacteria 3032
252 Ga0450923_039849 3300042125 Bacteria 984
253 Ga0450896_005811 3300042133 Bacteria 1687
254 Ga0450906_030744 3300042145 Bacteria 949
255 Ga0439446_0039433 3300042156 Bacteria 1387
256 Ga0466963_0070951 3300044694 Bacteria 2344
257 Ga0495638_0040589 3300046460 Bacteria 2949
258 Ga0495638_0041569 3300046460 Bacteria 2907
259 Ga0495582_0214326 3300046473 Bacteria 1101
260 Ga0495584_0044287 3300046491 Bacteria 2246
261 Ga0495642_0115100 3300046528 Bacteria 1152
262 Ga0495586_0325139 3300046535 Bacteria 882
263 Ga0495634_0140266 3300046642 Bacteria 1535
264 Ga0495635_0121361 3300046663 Bacteria 1783
265 Ga0495658_0123671 3300046683 Bacteria 1567
266 Ga0495613_0122140 3300046689 Bacteria 1870
267 Ga0495649_0155810 3300046694 Bacteria 1199
268 Ga0495636_0018103 3300047318 Bacteria 2826
269 Ga0496100_0639449 3300048903 Bacteria 828
270 Ga0496101_0000344 3300048904 Bacteria 31365
271 Ga0496101_0117136 3300048904 Bacteria 2011
272 Ga0496101_0412048 3300048904 Bacteria 1065
273 Ga0496102_0303984 3300048905 Bacteria 1503
274 Ga0496103_0071767 3300048906 Bacteria 2168
275 Ga0496104_0013567 3300048907 Bacteria 7344
276 Ga0496104_0086442 3300048907 Bacteria 2994
277 Ga0496104_0278820 3300048907 Bacteria 1585
278 Ga0496104_0399566 3300048907 Bacteria 1286
279 Ga0496105_0125555 3300048908 Bacteria 2115
280 Ga0496106_0035849 3300048909 Bacteria 3710
281 Ga0496106_0048802 3300048909 Bacteria 3189
282 Ga0496106_0050338 3300048909 Bacteria 3140
283 Ga0496106_0277844 3300048909 Bacteria 1342
284 Ga0496109_0010743 3300048912 Bacteria 7837
285 Ga0496109_0498084 3300048912 Bacteria 1150
286 Ga0496110_0083884 3300048913 Bacteria 2843
287 Ga0496111_0091677 3300048914 Bacteria 2227
288 Ga0496112_0025881 3300048915 Bacteria 5638
289 Ga0496112_0381675 3300048915 Bacteria 1350
290 Ga0496113_0110489 3300048916 Bacteria 2139
291 Ga0496114_0000199 3300048917 Bacteria 43799
292 Ga0496114_0013225 3300048917 Bacteria 6616
293 Ga0496114_0174504 3300048917 Bacteria 1875
294 Ga0496115_0121490 3300048918 Bacteria 2149
295 Ga0496125_0000231 3300048928 Bacteria 114178
296 Ga0496125_0253919 3300048928 Bacteria 1107
297 Ga0496126_0001147 3300048929 Bacteria 43959
298 Ga0501031_0252152 3300049568 Bacteria 1147
299 Ga0501034_0290087 3300049571 Bacteria 1574
300 Ga0501036_0434699 3300049572 Bacteria 1094
301 Ga0501038_0201757 3300049574 Bacteria 1596
302 Ga0501070_0504105 3300049586 Bacteria 972
303 Ga0501202_021163 3300049652 Bacteria 1298
304 Ga0501080_0125696 3300049742 Bacteria 2375
305 Ga0501044_0019910 3300049823 Bacteria 7167
306 nmdc:mga00v17_26453_c1 3300050491 Bacteria 1537
307 nmdc:mga00v17_72890_c1 3300050491 Bacteria 2131
308 nmdc:mga0yw44_413858_c1 3300050492 Bacteria 912
309 nmdc:mga0k408_177426_c1 3300050493 Bacteria 1270
310 nmdc:mga07m45_105136_c1 3300050496 Bacteria 1623
311 nmdc:mga07m45_10544_c1 3300050496 Bacteria 4831
312 nmdc:mga05p37_186520_c1 3300050507 Bacteria 2521
313 nmdc:mga0n895_21_c1 3300050512 Bacteria 93738
314 nmdc:mga0n895_404754_c1 3300050512 Bacteria 1380
315 nmdc:mga0n895_674598_c1 3300050512 Bacteria 1031
316 nmdc:mga0rr50_51024_c1 3300050513 Bacteria 3068
317 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
318 nmdc:mga08x19_9467_c1 3300050514 Bacteria 5836
319 Ga0495619_0172973 3300053085 Bacteria 1494
320 Ga0495619_0267316 3300053085 Bacteria 1185
321 Ga0500641_0000316 3300053096 Bacteria 17892
322 Ga0500556_0002858 3300053104 Bacteria 5265
323 Ga0500568_0005078 3300053139 Bacteria 6884
324 Ga0500645_000890 3300053730 Bacteria 17324
325 Ga0590071_000192 3300059421 Bacteria 17812
326 Ga0590074_001206 3300059423 Bacteria 4086
327 Ga0590074_006818 3300059423 Bacteria 1897
328 Ga0590075_002506 3300059424 Bacteria 4391
329 Ga0590077_000934 3300059426 Bacteria 7464
330 2787509650 2786546548 Bacteria 4745694
331 2819549094 2818991437 Bacteria 5805520
332 2831431667 2831426010 Bacteria 8662725
333 2848702705 2848694841 Bacteria 9205737
334 2849664196 2849660919 Bacteria 8251853
335 2886628607 2886627955 Bacteria 7618130
336 2904449171 2904445276 Bacteria 5310396
337 2913943739 2913939268 Bacteria 8559644
338 Ga0105245_10016388
339 rootH2_10024231
340 Ga0055537_1000162
341 Ga0055537_1001048
342 Ga0055534_1000128
343 Ga0055528_1000590
344 Ga0065712_10001553
345 Ga0065712_10185051
346 Ga0065715_10000455
347 Ga0065707_10126239
348 Ga0070670_100001234
349 Ga0070670_100064323
350 Ga0070677_10074532
351 Ga0068869_100222328
352 Ga0070666_10028944
353 Ga0070666_10224579
354 Ga0068868_100058091
355 Ga0068868_100180590
356 Ga0068868_100276885
357 Ga0070687_100187470
358 Ga0070668_100127472
359 Ga0070669_100040157
360 Ga0070669_100134282
361 Ga0070669_100380774
362 Ga0070675_100000819
363 Ga0070675_100020919
364 Ga0070675_100138432
365 Ga0070675_100182493
366 Ga0070671_100057197
367 Ga0070671_100385931
368 Ga0070674_100032131
369 Ga0070674_100210034
370 Ga0070674_100286734
371 Ga0070674_100631071
372 Ga0070673_100013628
373 Ga0070688_100126238
374 Ga0070667_100135598
375 Ga0070709_10058705
376 Ga0070701_10032437
377 Ga0070694_100052653
378 Ga0070663_100141108
379 Ga0070678_100085095
380 Ga0070678_100269252
381 Ga0070678_100353746
382 Ga0070678_100466766
383 Ga0070662_100376846
384 Ga0068867_100264031
385 Ga0070685_10353747
386 Ga0070707_100197307
387 Ga0070707_100386584
388 Ga0070698_100043189
389 Ga0070698_100756160
390 Ga0070684_100680956
391 Ga0070697_100063788
392 Ga0070672_100260758
393 Ga0070695_100133682
394 Ga0070696_100339684
395 Ga0070665_100009257
396 Ga0070665_100012963
397 Ga0070665_100013446
398 Ga0070664_100233327
399 Ga0070664_100452717
400 Ga0068854_100157505
401 Ga0068852_100390687
402 Ga0068859_100004423
403 Ga0068859_100010225
404 Ga0068859_100015703
405 Ga0068859_100544682
406 Ga0068864_100016370
407 Ga0068864_100044631
408 Ga0068866_10060092
409 Ga0068866_10229523
410 Ga0068861_100048136
411 Ga0068863_100191354
412 Ga0068858_100001201
413 Ga0068858_100005007
414 Ga0068858_100163419
415 Ga0068860_100297834
416 Ga0068860_100792474
417 Ga0068862_100131240
418 Ga0068862_100526363
419 Ga0081539_10001514
420 Ga0081539_10002390
421 Ga0075364_10043265
422 Ga0075364_10143043
423 Ga0075364_10147352
424 Ga0075364_10245324
425 Ga0075367_10022703
426 Ga0075367_10026856
427 Ga0075366_10040780
428 Ga0075366_10257089
429 Ga0097621_100000043
430 Ga0097621_100320407
431 Ga0097621_100415012
432 Ga0075370_10015433
433 Ga0068871_100000775
434 Ga0068871_100431287
435 Ga0075428_100085843
436 Ga0075433_10293368
437 Ga0075434_100199321
438 Ga0075434_100831620
439 Ga0068865_100002067
440 Ga0068865_100045321
441 Ga0068865_100273939
442 Ga0075436_100012573
443 Ga0097620_100004423
444 Ga0097620_100010225
445 Ga0097620_100015703
446 Ga0097620_100544651
447 Ga0099826_10000576
448 Ga0075435_100000304
449 Ga0075435_100180786
450 Ga0099794_10003017
451 Ga0099794_10131776
452 Ga0105240_10106779
453 Ga0105245_10052010
454 Ga0105247_10053254
455 Ga0114129_10187136
456 Ga0114129_10194498
457 Ga0114129_10829685
458 Ga0105241_10137616
459 Ga0105242_10023599
460 Ga0105242_10147588
461 Ga0105242_10337115
462 Ga0105242_10408071
463 Ga0105248_10002903
464 Ga0105248_10006202
465 Ga0105248_10046555
466 Ga0105248_10102728
467 Ga0105248_10196384
468 Ga0105248_10229443
469 Ga0105248_10230491
470 Ga0105249_10006208
471 Ga0105239_10357025
472 Ga0105239_10377304
473 Ga0105246_10184596
474 Ga0105246_10298232
475 Ga0157374_10264732
476 Ga0163162_10041916
477 Ga0163162_10102377
478 Ga0163162_10129387
479 Ga0157372_10200761
480 Ga0157375_10036727
481 Ga0157375_10640076
482 Ga0163163_10095548
483 Ga0163163_10110918
484 Ga0163163_10196857
485 Ga0163163_10223561
486 Ga0163163_10592943
487 Ga0157380_10042596
488 Ga0182008_10000227
489 Ga0157379_10056666
490 Ga0157379_10144119
491 Ga0157379_10185102
492 Ga0157379_10449101
493 Ga0157379_10595576
494 Ga0157376_10000387
495 Ga0157376_10103919
496 Ga0163161_10416284
497 Ga0209565_1000229
498 Ga0209673_1000463
499 Ga0209675_1000186
500 Ga0209025_1018826
501 Ga0209051_1038232
502 Ga0207682_10095799
503 Ga0207710_10027962
504 Ga0207688_10279811
505 Ga0207680_10055838
506 Ga0207680_10304097
507 Ga0207680_10428928
508 Ga0207654_10165409
509 Ga0207662_10003346
510 Ga0207646_10016706
511 Ga0207681_10075956
512 Ga0207681_10533397
513 Ga0207650_10008209
514 Ga0207650_10018162
515 Ga0207659_10005105
516 Ga0207659_10126838
517 Ga0207659_10419365
518 Ga0207687_10046083
519 Ga0207687_10199687
520 Ga0207644_10041646
521 Ga0207644_10137330
522 Ga0207706_10099454
523 Ga0207706_10539917
524 Ga0207686_10116234
525 Ga0207686_10144481
526 Ga0207669_10006695
527 Ga0207669_10075275
528 Ga0207669_10127579
529 Ga0207704_10038930
530 Ga0207665_10125592
531 Ga0207691_10028011
532 Ga0207691_10336350
533 Ga0207711_10004047
534 Ga0207711_10010740
535 Ga0207711_10037851
536 Ga0207711_10109326
537 Ga0207711_10186268
538 Ga0207711_10491833
539 Ga0207679_10278172
540 Ga0207679_10415079
541 Ga0207651_10021379
542 Ga0207651_10531519
543 Ga0207640_10095282
544 Ga0207658_10185338
545 Ga0207703_10002676
546 Ga0207703_10286027
547 Ga0207678_10026521
548 Ga0207678_10138928
549 Ga0207708_10194285
550 Ga0207648_10098912
551 Ga0207676_10011943
552 Ga0207674_10346424
553 Ga0207675_100081984
554 Ga0207675_100270370
555 Ga0207683_10044999
556 Ga0207683_10081805
557 Ga0207683_10256799
558 Ga0207683_10577557
559 Ga0209282_1000260
560 Ga0209588_1015156
561 Ga0268266_10016896
562 Ga0268266_10046385
563 Ga0268265_10044668
564 Ga0268265_10067047
565 Ga0268265_10262908
566 Ga0268264_10118257
567 Ga0307408_100215823
568 Ga0307405_10266621
569 Ga0307413_10297148
570 Ga0307410_10014009
571 Ga0307406_10262785
572 Ga0307407_10000574
573 Ga0307412_10056403
574 Ga0307409_100060528
575 Ga0307409_100085825
576 Ga0307409_100296410
577 Ga0307416_100122592
578 Ga0307416_100323455
579 Ga0307414_10139479
580 Ga0307414_10163491
581 Ga0307414_10315401
582 Ga0373935_0153017
583 Ga0436364_0806130
584 Ga0436360_0369913
585 Ga0436361_0792253
586 Ga0436363_1530451
587 Ga0439439_0010499
588 Ga0439462_0005900
589 Ga0450923_039849
590 Ga0450896_005811
591 Ga0450906_030744
592 Ga0439446_0039433
593 Ga0466963_0070951
594 Ga0495638_0040589
595 Ga0495638_0041569
596 Ga0495582_0214326
597 Ga0495584_0044287
598 Ga0495642_0115100
599 Ga0495586_0325139
600 Ga0495634_0140266
601 Ga0495635_0121361
602 Ga0495658_0123671
603 Ga0495613_0122140
604 Ga0495649_0155810
605 Ga0495636_0018103
606 Ga0496100_0639449
607 Ga0496101_0000344
608 Ga0496101_0117136
609 Ga0496101_0412048
610 Ga0496102_0303984
611 Ga0496103_0071767
612 Ga0496104_0013567
613 Ga0496104_0086442
614 Ga0496104_0278820
615 Ga0496104_0399566
616 Ga0496105_0125555
617 Ga0496106_0035849
618 Ga0496106_0048802
619 Ga0496106_0050338
620 Ga0496106_0277844
621 Ga0496109_0010743
622 Ga0496109_0498084
623 Ga0496110_0083884
624 Ga0496111_0091677
625 Ga0496112_0025881
626 Ga0496112_0381675
627 Ga0496113_0110489
628 Ga0496114_0000199
629 Ga0496114_0013225
630 Ga0496114_0174504
631 Ga0496115_0121490
632 Ga0496125_0000231
633 Ga0496125_0253919
634 Ga0496126_0001147
635 Ga0501031_0252152
636 Ga0501034_0290087
637 Ga0501036_0434699
638 Ga0501038_0201757
639 Ga0501070_0504105
640 Ga0501202_021163
641 Ga0501080_0125696
642 Ga0501044_0019910
643 nmdc:mga00v17_26453_c1
644 nmdc:mga00v17_72890_c1
645 nmdc:mga0yw44_413858_c1
646 nmdc:mga0k408_177426_c1
647 nmdc:mga07m45_105136_c1
648 nmdc:mga07m45_10544_c1
649 nmdc:mga05p37_186520_c1
650 nmdc:mga0n895_21_c1
651 nmdc:mga0n895_404754_c1
652 nmdc:mga0n895_674598_c1
653 nmdc:mga0rr50_51024_c1
654 nmdc:mga0rr50_8_c1
655 nmdc:mga08x19_9467_c1
656 Ga0495619_0172973
657 Ga0495619_0267316
658 Ga0500641_0000316
659 Ga0500556_0002858
660 Ga0500568_0005078
661 Ga0500645_000890
662 Ga0590071_000192
663 Ga0590074_001206
664 Ga0590074_006818
665 Ga0590075_002506
666 Ga0590077_000934
667 2787509650
668 2819549094
669 2831431667
670 2848702705
671 2849664196
672 2886628607
673 2904449171
674 2913943739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

43

238

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

49

286

0.96

PF08659

KR

KR domain

44

210

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9829 3 249
3aus-assembly1.cif.gz_A crystal structure of bacillus megaterium glucose dehydrogenase 4 in ligand-free form 0.9808 2 251
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9803 7 249
1g6k-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ 0.9793 2 252
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9789 3 249
ID Description Score Start End Superfamily
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9757 7 249 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9743 4 251 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9733 2 252 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9711 4 249 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 4 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7S1WMZ4-F1-model_v4 Glucose 1-dehydrogenase 0.9823 2 233 GO:0016491
AF-A0A1R0ZAZ2-F1-model_v4 Sugar dehydrogenase 0.9789 2 252 GO:0016616
AF-A0A0S6TID8-F1-model_v4 deleted 0.9768 76 252
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9767 86 249 GO:0016491
AF-T1VXS9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9758 7 249 GO:0004316
GO:0006633
GO:0009507
GO:0051287

Map