F413001

General Info

Members Datasets Scaffolds Average Seq Length
337 172 337 138

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100401140|Ga0068852_1004011402
Length 145
Sequence MYFAEITMNQTFHTITVPTRGPGLYEFTDEATDFVRGAKIADGLLTCFIRHTSASLLIQENADPDVQRDLQDFFAWLATSGPRFRHTTEGPDDMPSHIRSALTQVSLGIPVAKGRLALGTWQGIYVFEHRDAPHRREVTLHLIGA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
169 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 0.3
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001888 3300003320 Bacteria 9122
2 rootH2_10029615 3300003320 Bacteria 1983
3 Ga0070658_10017310 3300005327 Bacteria 5768
4 Ga0070658_11041738 3300005327 Bacteria 712
5 Ga0070683_101809973 3300005329 Bacteria 587
6 Ga0070670_100154306 3300005331 Bacteria 1988
7 Ga0068869_100109017 3300005334 Bacteria 2104
8 Ga0068868_100103692 3300005338 Bacteria 2304
9 Ga0070660_100586160 3300005339 Bacteria 932
10 Ga0070661_100000254 3300005344 Bacteria 43578
11 Ga0070661_101055119 3300005344 Bacteria 676
12 Ga0070668_100936613 3300005347 Bacteria 776
13 Ga0070714_101414449 3300005435 Bacteria 679
14 Ga0070713_100832030 3300005436 Bacteria 886
15 Ga0070713_101071100 3300005436 Bacteria 779
16 Ga0070713_101373299 3300005436 Bacteria 685
17 Ga0070710_10900497 3300005437 Bacteria 639
18 Ga0070710_11252823 3300005437 Bacteria 550
19 Ga0070711_100779611 3300005439 Bacteria 810
20 Ga0070700_100687498 3300005441 Bacteria 812
21 Ga0070678_100007429 3300005456 Bacteria 6500
22 Ga0070662_100542480 3300005457 Bacteria 974
23 Ga0070681_10141132 3300005458 Bacteria 2339
24 Ga0070681_10843191 3300005458 Bacteria 834
25 Ga0068867_100016001 3300005459 Bacteria 5325
26 Ga0068867_100134146 3300005459 Bacteria 1928
27 Ga0070685_10124573 3300005466 Bacteria 1604
28 Ga0070679_100119650 3300005530 Bacteria 2618
29 Ga0070679_100184525 3300005530 Bacteria 2058
30 Ga0070679_100686229 3300005530 Bacteria 967
31 Ga0070684_100169556 3300005535 Bacteria 1982
32 Ga0070684_101126001 3300005535 Bacteria 738
33 Ga0070684_101769050 3300005535 Bacteria 583
34 Ga0068853_100037237 3300005539 Bacteria 4139
35 Ga0068853_100142065 3300005539 Bacteria 2155
36 Ga0070672_100463987 3300005543 Bacteria 1092
37 Ga0070672_101778091 3300005543 Bacteria 554
38 Ga0070665_100001302 3300005548 Bacteria 29816
39 Ga0070665_100125846 3300005548 Bacteria 2565
40 Ga0070665_100205755 3300005548 Bacteria 1969
41 Ga0070665_100740796 3300005548 Bacteria 996
42 Ga0068855_100065280 3300005563 Bacteria 4243
43 Ga0068855_100268381 3300005563 Bacteria 1898
44 Ga0068857_100174122 3300005577 Bacteria 1957
45 Ga0068857_100179817 3300005577 Bacteria 1925
46 Ga0068856_100118813 3300005614 Bacteria 2644
47 Ga0068856_100181514 3300005614 Bacteria 2118
48 Ga0068852_100401140 3300005616 Bacteria 1349
49 Ga0068852_101425219 3300005616 Bacteria 715
50 Ga0068866_10116445 3300005718 Bacteria 1499
51 Ga0068866_10284587 3300005718 Bacteria 1026
52 Ga0068870_10080190 3300005840 Bacteria 1803
53 Ga0068863_102032652 3300005841 Bacteria 585
54 Ga0068862_100392497 3300005844 Bacteria 1297
55 Ga0068862_100429343 3300005844 Bacteria 1242
56 Ga0068871_100042130 3300006358 Bacteria 3663
57 Ga0105240_10019617 3300009093 Bacteria 9031
58 Ga0105240_10049843 3300009093 Bacteria 5282
59 Ga0105240_10295631 3300009093 Bacteria 1854
60 Ga0105240_10296666 3300009093 Bacteria 1851
61 Ga0105240_10405960 3300009093 Bacteria 1533
62 Ga0105240_10449694 3300009093 Bacteria 1442
63 Ga0105240_10791179 3300009093 Bacteria 1028
64 Ga0105240_11419874 3300009093 Bacteria 729
65 Ga0105243_10004582 3300009148 Bacteria 10901
66 Ga0105241_10179588 3300009174 Bacteria 1755
67 Ga0105241_10309542 3300009174 Bacteria 1358
68 Ga0105242_10051210 3300009176 Bacteria 3364
69 Ga0105242_10382872 3300009176 Bacteria 1308
70 Ga0105242_11170672 3300009176 Bacteria 786
71 Ga0105248_10141690 3300009177 Bacteria 2712
72 Ga0105248_10208380 3300009177 Bacteria 2202
73 Ga0105237_10229518 3300009545 Bacteria 1857
74 Ga0105237_10292733 3300009545 Bacteria 1631
75 Ga0105237_10367097 3300009545 Bacteria 1444
76 Ga0105237_10840849 3300009545 Bacteria 925
77 Ga0105238_10104427 3300009551 Bacteria 2814
78 Ga0105238_10247833 3300009551 Bacteria 1759
79 Ga0105238_10548193 3300009551 Bacteria 1160
80 Ga0105238_11829918 3300009551 Bacteria 639
81 Ga0105238_11892276 3300009551 Bacteria 629
82 Ga0105238_12411707 3300009551 Bacteria 562
83 Ga0105249_10064235 3300009553 Bacteria 3374
84 Ga0105249_10315866 3300009553 Bacteria 1572
85 Ga0105239_10016304 3300010375 Bacteria 8215
86 Ga0105239_10149177 3300010375 Bacteria 2609
87 Ga0105239_11087442 3300010375 Bacteria 920
88 Ga0105239_11111588 3300010375 Bacteria 910
89 Ga0105239_11276586 3300010375 Bacteria 847
90 Ga0105239_11569605 3300010375 Bacteria 761
91 Ga0105239_13405419 3300010375 Bacteria 517
92 Ga0105246_11129919 3300011119 Bacteria 717
93 Ga0105246_11455412 3300011119 Bacteria 641
94 Ga0157373_10272751 3300013100 Bacteria 1198
95 Ga0157370_10025977 3300013104 Bacteria 5788
96 Ga0157370_10030611 3300013104 Bacteria 5273
97 Ga0157370_11004401 3300013104 Bacteria 755
98 Ga0157370_11204778 3300013104 Bacteria 683
99 Ga0157369_10308172 3300013105 Bacteria 1646
100 Ga0157369_10628342 3300013105 Bacteria 1108
101 Ga0157374_10182136 3300013296 Bacteria 2052
102 Ga0157378_10316955 3300013297 Bacteria 1514
103 Ga0157378_10406893 3300013297 Bacteria 1342
104 Ga0163162_10243736 3300013306 Bacteria 1929
105 Ga0163162_10270773 3300013306 Bacteria 1830
106 Ga0163162_11831129 3300013306 Bacteria 694
107 Ga0157372_11425884 3300013307 Bacteria 798
108 Ga0157372_12148173 3300013307 Bacteria 641
109 Ga0157375_10118439 3300013308 Bacteria 2754
110 Ga0163163_10000012 3300014325 Bacteria 257369
111 Ga0163163_10169880 3300014325 Bacteria 2227
112 Ga0163163_10327960 3300014325 Bacteria 1585
113 Ga0163163_12943690 3300014325 Unclassified 531
114 Ga0157379_10003912 3300014968 Bacteria 12701
115 Ga0157379_10498286 3300014968 Bacteria 1129
116 Ga0157379_10696466 3300014968 Bacteria 953
117 Ga0157376_10259642 3300014969 Bacteria 1627
118 Ga0157376_11185013 3300014969 Bacteria 792
119 Ga0163161_10077000 3300017792 Bacteria 2449
120 Ga0209233_1000006 3300025261 Bacteria 1473685
121 Ga0209233_1004865 3300025261 Bacteria 4522
122 Ga0209455_1011654 3300025272 Bacteria 2151
123 Ga0207688_10025364 3300025901 Bacteria 3255
124 Ga0207680_10246382 3300025903 Bacteria 1233
125 Ga0207645_10402500 3300025907 Bacteria 921
126 Ga0207705_10067321 3300025909 Bacteria 2592
127 Ga0207654_10046246 3300025911 Bacteria 2481
128 Ga0207654_10215865 3300025911 Bacteria 1270
129 Ga0207707_10191064 3300025912 Bacteria 1786
130 Ga0207695_10017780 3300025913 Bacteria 8249
131 Ga0207695_10299379 3300025913 Bacteria 1500
132 Ga0207695_10310466 3300025913 Bacteria 1467
133 Ga0207695_10342542 3300025913 Bacteria 1382
134 Ga0207695_10443734 3300025913 Bacteria 1181
135 Ga0207695_10512024 3300025913 Bacteria 1082
136 Ga0207695_10512993 3300025913 Bacteria 1081
137 Ga0207695_10840125 3300025913 Bacteria 798
138 Ga0207695_10979182 3300025913 Bacteria 725
139 Ga0207671_10180321 3300025914 Bacteria 1643
140 Ga0207671_10775268 3300025914 Bacteria 761
141 Ga0207671_10854690 3300025914 Bacteria 720
142 Ga0207662_11183613 3300025918 Bacteria 543
143 Ga0207657_10346636 3300025919 Bacteria 1172
144 Ga0207649_10000026 3300025920 Bacteria 177395
145 Ga0207652_10939330 3300025921 Bacteria 762
146 Ga0207652_11277428 3300025921 Bacteria 636
147 Ga0207650_10315676 3300025925 Bacteria 1279
148 Ga0207659_10408966 3300025926 Bacteria 1136
149 Ga0207700_10066687 3300025928 Bacteria 2752
150 Ga0207664_10715566 3300025929 Bacteria 900
151 Ga0207644_10811211 3300025931 Bacteria 783
152 Ga0207686_10434417 3300025934 Bacteria 1007
153 Ga0207686_10839866 3300025934 Bacteria 738
154 Ga0207709_10186140 3300025935 Bacteria 1471
155 Ga0207704_10013802 3300025938 Bacteria 4058
156 Ga0207704_10199028 3300025938 Bacteria 1464
157 Ga0207665_10604638 3300025939 Bacteria 856
158 Ga0207711_10062650 3300025941 Bacteria 3208
159 Ga0207711_10427967 3300025941 Bacteria 1231
160 Ga0207689_10003177 3300025942 Bacteria 15066
161 Ga0207689_10190745 3300025942 Bacteria 1691
162 Ga0207689_10285516 3300025942 Bacteria 1367
163 Ga0207689_10791405 3300025942 Bacteria 800
164 Ga0207661_10370500 3300025944 Bacteria 1295
165 Ga0207661_10507820 3300025944 Bacteria 1102
166 Ga0207667_10077854 3300025949 Bacteria 3437
167 Ga0207667_10662468 3300025949 Bacteria 1048
168 Ga0207712_11531567 3300025961 Bacteria 597
169 Ga0207703_10050393 3300026035 Bacteria 3370
170 Ga0207703_10995148 3300026035 Bacteria 804
171 Ga0207639_10020512 3300026041 Bacteria 4730
172 Ga0207639_10293699 3300026041 Bacteria 1434
173 Ga0207639_10448844 3300026041 Bacteria 1170
174 Ga0207702_10335334 3300026078 Bacteria 1444
175 Ga0207648_10012856 3300026089 Bacteria 7817
176 Ga0207674_10212101 3300026116 Bacteria 1885
177 Ga0207674_10258480 3300026116 Bacteria 1689
178 Ga0207674_10769696 3300026116 Bacteria 929
179 Ga0207683_10012265 3300026121 Bacteria 7315
180 Ga0207683_10043437 3300026121 Bacteria 3928
181 Ga0207683_10388925 3300026121 Bacteria 1282
182 Ga0207698_10135508 3300026142 Bacteria 2112
183 Ga0268266_10000847 3300028379 Bacteria 39858
184 Ga0268266_10005124 3300028379 Bacteria 12352
185 Ga0268266_10074199 3300028379 Bacteria 2954
186 Ga0268266_10078860 3300028379 Bacteria 2866
187 Ga0268265_12103456 3300028380 Bacteria 571
188 Ga0268264_10775567 3300028381 Bacteria 956
189 Ga0265338_10004163 3300028800 Bacteria 19762
190 Ga0265338_10285441 3300028800 Bacteria 1204
191 Ga0265330_10003149 3300031235 Bacteria 8730
192 Ga0265332_10017562 3300031238 Bacteria 3156
193 Ga0265325_10001683 3300031241 Bacteria 15359
194 Ga0265340_10090079 3300031247 Bacteria 1435
195 Ga0265339_10006313 3300031249 Bacteria 7791
196 Ga0265339_10042424 3300031249 Bacteria 2519
197 Ga0265331_10000008 3300031250 Bacteria 324311
198 Ga0265331_10035880 3300031250 Bacteria 2437
199 Ga0265331_10131481 3300031250 Bacteria 1141
200 Ga0265327_10000036 3300031251 Bacteria 312827
201 Ga0265316_10019292 3300031344 Bacteria 5837
202 Ga0265316_10074673 3300031344 Bacteria 2609
203 Ga0307513_10214087 3300031456 Bacteria 1755
204 Ga0265313_10009088 3300031595 Bacteria 6501
205 Ga0265313_10112848 3300031595 Bacteria 1193
206 Ga0265314_10012288 3300031711 Bacteria 6997
207 Ga0265342_10013775 3300031712 Bacteria 5400
208 Ga0265342_10026742 3300031712 Bacteria 3613
209 Ga0265342_10060988 3300031712 Bacteria 2223
210 Ga0307516_10070469 3300031730 Bacteria 3359
211 Ga0373926_0129244 3300035083 Bacteria 956
212 Ga0373923_0373472 3300035111 Unclassified 683
213 Ga0373941_0067547 3300035115 Unclassified 1179
214 Ga0373945_0081986 3300035116 Bacteria 1237
215 Ga0373943_0003007 3300035170 Bacteria 7654
216 Ga0373946_0023585 3300035171 Bacteria 2406
217 Ga0373935_0011561 3300035692 Bacteria 5300
218 Ga0373927_0396158 3300035695 Bacteria 911
219 Ga0373947_0164233 3300035725 Bacteria 1437
220 Ga0373925_0001182 3300037068 Bacteria 23075
221 Ga0373925_0067791 3300037068 Bacteria 2692
222 Ga0395900_0363077 3300037418 Bacteria 1419
223 Ga0395898_0015029 3300037466 Bacteria 7946
224 Ga0395901_0349763 3300038443 Bacteria 1525
225 Ga0436363_0134827 3300039450 Bacteria 506
226 Ga0466963_0426828 3300044694 Bacteria 935
227 Ga0466957_0814944 3300044842 Bacteria 664
228 Ga0466960_0812365 3300044901 Bacteria 567
229 Ga0466967_1437056 3300045976 Bacteria 687
230 Ga0495585_0390793 3300046492 Bacteria 671
231 Ga0495628_0580095 3300046516 Bacteria 803
232 Ga0495648_0316112 3300046524 Bacteria 726
233 Ga0495587_0368170 3300046536 Unclassified 800
234 Ga0495611_0131968 3300046648 Bacteria 1165
235 Ga0495625_0383416 3300046660 Bacteria 881
236 Ga0495625_0506820 3300046660 Bacteria 737
237 Ga0495600_0595321 3300046809 Unclassified 672
238 Ga0495686_0254891 3300047472 Bacteria 985
239 Ga0495686_0485341 3300047472 Bacteria 652
240 Ga0495602_0041073 3300048088 Bacteria 4230
241 Ga0496101_0250203 3300048904 Bacteria 1381
242 Ga0496121_0071754 3300048924 Bacteria 2783
243 Ga0496126_0000463 3300048929 Bacteria 80860
244 Ga0501031_0007877 3300049568 Bacteria 6933
245 Ga0501031_0111873 3300049568 Bacteria 1783
246 Ga0501032_0019863 3300049569 Bacteria 4690
247 Ga0501032_0044836 3300049569 Bacteria 2992
248 Ga0501032_0163522 3300049569 Bacteria 1461
249 Ga0501032_0293860 3300049569 Bacteria 1051
250 Ga0501032_0711254 3300049569 Bacteria 636
251 Ga0501033_0027756 3300049570 Bacteria 4255
252 Ga0501033_0035160 3300049570 Bacteria 3757
253 Ga0501033_0044818 3300049570 Bacteria 3292
254 Ga0501033_0144096 3300049570 Bacteria 1722
255 Ga0501033_0156420 3300049570 Bacteria 1642
256 Ga0501033_0541501 3300049570 Bacteria 802
257 Ga0501034_0006981 3300049571 Bacteria 12057
258 Ga0501034_0022222 3300049571 Bacteria 6464
259 Ga0501034_0157235 3300049571 Bacteria 2246
260 Ga0501034_0166706 3300049571 Bacteria 2171
261 Ga0501034_0635917 3300049571 Bacteria 970
262 Ga0501034_0661179 3300049571 Bacteria 946
263 Ga0501034_0680964 3300049571 Unclassified 928
264 Ga0501037_0008477 3300049573 Bacteria 7537
265 Ga0501037_0075833 3300049573 Bacteria 2442
266 Ga0501038_0007322 3300049574 Bacteria 10181
267 Ga0501038_0215371 3300049574 Bacteria 1535
268 Ga0501038_0570231 3300049574 Bacteria 859
269 Ga0501039_0001379 3300049575 Bacteria 17823
270 Ga0501043_0018860 3300049579 Bacteria 5414
271 Ga0501043_0075617 3300049579 Bacteria 2645
272 Ga0501043_0154284 3300049579 Bacteria 1796
273 Ga0501043_0190958 3300049579 Bacteria 1593
274 Ga0501043_0302009 3300049579 Bacteria 1223
275 Ga0501043_0596531 3300049579 Bacteria 816
276 Ga0501046_0020811 3300049580 Bacteria 5418
277 Ga0501046_0255697 3300049580 Bacteria 1288
278 Ga0501046_0525665 3300049580 Bacteria 845
279 Ga0501046_1094643 3300049580 Bacteria 550
280 Ga0501047_0015429 3300049581 Bacteria 7278
281 Ga0501047_0015784 3300049581 Bacteria 7199
282 Ga0501047_0027448 3300049581 Bacteria 5485
283 Ga0501047_0139561 3300049581 Bacteria 2302
284 Ga0501047_1305409 3300049581 Bacteria 540
285 Ga0501048_0025496 3300049582 Bacteria 4308
286 Ga0501067_0001970 3300049583 Bacteria 11308
287 Ga0501068_0014415 3300049584 Bacteria 4519
288 Ga0501068_0328283 3300049584 Bacteria 981
289 Ga0501069_0003406 3300049585 Bacteria 8164
290 Ga0501070_0011200 3300049586 Bacteria 7569
291 Ga0501070_0047024 3300049586 Bacteria 3588
292 Ga0501070_0372033 3300049586 Bacteria 1158
293 Ga0501070_0732681 3300049586 Bacteria 780
294 Ga0501071_0648752 3300049587 Bacteria 812
295 Ga0501073_0012247 3300049589 Bacteria 6259
296 Ga0501073_0124159 3300049589 Bacteria 1789
297 Ga0501073_0200527 3300049589 Bacteria 1380
298 Ga0501073_0740850 3300049589 Bacteria 678
299 Ga0501076_0223735 3300049592 Bacteria 1538
300 Ga0501079_0004716 3300049741 Bacteria 10093
301 Ga0501080_0040900 3300049742 Bacteria 4322
302 Ga0501080_0074514 3300049742 Bacteria 3157
303 Ga0501080_0082630 3300049742 Bacteria 2983
304 Ga0501080_0138827 3300049742 Bacteria 2248
305 Ga0501083_0015213 3300049744 Bacteria 5386
306 Ga0501035_0003644 3300049822 Bacteria 14691
307 Ga0501035_0008954 3300049822 Bacteria 9314
308 Ga0501035_0010036 3300049822 Bacteria 8787
309 Ga0501035_0036634 3300049822 Bacteria 4445
310 Ga0501035_0133681 3300049822 Bacteria 2161
311 Ga0501035_0180766 3300049822 Bacteria 1817
312 Ga0501035_1086961 3300049822 Bacteria 625
313 Ga0501044_0006795 3300049823 Bacteria 12608
314 Ga0501044_0007302 3300049823 Bacteria 12142
315 Ga0501044_0008500 3300049823 Bacteria 11250
316 Ga0501044_0028768 3300049823 Bacteria 5863
317 Ga0501044_0051986 3300049823 Bacteria 4224
318 Ga0501044_0222798 3300049823 Bacteria 1836
319 Ga0501044_0519005 3300049823 Bacteria 1091
320 Ga0501044_1164219 3300049823 Bacteria 639
321 Ga0501045_0109139 3300049824 Bacteria 2051
322 Ga0500643_000027 3300053087 Bacteria 251062
323 Ga0500643_020314 3300053087 Bacteria 2174
324 Ga0500592_007035 3300053116 Bacteria 1789
325 Ga0500595_002521 3300053119 Bacteria 9035
326 Ga0500595_029268 3300053119 Bacteria 1870
327 Ga0500595_037337 3300053119 Bacteria 1585
328 Ga0500642_0406288 3300053130 Bacteria 593
329 Ga0500568_0017760 3300053139 Bacteria 3132
330 Ga0500573_0387569 3300053140 Bacteria 666
331 Ga0500577_0098121 3300053142 Bacteria 1194
332 Ga0500611_021458 3300053727 Bacteria 1233
333 Ga0501084_0003057 3300054114 Bacteria 13556
334 Ga0501084_0023056 3300054114 Bacteria 5196
335 Ga0501084_0280206 3300054114 Bacteria 1408
336 Ga0501082_0009507 3300060353 Bacteria 8367
337 Ga0530510_1226568 3300061734 Bacteria 575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0035160 Ga0501033_0035160_1446_1874 128
2 3300049571 Ga0501034_0635917 Ga0501034_0635917_404_793 129
3 3300049568 Ga0501031_0111873 Ga0501031_0111873_1374_1769 131
4 3300049824 Ga0501045_0109139 Ga0501045_0109139_128_523 131
5 3300028800 Ga0265338_10285441 Ga0265338_102854413 133
6 3300049571 Ga0501034_0022222 Ga0501034_0022222_3817_4233 134
7 3300025939 Ga0207665_10604638 Ga0207665_106046382 135
8 3300047472 Ga0495686_0485341 Ga0495686_0485341_15_434 135
9 3300009551 Ga0105238_12411707 Ga0105238_124117071 136
10 3300014969 Ga0157376_11185013 Ga0157376_111850132 136
11 3300003320 rootH2_10029615 rootH2_100296153 137
12 3300005436 Ga0070713_101373299 Ga0070713_1013732992 137
13 3300014325 Ga0163163_12943690 Ga0163163_129436901 137
14 3300044694 Ga0466963_0426828 Ga0466963_0426828_25_444 137
15 3300045976 Ga0466967_1437056 Ga0466967_1437056_28_447 137
16 3300048904 Ga0496101_0250203 Ga0496101_0250203_114_527 137
17 3300049822 Ga0501035_0133681 Ga0501035_0133681_1322_1735 137
18 3300005327 Ga0070658_10017310 Ga0070658_100173107 138
19 3300005327 Ga0070658_11041738 Ga0070658_110417382 138
20 3300005329 Ga0070683_101809973 Ga0070683_1018099731 138
21 3300005331 Ga0070670_100154306 Ga0070670_1001543063 138
22 3300005334 Ga0068869_100109017 Ga0068869_1001090171 138
23 3300005338 Ga0068868_100103692 Ga0068868_1001036923 138
24 3300005339 Ga0070660_100586160 Ga0070660_1005861602 138
25 3300005344 Ga0070661_101055119 Ga0070661_1010551192 138
26 3300005347 Ga0070668_100936613 Ga0070668_1009366132 138
27 3300005435 Ga0070714_101414449 Ga0070714_1014144491 138
28 3300005436 Ga0070713_100832030 Ga0070713_1008320302 138
29 3300005436 Ga0070713_101071100 Ga0070713_1010711001 138
30 3300005437 Ga0070710_10900497 Ga0070710_109004971 138
31 3300005437 Ga0070710_11252823 Ga0070710_112528231 138
32 3300005439 Ga0070711_100779611 Ga0070711_1007796111 138
33 3300005441 Ga0070700_100687498 Ga0070700_1006874982 138
34 3300005456 Ga0070678_100007429 Ga0070678_1000074295 138
35 3300005457 Ga0070662_100542480 Ga0070662_1005424802 138
36 3300005458 Ga0070681_10141132 Ga0070681_101411323 138
37 3300005458 Ga0070681_10843191 Ga0070681_108431911 138
38 3300005459 Ga0068867_100016001 Ga0068867_1000160017 138
39 3300005459 Ga0068867_100134146 Ga0068867_1001341463 138
40 3300005466 Ga0070685_10124573 Ga0070685_101245732 138
41 3300005530 Ga0070679_100119650 Ga0070679_1001196502 138
42 3300005530 Ga0070679_100184525 Ga0070679_1001845252 138
43 3300005530 Ga0070679_100686229 Ga0070679_1006862293 138
44 3300005535 Ga0070684_100169556 Ga0070684_1001695562 138
45 3300005535 Ga0070684_101126001 Ga0070684_1011260011 138
46 3300005535 Ga0070684_101769050 Ga0070684_1017690501 138
47 3300005539 Ga0068853_100037237 Ga0068853_1000372371 138
48 3300005539 Ga0068853_100142065 Ga0068853_1001420654 138
49 3300005543 Ga0070672_100463987 Ga0070672_1004639872 138
50 3300005543 Ga0070672_101778091 Ga0070672_1017780912 138
51 3300005548 Ga0070665_100001302 Ga0070665_10000130229 138
52 3300005548 Ga0070665_100125846 Ga0070665_1001258462 138
53 3300005548 Ga0070665_100205755 Ga0070665_1002057552 138
54 3300005548 Ga0070665_100740796 Ga0070665_1007407962 138
55 3300005563 Ga0068855_100065280 Ga0068855_1000652806 138
56 3300005563 Ga0068855_100268381 Ga0068855_1002683812 138
57 3300005577 Ga0068857_100174122 Ga0068857_1001741222 138
58 3300005577 Ga0068857_100179817 Ga0068857_1001798172 138
59 3300005614 Ga0068856_100118813 Ga0068856_1001188133 138
60 3300005614 Ga0068856_100181514 Ga0068856_1001815142 138
61 3300005616 Ga0068852_100401140 Ga0068852_1004011402 138
62 3300005616 Ga0068852_101425219 Ga0068852_1014252192 138
63 3300005718 Ga0068866_10116445 Ga0068866_101164453 138
64 3300005718 Ga0068866_10284587 Ga0068866_102845872 138
65 3300005840 Ga0068870_10080190 Ga0068870_100801902 138
66 3300005841 Ga0068863_102032652 Ga0068863_1020326521 138
67 3300005844 Ga0068862_100392497 Ga0068862_1003924972 138
68 3300005844 Ga0068862_100429343 Ga0068862_1004293431 138
69 3300006358 Ga0068871_100042130 Ga0068871_1000421302 138
70 3300009093 Ga0105240_10019617 Ga0105240_1001961712 138
71 3300009093 Ga0105240_10049843 Ga0105240_100498432 138
72 3300009093 Ga0105240_10295631 Ga0105240_102956311 138
73 3300009093 Ga0105240_10405960 Ga0105240_104059602 138
74 3300009093 Ga0105240_10449694 Ga0105240_104496942 138
75 3300009093 Ga0105240_10791179 Ga0105240_107911792 138
76 3300009093 Ga0105240_11419874 Ga0105240_114198742 138
77 3300009148 Ga0105243_10004582 Ga0105243_100045821 138
78 3300009174 Ga0105241_10179588 Ga0105241_101795882 138
79 3300009174 Ga0105241_10309542 Ga0105241_103095422 138
80 3300009176 Ga0105242_10051210 Ga0105242_100512103 138
81 3300009176 Ga0105242_10382872 Ga0105242_103828723 138
82 3300009176 Ga0105242_11170672 Ga0105242_111706721 138
83 3300009177 Ga0105248_10141690 Ga0105248_101416903 138
84 3300009177 Ga0105248_10208380 Ga0105248_102083802 138
85 3300009545 Ga0105237_10229518 Ga0105237_102295182 138
86 3300009545 Ga0105237_10292733 Ga0105237_102927332 138
87 3300009545 Ga0105237_10367097 Ga0105237_103670972 138
88 3300009545 Ga0105237_10840849 Ga0105237_108408492 138
89 3300009551 Ga0105238_10104427 Ga0105238_101044272 138
90 3300009551 Ga0105238_10247833 Ga0105238_102478333 138
91 3300009551 Ga0105238_10548193 Ga0105238_105481932 138
92 3300009551 Ga0105238_11829918 Ga0105238_118299181 138
93 3300009551 Ga0105238_11892276 Ga0105238_118922762 138
94 3300009553 Ga0105249_10064235 Ga0105249_100642353 138
95 3300009553 Ga0105249_10315866 Ga0105249_103158662 138
96 3300010375 Ga0105239_10016304 Ga0105239_100163046 138
97 3300010375 Ga0105239_10149177 Ga0105239_101491774 138
98 3300010375 Ga0105239_11087442 Ga0105239_110874422 138
99 3300010375 Ga0105239_11111588 Ga0105239_111115882 138
100 3300010375 Ga0105239_11276586 Ga0105239_112765861 138
101 3300010375 Ga0105239_11569605 Ga0105239_115696052 138
102 3300010375 Ga0105239_13405419 Ga0105239_134054192 138
103 3300011119 Ga0105246_11129919 Ga0105246_111299191 138
104 3300011119 Ga0105246_11455412 Ga0105246_114554121 138
105 3300013100 Ga0157373_10272751 Ga0157373_102727512 138
106 3300013104 Ga0157370_10025977 Ga0157370_100259772 138
107 3300013104 Ga0157370_10030611 Ga0157370_100306116 138
108 3300013104 Ga0157370_11204778 Ga0157370_112047781 138
109 3300013105 Ga0157369_10308172 Ga0157369_103081722 138
110 3300013105 Ga0157369_10628342 Ga0157369_106283422 138
111 3300013296 Ga0157374_10182136 Ga0157374_101821363 138
112 3300013297 Ga0157378_10316955 Ga0157378_103169551 138
113 3300013297 Ga0157378_10406893 Ga0157378_104068933 138
114 3300013306 Ga0163162_10243736 Ga0163162_102437362 138
115 3300013306 Ga0163162_10270773 Ga0163162_102707733 138
116 3300013306 Ga0163162_11831129 Ga0163162_118311292 138
117 3300013307 Ga0157372_11425884 Ga0157372_114258841 138
118 3300013307 Ga0157372_12148173 Ga0157372_121481732 138
119 3300013308 Ga0157375_10118439 Ga0157375_101184394 138
120 3300014325 Ga0163163_10000012 Ga0163163_10000012121 138
121 3300014325 Ga0163163_10169880 Ga0163163_101698804 138
122 3300014325 Ga0163163_10327960 Ga0163163_103279603 138
123 3300014968 Ga0157379_10003912 Ga0157379_100039127 138
124 3300014968 Ga0157379_10498286 Ga0157379_104982862 138
125 3300014968 Ga0157379_10696466 Ga0157379_106964662 138
126 3300014969 Ga0157376_10259642 Ga0157376_102596422 138
127 3300017792 Ga0163161_10077000 Ga0163161_100770001 138
128 3300025261 Ga0209233_1000006 Ga0209233_1000006640 138
129 3300025261 Ga0209233_1004865 Ga0209233_10048656 138
130 3300025272 Ga0209455_1011654 Ga0209455_10116542 138
131 3300025901 Ga0207688_10025364 Ga0207688_100253644 138
132 3300025903 Ga0207680_10246382 Ga0207680_102463822 138
133 3300025907 Ga0207645_10402500 Ga0207645_104025002 138
134 3300025909 Ga0207705_10067321 Ga0207705_100673214 138
135 3300025911 Ga0207654_10046246 Ga0207654_100462464 138
136 3300025911 Ga0207654_10215865 Ga0207654_102158652 138
137 3300025912 Ga0207707_10191064 Ga0207707_101910642 138
138 3300025913 Ga0207695_10017780 Ga0207695_100177803 138
139 3300025913 Ga0207695_10299379 Ga0207695_102993792 138
140 3300025913 Ga0207695_10310466 Ga0207695_103104662 138
141 3300025913 Ga0207695_10443734 Ga0207695_104437342 138
142 3300025913 Ga0207695_10512024 Ga0207695_105120242 138
143 3300025913 Ga0207695_10512993 Ga0207695_105129932 138
144 3300025913 Ga0207695_10840125 Ga0207695_108401252 138
145 3300025913 Ga0207695_10979182 Ga0207695_109791822 138
146 3300025914 Ga0207671_10180321 Ga0207671_101803212 138
147 3300025914 Ga0207671_10775268 Ga0207671_107752681 138
148 3300025914 Ga0207671_10854690 Ga0207671_108546902 138
149 3300025918 Ga0207662_11183613 Ga0207662_111836131 138
150 3300025919 Ga0207657_10346636 Ga0207657_103466361 138
151 3300025921 Ga0207652_10939330 Ga0207652_109393302 138
152 3300025921 Ga0207652_11277428 Ga0207652_112774282 138
153 3300025925 Ga0207650_10315676 Ga0207650_103156763 138
154 3300025926 Ga0207659_10408966 Ga0207659_104089662 138
155 3300025928 Ga0207700_10066687 Ga0207700_100666874 138
156 3300025929 Ga0207664_10715566 Ga0207664_107155662 138
157 3300025931 Ga0207644_10811211 Ga0207644_108112112 138
158 3300025934 Ga0207686_10434417 Ga0207686_104344173 138
159 3300025934 Ga0207686_10839866 Ga0207686_108398662 138
160 3300025935 Ga0207709_10186140 Ga0207709_101861402 138
161 3300025938 Ga0207704_10013802 Ga0207704_100138021 138
162 3300025938 Ga0207704_10199028 Ga0207704_101990283 138
163 3300025941 Ga0207711_10062650 Ga0207711_100626503 138
164 3300025941 Ga0207711_10427967 Ga0207711_104279672 138
165 3300025942 Ga0207689_10003177 Ga0207689_100031775 138
166 3300025942 Ga0207689_10190745 Ga0207689_101907452 138
167 3300025942 Ga0207689_10285516 Ga0207689_102855162 138
168 3300025942 Ga0207689_10791405 Ga0207689_107914051 138
169 3300025944 Ga0207661_10370500 Ga0207661_103705002 138
170 3300025944 Ga0207661_10507820 Ga0207661_105078203 138
171 3300025949 Ga0207667_10077854 Ga0207667_100778545 138
172 3300025949 Ga0207667_10662468 Ga0207667_106624682 138
173 3300025961 Ga0207712_11531567 Ga0207712_115315671 138
174 3300026035 Ga0207703_10050393 Ga0207703_100503933 138
175 3300026035 Ga0207703_10995148 Ga0207703_109951482 138
176 3300026041 Ga0207639_10020512 Ga0207639_100205124 138
177 3300026041 Ga0207639_10293699 Ga0207639_102936992 138
178 3300026041 Ga0207639_10448844 Ga0207639_104488442 138
179 3300026078 Ga0207702_10335334 Ga0207702_103353342 138
180 3300026089 Ga0207648_10012856 Ga0207648_100128567 138
181 3300026116 Ga0207674_10212101 Ga0207674_102121014 138
182 3300026116 Ga0207674_10258480 Ga0207674_102584802 138
183 3300026116 Ga0207674_10769696 Ga0207674_107696962 138
184 3300026121 Ga0207683_10012265 Ga0207683_100122654 138
185 3300026121 Ga0207683_10043437 Ga0207683_100434374 138
186 3300026121 Ga0207683_10388925 Ga0207683_103889252 138
187 3300026142 Ga0207698_10135508 Ga0207698_101355082 138
188 3300028379 Ga0268266_10000847 Ga0268266_1000084723 138
189 3300028379 Ga0268266_10005124 Ga0268266_100051244 138
190 3300028379 Ga0268266_10074199 Ga0268266_100741994 138
191 3300028379 Ga0268266_10078860 Ga0268266_100788602 138
192 3300028380 Ga0268265_12103456 Ga0268265_121034561 138
193 3300028381 Ga0268264_10775567 Ga0268264_107755672 138
194 3300028800 Ga0265338_10004163 Ga0265338_1000416313 138
195 3300031235 Ga0265330_10003149 Ga0265330_100031498 138
196 3300031238 Ga0265332_10017562 Ga0265332_100175622 138
197 3300031241 Ga0265325_10001683 Ga0265325_1000168314 138
198 3300031247 Ga0265340_10090079 Ga0265340_100900792 138
199 3300031249 Ga0265339_10006313 Ga0265339_100063136 138
200 3300031249 Ga0265339_10042424 Ga0265339_100424244 138
201 3300031250 Ga0265331_10035880 Ga0265331_100358804 138
202 3300031250 Ga0265331_10131481 Ga0265331_101314812 138
203 3300031344 Ga0265316_10019292 Ga0265316_100192922 138
204 3300031344 Ga0265316_10074673 Ga0265316_100746733 138
205 3300031456 Ga0307513_10214087 Ga0307513_102140873 138
206 3300031595 Ga0265313_10009088 Ga0265313_100090887 138
207 3300031595 Ga0265313_10112848 Ga0265313_101128482 138
208 3300031711 Ga0265314_10012288 Ga0265314_100122888 138
209 3300031712 Ga0265342_10026742 Ga0265342_100267426 138
210 3300031712 Ga0265342_10060988 Ga0265342_100609882 138
211 3300031730 Ga0307516_10070469 Ga0307516_100704692 138
212 3300037418 Ga0395900_0363077 Ga0395900_0363077_939_1355 138
213 3300037466 Ga0395898_0015029 Ga0395898_0015029_216_632 138
214 3300038443 Ga0395901_0349763 Ga0395901_0349763_1020_1436 138
215 3300039450 Ga0436363_0134827 Ga0436363_0134827_38_460 138
216 3300044842 Ga0466957_0814944 Ga0466957_0814944_185_601 138
217 3300044901 Ga0466960_0812365 Ga0466960_0812365_133_549 138
218 3300046492 Ga0495585_0390793 Ga0495585_0390793_186_602 138
219 3300046516 Ga0495628_0580095 Ga0495628_0580095_35_451 138
220 3300046524 Ga0495648_0316112 Ga0495648_0316112_291_707 138
221 3300046536 Ga0495587_0368170 Ga0495587_0368170_225_641 138
222 3300046648 Ga0495611_0131968 Ga0495611_0131968_596_1012 138
223 3300046660 Ga0495625_0383416 Ga0495625_0383416_162_578 138
224 3300046660 Ga0495625_0506820 Ga0495625_0506820_228_644 138
225 3300046809 Ga0495600_0595321 Ga0495600_0595321_93_509 138
226 3300047472 Ga0495686_0254891 Ga0495686_0254891_292_708 138
227 3300048088 Ga0495602_0041073 Ga0495602_0041073_3720_4136 138
228 3300048924 Ga0496121_0071754 Ga0496121_0071754_976_1392 138
229 3300049568 Ga0501031_0007877 Ga0501031_0007877_4469_4885 138
230 3300049569 Ga0501032_0019863 Ga0501032_0019863_2614_3030 138
231 3300049569 Ga0501032_0163522 Ga0501032_0163522_717_1142 138
232 3300049569 Ga0501032_0293860 Ga0501032_0293860_221_637 138
233 3300049569 Ga0501032_0711254 Ga0501032_0711254_193_609 138
234 3300049570 Ga0501033_0044818 Ga0501033_0044818_2692_3108 138
235 3300049570 Ga0501033_0144096 Ga0501033_0144096_122_538 138
236 3300049570 Ga0501033_0156420 Ga0501033_0156420_840_1256 138
237 3300049570 Ga0501033_0541501 Ga0501033_0541501_138_554 138
238 3300049571 Ga0501034_0006981 Ga0501034_0006981_3067_3483 138
239 3300049571 Ga0501034_0166706 Ga0501034_0166706_1736_2152 138
240 3300049571 Ga0501034_0661179 Ga0501034_0661179_348_764 138
241 3300049571 Ga0501034_0680964 Ga0501034_0680964_375_791 138
242 3300049573 Ga0501037_0008477 Ga0501037_0008477_4599_5015 138
243 3300049574 Ga0501038_0007322 Ga0501038_0007322_5917_6333 138
244 3300049574 Ga0501038_0215371 Ga0501038_0215371_429_845 138
245 3300049574 Ga0501038_0570231 Ga0501038_0570231_182_598 138
246 3300049575 Ga0501039_0001379 Ga0501039_0001379_4696_5112 138
247 3300049579 Ga0501043_0018860 Ga0501043_0018860_4622_5038 138
248 3300049579 Ga0501043_0154284 Ga0501043_0154284_365_781 138
249 3300049579 Ga0501043_0190958 Ga0501043_0190958_683_1099 138
250 3300049579 Ga0501043_0302009 Ga0501043_0302009_200_625 138
251 3300049579 Ga0501043_0596531 Ga0501043_0596531_383_799 138
252 3300049580 Ga0501046_0020811 Ga0501046_0020811_1110_1526 138
253 3300049580 Ga0501046_0255697 Ga0501046_0255697_530_946 138
254 3300049580 Ga0501046_1094643 Ga0501046_1094643_85_501 138
255 3300049581 Ga0501047_0015429 Ga0501047_0015429_2812_3237 138
256 3300049581 Ga0501047_0015784 Ga0501047_0015784_492_908 138
257 3300049581 Ga0501047_0027448 Ga0501047_0027448_1212_1628 138
258 3300049581 Ga0501047_0139561 Ga0501047_0139561_761_1177 138
259 3300049581 Ga0501047_1305409 Ga0501047_1305409_107_523 138
260 3300049582 Ga0501048_0025496 Ga0501048_0025496_2083_2499 138
261 3300049583 Ga0501067_0001970 Ga0501067_0001970_6285_6701 138
262 3300049584 Ga0501068_0014415 Ga0501068_0014415_1725_2141 138
263 3300049585 Ga0501069_0003406 Ga0501069_0003406_5135_5551 138
264 3300049586 Ga0501070_0011200 Ga0501070_0011200_3025_3441 138
265 3300049586 Ga0501070_0732681 Ga0501070_0732681_220_645 138
266 3300049587 Ga0501071_0648752 Ga0501071_0648752_226_642 138
267 3300049589 Ga0501073_0012247 Ga0501073_0012247_4862_5278 138
268 3300049589 Ga0501073_0200527 Ga0501073_0200527_664_1080 138
269 3300049589 Ga0501073_0740850 Ga0501073_0740850_94_519 138
270 3300049592 Ga0501076_0223735 Ga0501076_0223735_469_885 138
271 3300049741 Ga0501079_0004716 Ga0501079_0004716_5649_6065 138
272 3300049742 Ga0501080_0040900 Ga0501080_0040900_1802_2218 138
273 3300049742 Ga0501080_0074514 Ga0501080_0074514_1783_2199 138
274 3300049744 Ga0501083_0015213 Ga0501083_0015213_2074_2490 138
275 3300049822 Ga0501035_0003644 Ga0501035_0003644_8661_9077 138
276 3300049822 Ga0501035_0008954 Ga0501035_0008954_623_1039 138
277 3300049822 Ga0501035_0036634 Ga0501035_0036634_3021_3446 138
278 3300049822 Ga0501035_0180766 Ga0501035_0180766_314_730 138
279 3300049822 Ga0501035_1086961 Ga0501035_1086961_160_576 138
280 3300049823 Ga0501044_0006795 Ga0501044_0006795_3567_3983 138
281 3300049823 Ga0501044_0007302 Ga0501044_0007302_8375_8791 138
282 3300049823 Ga0501044_0008500 Ga0501044_0008500_8917_9342 138
283 3300049823 Ga0501044_0028768 Ga0501044_0028768_3006_3422 138
284 3300049823 Ga0501044_0051986 Ga0501044_0051986_1999_2415 138
285 3300049823 Ga0501044_0519005 Ga0501044_0519005_91_507 138
286 3300049823 Ga0501044_1164219 Ga0501044_1164219_39_455 138
287 3300053087 Ga0500643_000027 Ga0500643_000027_40779_41195 138
288 3300053087 Ga0500643_020314 Ga0500643_020314_330_746 138
289 3300053116 Ga0500592_007035 Ga0500592_007035_1275_1691 138
290 3300053119 Ga0500595_002521 Ga0500595_002521_4866_5282 138
291 3300053119 Ga0500595_029268 Ga0500595_029268_802_1218 138
292 3300053119 Ga0500595_037337 Ga0500595_037337_1147_1563 138
293 3300053130 Ga0500642_0406288 Ga0500642_0406288_75_491 138
294 3300053139 Ga0500568_0017760 Ga0500568_0017760_1662_2078 138
295 3300053140 Ga0500573_0387569 Ga0500573_0387569_113_529 138
296 3300053142 Ga0500577_0098121 Ga0500577_0098121_340_756 138
297 3300053727 Ga0500611_021458 Ga0500611_021458_412_828 138
298 3300054114 Ga0501084_0003057 Ga0501084_0003057_7470_7886 138
299 3300054114 Ga0501084_0023056 Ga0501084_0023056_2794_3210 138
300 3300060353 Ga0501082_0009507 Ga0501082_0009507_2379_2795 138
301 3300061734 Ga0530510_1226568 Ga0530510_1226568_32_448 138
302 3300003320 rootH2_10001888 rootH2_1000188812 139
303 3300005344 Ga0070661_100000254 Ga0070661_10000025421 139
304 3300009093 Ga0105240_10296666 Ga0105240_102966663 139
305 3300013104 Ga0157370_11004401 Ga0157370_110044011 139
306 3300025913 Ga0207695_10342542 Ga0207695_103425422 139
307 3300025920 Ga0207649_10000026 Ga0207649_1000002641 139
308 3300031250 Ga0265331_10000008 Ga0265331_10000008162 139
309 3300031251 Ga0265327_10000036 Ga0265327_1000003642 139
310 3300031712 Ga0265342_10013775 Ga0265342_100137758 139
311 3300035083 Ga0373926_0129244 Ga0373926_0129244_230_649 139
312 3300035111 Ga0373923_0373472 Ga0373923_0373472_221_640 139
313 3300035115 Ga0373941_0067547 Ga0373941_0067547_77_496 139
314 3300035116 Ga0373945_0081986 Ga0373945_0081986_613_1032 139
315 3300035170 Ga0373943_0003007 Ga0373943_0003007_5950_6369 139
316 3300035171 Ga0373946_0023585 Ga0373946_0023585_1115_1534 139
317 3300035692 Ga0373935_0011561 Ga0373935_0011561_4792_5211 139
318 3300035695 Ga0373927_0396158 Ga0373927_0396158_230_649 139
319 3300035725 Ga0373947_0164233 Ga0373947_0164233_873_1292 139
320 3300037068 Ga0373925_0001182 Ga0373925_0001182_449_868 139
321 3300037068 Ga0373925_0067791 Ga0373925_0067791_1187_1606 139
322 3300048929 Ga0496126_0000463 Ga0496126_0000463_57806_58225 139
323 3300049569 Ga0501032_0044836 Ga0501032_0044836_923_1342 139
324 3300049570 Ga0501033_0027756 Ga0501033_0027756_3557_3976 139
325 3300049571 Ga0501034_0157235 Ga0501034_0157235_429_848 139
326 3300049573 Ga0501037_0075833 Ga0501037_0075833_1964_2383 139
327 3300049579 Ga0501043_0075617 Ga0501043_0075617_2021_2440 139
328 3300049580 Ga0501046_0525665 Ga0501046_0525665_338_757 139
329 3300049584 Ga0501068_0328283 Ga0501068_0328283_474_893 139
330 3300049586 Ga0501070_0047024 Ga0501070_0047024_166_585 139
331 3300049586 Ga0501070_0372033 Ga0501070_0372033_403_822 139
332 3300049589 Ga0501073_0124159 Ga0501073_0124159_279_698 139
333 3300049742 Ga0501080_0082630 Ga0501080_0082630_1096_1515 139
334 3300049742 Ga0501080_0138827 Ga0501080_0138827_1720_2139 139
335 3300049822 Ga0501035_0010036 Ga0501035_0010036_7370_7789 139
336 3300049823 Ga0501044_0222798 Ga0501044_0222798_1138_1557 139
337 3300054114 Ga0501084_0280206 Ga0501084_0280206_744_1163 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

26

142

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.9186 5 139
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.913 6 137
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9097 1 139
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9094 4 137
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.907 1 139
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8969 1 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8908 1 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8851 1 138 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.881 2 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8792 1 138 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A2U0T9U8-F1-model_v4 deleted 0.9588 1 139
AF-A0A0D6MWM4-F1-model_v4 deleted 0.9573 1 139
AF-A0A6P2JMJ1-F1-model_v4 YjbQ family protein 0.9571 1 139
AF-A0A1X7PM13-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9569 5 137
AF-A0A228GMY0-F1-model_v4 deleted 0.9568 1 139

Feature Viewer

pLDDT pTM Quality
91.38 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map