F413001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 172 | 337 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_100401140|Ga0068852_1004011402 |
| Length | 145 |
| Sequence | MYFAEITMNQTFHTITVPTRGPGLYEFTDEATDFVRGAKIADGLLTCFIRHTSASLLIQENADPDVQRDLQDFFAWLATSGPRFRHTTEGPDDMPSHIRSALTQVSLGIPVAKGRLALGTWQGIYVFEHRDAPHRREVTLHLIGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 30 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 108 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 109 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 116 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 122 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 163 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 164 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 165 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 166 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 167 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 168 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 169 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 170 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.15 |
| Nodule | 0 |
| Rhizoplane | 0.3 |
| Rhizosphere | 93.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10001888 | 3300003320 | Bacteria | 9122 |
| 2 | rootH2_10029615 | 3300003320 | Bacteria | 1983 |
| 3 | Ga0070658_10017310 | 3300005327 | Bacteria | 5768 |
| 4 | Ga0070658_11041738 | 3300005327 | Bacteria | 712 |
| 5 | Ga0070683_101809973 | 3300005329 | Bacteria | 587 |
| 6 | Ga0070670_100154306 | 3300005331 | Bacteria | 1988 |
| 7 | Ga0068869_100109017 | 3300005334 | Bacteria | 2104 |
| 8 | Ga0068868_100103692 | 3300005338 | Bacteria | 2304 |
| 9 | Ga0070660_100586160 | 3300005339 | Bacteria | 932 |
| 10 | Ga0070661_100000254 | 3300005344 | Bacteria | 43578 |
| 11 | Ga0070661_101055119 | 3300005344 | Bacteria | 676 |
| 12 | Ga0070668_100936613 | 3300005347 | Bacteria | 776 |
| 13 | Ga0070714_101414449 | 3300005435 | Bacteria | 679 |
| 14 | Ga0070713_100832030 | 3300005436 | Bacteria | 886 |
| 15 | Ga0070713_101071100 | 3300005436 | Bacteria | 779 |
| 16 | Ga0070713_101373299 | 3300005436 | Bacteria | 685 |
| 17 | Ga0070710_10900497 | 3300005437 | Bacteria | 639 |
| 18 | Ga0070710_11252823 | 3300005437 | Bacteria | 550 |
| 19 | Ga0070711_100779611 | 3300005439 | Bacteria | 810 |
| 20 | Ga0070700_100687498 | 3300005441 | Bacteria | 812 |
| 21 | Ga0070678_100007429 | 3300005456 | Bacteria | 6500 |
| 22 | Ga0070662_100542480 | 3300005457 | Bacteria | 974 |
| 23 | Ga0070681_10141132 | 3300005458 | Bacteria | 2339 |
| 24 | Ga0070681_10843191 | 3300005458 | Bacteria | 834 |
| 25 | Ga0068867_100016001 | 3300005459 | Bacteria | 5325 |
| 26 | Ga0068867_100134146 | 3300005459 | Bacteria | 1928 |
| 27 | Ga0070685_10124573 | 3300005466 | Bacteria | 1604 |
| 28 | Ga0070679_100119650 | 3300005530 | Bacteria | 2618 |
| 29 | Ga0070679_100184525 | 3300005530 | Bacteria | 2058 |
| 30 | Ga0070679_100686229 | 3300005530 | Bacteria | 967 |
| 31 | Ga0070684_100169556 | 3300005535 | Bacteria | 1982 |
| 32 | Ga0070684_101126001 | 3300005535 | Bacteria | 738 |
| 33 | Ga0070684_101769050 | 3300005535 | Bacteria | 583 |
| 34 | Ga0068853_100037237 | 3300005539 | Bacteria | 4139 |
| 35 | Ga0068853_100142065 | 3300005539 | Bacteria | 2155 |
| 36 | Ga0070672_100463987 | 3300005543 | Bacteria | 1092 |
| 37 | Ga0070672_101778091 | 3300005543 | Bacteria | 554 |
| 38 | Ga0070665_100001302 | 3300005548 | Bacteria | 29816 |
| 39 | Ga0070665_100125846 | 3300005548 | Bacteria | 2565 |
| 40 | Ga0070665_100205755 | 3300005548 | Bacteria | 1969 |
| 41 | Ga0070665_100740796 | 3300005548 | Bacteria | 996 |
| 42 | Ga0068855_100065280 | 3300005563 | Bacteria | 4243 |
| 43 | Ga0068855_100268381 | 3300005563 | Bacteria | 1898 |
| 44 | Ga0068857_100174122 | 3300005577 | Bacteria | 1957 |
| 45 | Ga0068857_100179817 | 3300005577 | Bacteria | 1925 |
| 46 | Ga0068856_100118813 | 3300005614 | Bacteria | 2644 |
| 47 | Ga0068856_100181514 | 3300005614 | Bacteria | 2118 |
| 48 | Ga0068852_100401140 | 3300005616 | Bacteria | 1349 |
| 49 | Ga0068852_101425219 | 3300005616 | Bacteria | 715 |
| 50 | Ga0068866_10116445 | 3300005718 | Bacteria | 1499 |
| 51 | Ga0068866_10284587 | 3300005718 | Bacteria | 1026 |
| 52 | Ga0068870_10080190 | 3300005840 | Bacteria | 1803 |
| 53 | Ga0068863_102032652 | 3300005841 | Bacteria | 585 |
| 54 | Ga0068862_100392497 | 3300005844 | Bacteria | 1297 |
| 55 | Ga0068862_100429343 | 3300005844 | Bacteria | 1242 |
| 56 | Ga0068871_100042130 | 3300006358 | Bacteria | 3663 |
| 57 | Ga0105240_10019617 | 3300009093 | Bacteria | 9031 |
| 58 | Ga0105240_10049843 | 3300009093 | Bacteria | 5282 |
| 59 | Ga0105240_10295631 | 3300009093 | Bacteria | 1854 |
| 60 | Ga0105240_10296666 | 3300009093 | Bacteria | 1851 |
| 61 | Ga0105240_10405960 | 3300009093 | Bacteria | 1533 |
| 62 | Ga0105240_10449694 | 3300009093 | Bacteria | 1442 |
| 63 | Ga0105240_10791179 | 3300009093 | Bacteria | 1028 |
| 64 | Ga0105240_11419874 | 3300009093 | Bacteria | 729 |
| 65 | Ga0105243_10004582 | 3300009148 | Bacteria | 10901 |
| 66 | Ga0105241_10179588 | 3300009174 | Bacteria | 1755 |
| 67 | Ga0105241_10309542 | 3300009174 | Bacteria | 1358 |
| 68 | Ga0105242_10051210 | 3300009176 | Bacteria | 3364 |
| 69 | Ga0105242_10382872 | 3300009176 | Bacteria | 1308 |
| 70 | Ga0105242_11170672 | 3300009176 | Bacteria | 786 |
| 71 | Ga0105248_10141690 | 3300009177 | Bacteria | 2712 |
| 72 | Ga0105248_10208380 | 3300009177 | Bacteria | 2202 |
| 73 | Ga0105237_10229518 | 3300009545 | Bacteria | 1857 |
| 74 | Ga0105237_10292733 | 3300009545 | Bacteria | 1631 |
| 75 | Ga0105237_10367097 | 3300009545 | Bacteria | 1444 |
| 76 | Ga0105237_10840849 | 3300009545 | Bacteria | 925 |
| 77 | Ga0105238_10104427 | 3300009551 | Bacteria | 2814 |
| 78 | Ga0105238_10247833 | 3300009551 | Bacteria | 1759 |
| 79 | Ga0105238_10548193 | 3300009551 | Bacteria | 1160 |
| 80 | Ga0105238_11829918 | 3300009551 | Bacteria | 639 |
| 81 | Ga0105238_11892276 | 3300009551 | Bacteria | 629 |
| 82 | Ga0105238_12411707 | 3300009551 | Bacteria | 562 |
| 83 | Ga0105249_10064235 | 3300009553 | Bacteria | 3374 |
| 84 | Ga0105249_10315866 | 3300009553 | Bacteria | 1572 |
| 85 | Ga0105239_10016304 | 3300010375 | Bacteria | 8215 |
| 86 | Ga0105239_10149177 | 3300010375 | Bacteria | 2609 |
| 87 | Ga0105239_11087442 | 3300010375 | Bacteria | 920 |
| 88 | Ga0105239_11111588 | 3300010375 | Bacteria | 910 |
| 89 | Ga0105239_11276586 | 3300010375 | Bacteria | 847 |
| 90 | Ga0105239_11569605 | 3300010375 | Bacteria | 761 |
| 91 | Ga0105239_13405419 | 3300010375 | Bacteria | 517 |
| 92 | Ga0105246_11129919 | 3300011119 | Bacteria | 717 |
| 93 | Ga0105246_11455412 | 3300011119 | Bacteria | 641 |
| 94 | Ga0157373_10272751 | 3300013100 | Bacteria | 1198 |
| 95 | Ga0157370_10025977 | 3300013104 | Bacteria | 5788 |
| 96 | Ga0157370_10030611 | 3300013104 | Bacteria | 5273 |
| 97 | Ga0157370_11004401 | 3300013104 | Bacteria | 755 |
| 98 | Ga0157370_11204778 | 3300013104 | Bacteria | 683 |
| 99 | Ga0157369_10308172 | 3300013105 | Bacteria | 1646 |
| 100 | Ga0157369_10628342 | 3300013105 | Bacteria | 1108 |
| 101 | Ga0157374_10182136 | 3300013296 | Bacteria | 2052 |
| 102 | Ga0157378_10316955 | 3300013297 | Bacteria | 1514 |
| 103 | Ga0157378_10406893 | 3300013297 | Bacteria | 1342 |
| 104 | Ga0163162_10243736 | 3300013306 | Bacteria | 1929 |
| 105 | Ga0163162_10270773 | 3300013306 | Bacteria | 1830 |
| 106 | Ga0163162_11831129 | 3300013306 | Bacteria | 694 |
| 107 | Ga0157372_11425884 | 3300013307 | Bacteria | 798 |
| 108 | Ga0157372_12148173 | 3300013307 | Bacteria | 641 |
| 109 | Ga0157375_10118439 | 3300013308 | Bacteria | 2754 |
| 110 | Ga0163163_10000012 | 3300014325 | Bacteria | 257369 |
| 111 | Ga0163163_10169880 | 3300014325 | Bacteria | 2227 |
| 112 | Ga0163163_10327960 | 3300014325 | Bacteria | 1585 |
| 113 | Ga0163163_12943690 | 3300014325 | Unclassified | 531 |
| 114 | Ga0157379_10003912 | 3300014968 | Bacteria | 12701 |
| 115 | Ga0157379_10498286 | 3300014968 | Bacteria | 1129 |
| 116 | Ga0157379_10696466 | 3300014968 | Bacteria | 953 |
| 117 | Ga0157376_10259642 | 3300014969 | Bacteria | 1627 |
| 118 | Ga0157376_11185013 | 3300014969 | Bacteria | 792 |
| 119 | Ga0163161_10077000 | 3300017792 | Bacteria | 2449 |
| 120 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 121 | Ga0209233_1004865 | 3300025261 | Bacteria | 4522 |
| 122 | Ga0209455_1011654 | 3300025272 | Bacteria | 2151 |
| 123 | Ga0207688_10025364 | 3300025901 | Bacteria | 3255 |
| 124 | Ga0207680_10246382 | 3300025903 | Bacteria | 1233 |
| 125 | Ga0207645_10402500 | 3300025907 | Bacteria | 921 |
| 126 | Ga0207705_10067321 | 3300025909 | Bacteria | 2592 |
| 127 | Ga0207654_10046246 | 3300025911 | Bacteria | 2481 |
| 128 | Ga0207654_10215865 | 3300025911 | Bacteria | 1270 |
| 129 | Ga0207707_10191064 | 3300025912 | Bacteria | 1786 |
| 130 | Ga0207695_10017780 | 3300025913 | Bacteria | 8249 |
| 131 | Ga0207695_10299379 | 3300025913 | Bacteria | 1500 |
| 132 | Ga0207695_10310466 | 3300025913 | Bacteria | 1467 |
| 133 | Ga0207695_10342542 | 3300025913 | Bacteria | 1382 |
| 134 | Ga0207695_10443734 | 3300025913 | Bacteria | 1181 |
| 135 | Ga0207695_10512024 | 3300025913 | Bacteria | 1082 |
| 136 | Ga0207695_10512993 | 3300025913 | Bacteria | 1081 |
| 137 | Ga0207695_10840125 | 3300025913 | Bacteria | 798 |
| 138 | Ga0207695_10979182 | 3300025913 | Bacteria | 725 |
| 139 | Ga0207671_10180321 | 3300025914 | Bacteria | 1643 |
| 140 | Ga0207671_10775268 | 3300025914 | Bacteria | 761 |
| 141 | Ga0207671_10854690 | 3300025914 | Bacteria | 720 |
| 142 | Ga0207662_11183613 | 3300025918 | Bacteria | 543 |
| 143 | Ga0207657_10346636 | 3300025919 | Bacteria | 1172 |
| 144 | Ga0207649_10000026 | 3300025920 | Bacteria | 177395 |
| 145 | Ga0207652_10939330 | 3300025921 | Bacteria | 762 |
| 146 | Ga0207652_11277428 | 3300025921 | Bacteria | 636 |
| 147 | Ga0207650_10315676 | 3300025925 | Bacteria | 1279 |
| 148 | Ga0207659_10408966 | 3300025926 | Bacteria | 1136 |
| 149 | Ga0207700_10066687 | 3300025928 | Bacteria | 2752 |
| 150 | Ga0207664_10715566 | 3300025929 | Bacteria | 900 |
| 151 | Ga0207644_10811211 | 3300025931 | Bacteria | 783 |
| 152 | Ga0207686_10434417 | 3300025934 | Bacteria | 1007 |
| 153 | Ga0207686_10839866 | 3300025934 | Bacteria | 738 |
| 154 | Ga0207709_10186140 | 3300025935 | Bacteria | 1471 |
| 155 | Ga0207704_10013802 | 3300025938 | Bacteria | 4058 |
| 156 | Ga0207704_10199028 | 3300025938 | Bacteria | 1464 |
| 157 | Ga0207665_10604638 | 3300025939 | Bacteria | 856 |
| 158 | Ga0207711_10062650 | 3300025941 | Bacteria | 3208 |
| 159 | Ga0207711_10427967 | 3300025941 | Bacteria | 1231 |
| 160 | Ga0207689_10003177 | 3300025942 | Bacteria | 15066 |
| 161 | Ga0207689_10190745 | 3300025942 | Bacteria | 1691 |
| 162 | Ga0207689_10285516 | 3300025942 | Bacteria | 1367 |
| 163 | Ga0207689_10791405 | 3300025942 | Bacteria | 800 |
| 164 | Ga0207661_10370500 | 3300025944 | Bacteria | 1295 |
| 165 | Ga0207661_10507820 | 3300025944 | Bacteria | 1102 |
| 166 | Ga0207667_10077854 | 3300025949 | Bacteria | 3437 |
| 167 | Ga0207667_10662468 | 3300025949 | Bacteria | 1048 |
| 168 | Ga0207712_11531567 | 3300025961 | Bacteria | 597 |
| 169 | Ga0207703_10050393 | 3300026035 | Bacteria | 3370 |
| 170 | Ga0207703_10995148 | 3300026035 | Bacteria | 804 |
| 171 | Ga0207639_10020512 | 3300026041 | Bacteria | 4730 |
| 172 | Ga0207639_10293699 | 3300026041 | Bacteria | 1434 |
| 173 | Ga0207639_10448844 | 3300026041 | Bacteria | 1170 |
| 174 | Ga0207702_10335334 | 3300026078 | Bacteria | 1444 |
| 175 | Ga0207648_10012856 | 3300026089 | Bacteria | 7817 |
| 176 | Ga0207674_10212101 | 3300026116 | Bacteria | 1885 |
| 177 | Ga0207674_10258480 | 3300026116 | Bacteria | 1689 |
| 178 | Ga0207674_10769696 | 3300026116 | Bacteria | 929 |
| 179 | Ga0207683_10012265 | 3300026121 | Bacteria | 7315 |
| 180 | Ga0207683_10043437 | 3300026121 | Bacteria | 3928 |
| 181 | Ga0207683_10388925 | 3300026121 | Bacteria | 1282 |
| 182 | Ga0207698_10135508 | 3300026142 | Bacteria | 2112 |
| 183 | Ga0268266_10000847 | 3300028379 | Bacteria | 39858 |
| 184 | Ga0268266_10005124 | 3300028379 | Bacteria | 12352 |
| 185 | Ga0268266_10074199 | 3300028379 | Bacteria | 2954 |
| 186 | Ga0268266_10078860 | 3300028379 | Bacteria | 2866 |
| 187 | Ga0268265_12103456 | 3300028380 | Bacteria | 571 |
| 188 | Ga0268264_10775567 | 3300028381 | Bacteria | 956 |
| 189 | Ga0265338_10004163 | 3300028800 | Bacteria | 19762 |
| 190 | Ga0265338_10285441 | 3300028800 | Bacteria | 1204 |
| 191 | Ga0265330_10003149 | 3300031235 | Bacteria | 8730 |
| 192 | Ga0265332_10017562 | 3300031238 | Bacteria | 3156 |
| 193 | Ga0265325_10001683 | 3300031241 | Bacteria | 15359 |
| 194 | Ga0265340_10090079 | 3300031247 | Bacteria | 1435 |
| 195 | Ga0265339_10006313 | 3300031249 | Bacteria | 7791 |
| 196 | Ga0265339_10042424 | 3300031249 | Bacteria | 2519 |
| 197 | Ga0265331_10000008 | 3300031250 | Bacteria | 324311 |
| 198 | Ga0265331_10035880 | 3300031250 | Bacteria | 2437 |
| 199 | Ga0265331_10131481 | 3300031250 | Bacteria | 1141 |
| 200 | Ga0265327_10000036 | 3300031251 | Bacteria | 312827 |
| 201 | Ga0265316_10019292 | 3300031344 | Bacteria | 5837 |
| 202 | Ga0265316_10074673 | 3300031344 | Bacteria | 2609 |
| 203 | Ga0307513_10214087 | 3300031456 | Bacteria | 1755 |
| 204 | Ga0265313_10009088 | 3300031595 | Bacteria | 6501 |
| 205 | Ga0265313_10112848 | 3300031595 | Bacteria | 1193 |
| 206 | Ga0265314_10012288 | 3300031711 | Bacteria | 6997 |
| 207 | Ga0265342_10013775 | 3300031712 | Bacteria | 5400 |
| 208 | Ga0265342_10026742 | 3300031712 | Bacteria | 3613 |
| 209 | Ga0265342_10060988 | 3300031712 | Bacteria | 2223 |
| 210 | Ga0307516_10070469 | 3300031730 | Bacteria | 3359 |
| 211 | Ga0373926_0129244 | 3300035083 | Bacteria | 956 |
| 212 | Ga0373923_0373472 | 3300035111 | Unclassified | 683 |
| 213 | Ga0373941_0067547 | 3300035115 | Unclassified | 1179 |
| 214 | Ga0373945_0081986 | 3300035116 | Bacteria | 1237 |
| 215 | Ga0373943_0003007 | 3300035170 | Bacteria | 7654 |
| 216 | Ga0373946_0023585 | 3300035171 | Bacteria | 2406 |
| 217 | Ga0373935_0011561 | 3300035692 | Bacteria | 5300 |
| 218 | Ga0373927_0396158 | 3300035695 | Bacteria | 911 |
| 219 | Ga0373947_0164233 | 3300035725 | Bacteria | 1437 |
| 220 | Ga0373925_0001182 | 3300037068 | Bacteria | 23075 |
| 221 | Ga0373925_0067791 | 3300037068 | Bacteria | 2692 |
| 222 | Ga0395900_0363077 | 3300037418 | Bacteria | 1419 |
| 223 | Ga0395898_0015029 | 3300037466 | Bacteria | 7946 |
| 224 | Ga0395901_0349763 | 3300038443 | Bacteria | 1525 |
| 225 | Ga0436363_0134827 | 3300039450 | Bacteria | 506 |
| 226 | Ga0466963_0426828 | 3300044694 | Bacteria | 935 |
| 227 | Ga0466957_0814944 | 3300044842 | Bacteria | 664 |
| 228 | Ga0466960_0812365 | 3300044901 | Bacteria | 567 |
| 229 | Ga0466967_1437056 | 3300045976 | Bacteria | 687 |
| 230 | Ga0495585_0390793 | 3300046492 | Bacteria | 671 |
| 231 | Ga0495628_0580095 | 3300046516 | Bacteria | 803 |
| 232 | Ga0495648_0316112 | 3300046524 | Bacteria | 726 |
| 233 | Ga0495587_0368170 | 3300046536 | Unclassified | 800 |
| 234 | Ga0495611_0131968 | 3300046648 | Bacteria | 1165 |
| 235 | Ga0495625_0383416 | 3300046660 | Bacteria | 881 |
| 236 | Ga0495625_0506820 | 3300046660 | Bacteria | 737 |
| 237 | Ga0495600_0595321 | 3300046809 | Unclassified | 672 |
| 238 | Ga0495686_0254891 | 3300047472 | Bacteria | 985 |
| 239 | Ga0495686_0485341 | 3300047472 | Bacteria | 652 |
| 240 | Ga0495602_0041073 | 3300048088 | Bacteria | 4230 |
| 241 | Ga0496101_0250203 | 3300048904 | Bacteria | 1381 |
| 242 | Ga0496121_0071754 | 3300048924 | Bacteria | 2783 |
| 243 | Ga0496126_0000463 | 3300048929 | Bacteria | 80860 |
| 244 | Ga0501031_0007877 | 3300049568 | Bacteria | 6933 |
| 245 | Ga0501031_0111873 | 3300049568 | Bacteria | 1783 |
| 246 | Ga0501032_0019863 | 3300049569 | Bacteria | 4690 |
| 247 | Ga0501032_0044836 | 3300049569 | Bacteria | 2992 |
| 248 | Ga0501032_0163522 | 3300049569 | Bacteria | 1461 |
| 249 | Ga0501032_0293860 | 3300049569 | Bacteria | 1051 |
| 250 | Ga0501032_0711254 | 3300049569 | Bacteria | 636 |
| 251 | Ga0501033_0027756 | 3300049570 | Bacteria | 4255 |
| 252 | Ga0501033_0035160 | 3300049570 | Bacteria | 3757 |
| 253 | Ga0501033_0044818 | 3300049570 | Bacteria | 3292 |
| 254 | Ga0501033_0144096 | 3300049570 | Bacteria | 1722 |
| 255 | Ga0501033_0156420 | 3300049570 | Bacteria | 1642 |
| 256 | Ga0501033_0541501 | 3300049570 | Bacteria | 802 |
| 257 | Ga0501034_0006981 | 3300049571 | Bacteria | 12057 |
| 258 | Ga0501034_0022222 | 3300049571 | Bacteria | 6464 |
| 259 | Ga0501034_0157235 | 3300049571 | Bacteria | 2246 |
| 260 | Ga0501034_0166706 | 3300049571 | Bacteria | 2171 |
| 261 | Ga0501034_0635917 | 3300049571 | Bacteria | 970 |
| 262 | Ga0501034_0661179 | 3300049571 | Bacteria | 946 |
| 263 | Ga0501034_0680964 | 3300049571 | Unclassified | 928 |
| 264 | Ga0501037_0008477 | 3300049573 | Bacteria | 7537 |
| 265 | Ga0501037_0075833 | 3300049573 | Bacteria | 2442 |
| 266 | Ga0501038_0007322 | 3300049574 | Bacteria | 10181 |
| 267 | Ga0501038_0215371 | 3300049574 | Bacteria | 1535 |
| 268 | Ga0501038_0570231 | 3300049574 | Bacteria | 859 |
| 269 | Ga0501039_0001379 | 3300049575 | Bacteria | 17823 |
| 270 | Ga0501043_0018860 | 3300049579 | Bacteria | 5414 |
| 271 | Ga0501043_0075617 | 3300049579 | Bacteria | 2645 |
| 272 | Ga0501043_0154284 | 3300049579 | Bacteria | 1796 |
| 273 | Ga0501043_0190958 | 3300049579 | Bacteria | 1593 |
| 274 | Ga0501043_0302009 | 3300049579 | Bacteria | 1223 |
| 275 | Ga0501043_0596531 | 3300049579 | Bacteria | 816 |
| 276 | Ga0501046_0020811 | 3300049580 | Bacteria | 5418 |
| 277 | Ga0501046_0255697 | 3300049580 | Bacteria | 1288 |
| 278 | Ga0501046_0525665 | 3300049580 | Bacteria | 845 |
| 279 | Ga0501046_1094643 | 3300049580 | Bacteria | 550 |
| 280 | Ga0501047_0015429 | 3300049581 | Bacteria | 7278 |
| 281 | Ga0501047_0015784 | 3300049581 | Bacteria | 7199 |
| 282 | Ga0501047_0027448 | 3300049581 | Bacteria | 5485 |
| 283 | Ga0501047_0139561 | 3300049581 | Bacteria | 2302 |
| 284 | Ga0501047_1305409 | 3300049581 | Bacteria | 540 |
| 285 | Ga0501048_0025496 | 3300049582 | Bacteria | 4308 |
| 286 | Ga0501067_0001970 | 3300049583 | Bacteria | 11308 |
| 287 | Ga0501068_0014415 | 3300049584 | Bacteria | 4519 |
| 288 | Ga0501068_0328283 | 3300049584 | Bacteria | 981 |
| 289 | Ga0501069_0003406 | 3300049585 | Bacteria | 8164 |
| 290 | Ga0501070_0011200 | 3300049586 | Bacteria | 7569 |
| 291 | Ga0501070_0047024 | 3300049586 | Bacteria | 3588 |
| 292 | Ga0501070_0372033 | 3300049586 | Bacteria | 1158 |
| 293 | Ga0501070_0732681 | 3300049586 | Bacteria | 780 |
| 294 | Ga0501071_0648752 | 3300049587 | Bacteria | 812 |
| 295 | Ga0501073_0012247 | 3300049589 | Bacteria | 6259 |
| 296 | Ga0501073_0124159 | 3300049589 | Bacteria | 1789 |
| 297 | Ga0501073_0200527 | 3300049589 | Bacteria | 1380 |
| 298 | Ga0501073_0740850 | 3300049589 | Bacteria | 678 |
| 299 | Ga0501076_0223735 | 3300049592 | Bacteria | 1538 |
| 300 | Ga0501079_0004716 | 3300049741 | Bacteria | 10093 |
| 301 | Ga0501080_0040900 | 3300049742 | Bacteria | 4322 |
| 302 | Ga0501080_0074514 | 3300049742 | Bacteria | 3157 |
| 303 | Ga0501080_0082630 | 3300049742 | Bacteria | 2983 |
| 304 | Ga0501080_0138827 | 3300049742 | Bacteria | 2248 |
| 305 | Ga0501083_0015213 | 3300049744 | Bacteria | 5386 |
| 306 | Ga0501035_0003644 | 3300049822 | Bacteria | 14691 |
| 307 | Ga0501035_0008954 | 3300049822 | Bacteria | 9314 |
| 308 | Ga0501035_0010036 | 3300049822 | Bacteria | 8787 |
| 309 | Ga0501035_0036634 | 3300049822 | Bacteria | 4445 |
| 310 | Ga0501035_0133681 | 3300049822 | Bacteria | 2161 |
| 311 | Ga0501035_0180766 | 3300049822 | Bacteria | 1817 |
| 312 | Ga0501035_1086961 | 3300049822 | Bacteria | 625 |
| 313 | Ga0501044_0006795 | 3300049823 | Bacteria | 12608 |
| 314 | Ga0501044_0007302 | 3300049823 | Bacteria | 12142 |
| 315 | Ga0501044_0008500 | 3300049823 | Bacteria | 11250 |
| 316 | Ga0501044_0028768 | 3300049823 | Bacteria | 5863 |
| 317 | Ga0501044_0051986 | 3300049823 | Bacteria | 4224 |
| 318 | Ga0501044_0222798 | 3300049823 | Bacteria | 1836 |
| 319 | Ga0501044_0519005 | 3300049823 | Bacteria | 1091 |
| 320 | Ga0501044_1164219 | 3300049823 | Bacteria | 639 |
| 321 | Ga0501045_0109139 | 3300049824 | Bacteria | 2051 |
| 322 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 323 | Ga0500643_020314 | 3300053087 | Bacteria | 2174 |
| 324 | Ga0500592_007035 | 3300053116 | Bacteria | 1789 |
| 325 | Ga0500595_002521 | 3300053119 | Bacteria | 9035 |
| 326 | Ga0500595_029268 | 3300053119 | Bacteria | 1870 |
| 327 | Ga0500595_037337 | 3300053119 | Bacteria | 1585 |
| 328 | Ga0500642_0406288 | 3300053130 | Bacteria | 593 |
| 329 | Ga0500568_0017760 | 3300053139 | Bacteria | 3132 |
| 330 | Ga0500573_0387569 | 3300053140 | Bacteria | 666 |
| 331 | Ga0500577_0098121 | 3300053142 | Bacteria | 1194 |
| 332 | Ga0500611_021458 | 3300053727 | Bacteria | 1233 |
| 333 | Ga0501084_0003057 | 3300054114 | Bacteria | 13556 |
| 334 | Ga0501084_0023056 | 3300054114 | Bacteria | 5196 |
| 335 | Ga0501084_0280206 | 3300054114 | Bacteria | 1408 |
| 336 | Ga0501082_0009507 | 3300060353 | Bacteria | 8367 |
| 337 | Ga0530510_1226568 | 3300061734 | Bacteria | 575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0035160 | Ga0501033_0035160_1446_1874 | 128 |
| 2 | 3300049571 | Ga0501034_0635917 | Ga0501034_0635917_404_793 | 129 |
| 3 | 3300049568 | Ga0501031_0111873 | Ga0501031_0111873_1374_1769 | 131 |
| 4 | 3300049824 | Ga0501045_0109139 | Ga0501045_0109139_128_523 | 131 |
| 5 | 3300028800 | Ga0265338_10285441 | Ga0265338_102854413 | 133 |
| 6 | 3300049571 | Ga0501034_0022222 | Ga0501034_0022222_3817_4233 | 134 |
| 7 | 3300025939 | Ga0207665_10604638 | Ga0207665_106046382 | 135 |
| 8 | 3300047472 | Ga0495686_0485341 | Ga0495686_0485341_15_434 | 135 |
| 9 | 3300009551 | Ga0105238_12411707 | Ga0105238_124117071 | 136 |
| 10 | 3300014969 | Ga0157376_11185013 | Ga0157376_111850132 | 136 |
| 11 | 3300003320 | rootH2_10029615 | rootH2_100296153 | 137 |
| 12 | 3300005436 | Ga0070713_101373299 | Ga0070713_1013732992 | 137 |
| 13 | 3300014325 | Ga0163163_12943690 | Ga0163163_129436901 | 137 |
| 14 | 3300044694 | Ga0466963_0426828 | Ga0466963_0426828_25_444 | 137 |
| 15 | 3300045976 | Ga0466967_1437056 | Ga0466967_1437056_28_447 | 137 |
| 16 | 3300048904 | Ga0496101_0250203 | Ga0496101_0250203_114_527 | 137 |
| 17 | 3300049822 | Ga0501035_0133681 | Ga0501035_0133681_1322_1735 | 137 |
| 18 | 3300005327 | Ga0070658_10017310 | Ga0070658_100173107 | 138 |
| 19 | 3300005327 | Ga0070658_11041738 | Ga0070658_110417382 | 138 |
| 20 | 3300005329 | Ga0070683_101809973 | Ga0070683_1018099731 | 138 |
| 21 | 3300005331 | Ga0070670_100154306 | Ga0070670_1001543063 | 138 |
| 22 | 3300005334 | Ga0068869_100109017 | Ga0068869_1001090171 | 138 |
| 23 | 3300005338 | Ga0068868_100103692 | Ga0068868_1001036923 | 138 |
| 24 | 3300005339 | Ga0070660_100586160 | Ga0070660_1005861602 | 138 |
| 25 | 3300005344 | Ga0070661_101055119 | Ga0070661_1010551192 | 138 |
| 26 | 3300005347 | Ga0070668_100936613 | Ga0070668_1009366132 | 138 |
| 27 | 3300005435 | Ga0070714_101414449 | Ga0070714_1014144491 | 138 |
| 28 | 3300005436 | Ga0070713_100832030 | Ga0070713_1008320302 | 138 |
| 29 | 3300005436 | Ga0070713_101071100 | Ga0070713_1010711001 | 138 |
| 30 | 3300005437 | Ga0070710_10900497 | Ga0070710_109004971 | 138 |
| 31 | 3300005437 | Ga0070710_11252823 | Ga0070710_112528231 | 138 |
| 32 | 3300005439 | Ga0070711_100779611 | Ga0070711_1007796111 | 138 |
| 33 | 3300005441 | Ga0070700_100687498 | Ga0070700_1006874982 | 138 |
| 34 | 3300005456 | Ga0070678_100007429 | Ga0070678_1000074295 | 138 |
| 35 | 3300005457 | Ga0070662_100542480 | Ga0070662_1005424802 | 138 |
| 36 | 3300005458 | Ga0070681_10141132 | Ga0070681_101411323 | 138 |
| 37 | 3300005458 | Ga0070681_10843191 | Ga0070681_108431911 | 138 |
| 38 | 3300005459 | Ga0068867_100016001 | Ga0068867_1000160017 | 138 |
| 39 | 3300005459 | Ga0068867_100134146 | Ga0068867_1001341463 | 138 |
| 40 | 3300005466 | Ga0070685_10124573 | Ga0070685_101245732 | 138 |
| 41 | 3300005530 | Ga0070679_100119650 | Ga0070679_1001196502 | 138 |
| 42 | 3300005530 | Ga0070679_100184525 | Ga0070679_1001845252 | 138 |
| 43 | 3300005530 | Ga0070679_100686229 | Ga0070679_1006862293 | 138 |
| 44 | 3300005535 | Ga0070684_100169556 | Ga0070684_1001695562 | 138 |
| 45 | 3300005535 | Ga0070684_101126001 | Ga0070684_1011260011 | 138 |
| 46 | 3300005535 | Ga0070684_101769050 | Ga0070684_1017690501 | 138 |
| 47 | 3300005539 | Ga0068853_100037237 | Ga0068853_1000372371 | 138 |
| 48 | 3300005539 | Ga0068853_100142065 | Ga0068853_1001420654 | 138 |
| 49 | 3300005543 | Ga0070672_100463987 | Ga0070672_1004639872 | 138 |
| 50 | 3300005543 | Ga0070672_101778091 | Ga0070672_1017780912 | 138 |
| 51 | 3300005548 | Ga0070665_100001302 | Ga0070665_10000130229 | 138 |
| 52 | 3300005548 | Ga0070665_100125846 | Ga0070665_1001258462 | 138 |
| 53 | 3300005548 | Ga0070665_100205755 | Ga0070665_1002057552 | 138 |
| 54 | 3300005548 | Ga0070665_100740796 | Ga0070665_1007407962 | 138 |
| 55 | 3300005563 | Ga0068855_100065280 | Ga0068855_1000652806 | 138 |
| 56 | 3300005563 | Ga0068855_100268381 | Ga0068855_1002683812 | 138 |
| 57 | 3300005577 | Ga0068857_100174122 | Ga0068857_1001741222 | 138 |
| 58 | 3300005577 | Ga0068857_100179817 | Ga0068857_1001798172 | 138 |
| 59 | 3300005614 | Ga0068856_100118813 | Ga0068856_1001188133 | 138 |
| 60 | 3300005614 | Ga0068856_100181514 | Ga0068856_1001815142 | 138 |
| 61 | 3300005616 | Ga0068852_100401140 | Ga0068852_1004011402 | 138 |
| 62 | 3300005616 | Ga0068852_101425219 | Ga0068852_1014252192 | 138 |
| 63 | 3300005718 | Ga0068866_10116445 | Ga0068866_101164453 | 138 |
| 64 | 3300005718 | Ga0068866_10284587 | Ga0068866_102845872 | 138 |
| 65 | 3300005840 | Ga0068870_10080190 | Ga0068870_100801902 | 138 |
| 66 | 3300005841 | Ga0068863_102032652 | Ga0068863_1020326521 | 138 |
| 67 | 3300005844 | Ga0068862_100392497 | Ga0068862_1003924972 | 138 |
| 68 | 3300005844 | Ga0068862_100429343 | Ga0068862_1004293431 | 138 |
| 69 | 3300006358 | Ga0068871_100042130 | Ga0068871_1000421302 | 138 |
| 70 | 3300009093 | Ga0105240_10019617 | Ga0105240_1001961712 | 138 |
| 71 | 3300009093 | Ga0105240_10049843 | Ga0105240_100498432 | 138 |
| 72 | 3300009093 | Ga0105240_10295631 | Ga0105240_102956311 | 138 |
| 73 | 3300009093 | Ga0105240_10405960 | Ga0105240_104059602 | 138 |
| 74 | 3300009093 | Ga0105240_10449694 | Ga0105240_104496942 | 138 |
| 75 | 3300009093 | Ga0105240_10791179 | Ga0105240_107911792 | 138 |
| 76 | 3300009093 | Ga0105240_11419874 | Ga0105240_114198742 | 138 |
| 77 | 3300009148 | Ga0105243_10004582 | Ga0105243_100045821 | 138 |
| 78 | 3300009174 | Ga0105241_10179588 | Ga0105241_101795882 | 138 |
| 79 | 3300009174 | Ga0105241_10309542 | Ga0105241_103095422 | 138 |
| 80 | 3300009176 | Ga0105242_10051210 | Ga0105242_100512103 | 138 |
| 81 | 3300009176 | Ga0105242_10382872 | Ga0105242_103828723 | 138 |
| 82 | 3300009176 | Ga0105242_11170672 | Ga0105242_111706721 | 138 |
| 83 | 3300009177 | Ga0105248_10141690 | Ga0105248_101416903 | 138 |
| 84 | 3300009177 | Ga0105248_10208380 | Ga0105248_102083802 | 138 |
| 85 | 3300009545 | Ga0105237_10229518 | Ga0105237_102295182 | 138 |
| 86 | 3300009545 | Ga0105237_10292733 | Ga0105237_102927332 | 138 |
| 87 | 3300009545 | Ga0105237_10367097 | Ga0105237_103670972 | 138 |
| 88 | 3300009545 | Ga0105237_10840849 | Ga0105237_108408492 | 138 |
| 89 | 3300009551 | Ga0105238_10104427 | Ga0105238_101044272 | 138 |
| 90 | 3300009551 | Ga0105238_10247833 | Ga0105238_102478333 | 138 |
| 91 | 3300009551 | Ga0105238_10548193 | Ga0105238_105481932 | 138 |
| 92 | 3300009551 | Ga0105238_11829918 | Ga0105238_118299181 | 138 |
| 93 | 3300009551 | Ga0105238_11892276 | Ga0105238_118922762 | 138 |
| 94 | 3300009553 | Ga0105249_10064235 | Ga0105249_100642353 | 138 |
| 95 | 3300009553 | Ga0105249_10315866 | Ga0105249_103158662 | 138 |
| 96 | 3300010375 | Ga0105239_10016304 | Ga0105239_100163046 | 138 |
| 97 | 3300010375 | Ga0105239_10149177 | Ga0105239_101491774 | 138 |
| 98 | 3300010375 | Ga0105239_11087442 | Ga0105239_110874422 | 138 |
| 99 | 3300010375 | Ga0105239_11111588 | Ga0105239_111115882 | 138 |
| 100 | 3300010375 | Ga0105239_11276586 | Ga0105239_112765861 | 138 |
| 101 | 3300010375 | Ga0105239_11569605 | Ga0105239_115696052 | 138 |
| 102 | 3300010375 | Ga0105239_13405419 | Ga0105239_134054192 | 138 |
| 103 | 3300011119 | Ga0105246_11129919 | Ga0105246_111299191 | 138 |
| 104 | 3300011119 | Ga0105246_11455412 | Ga0105246_114554121 | 138 |
| 105 | 3300013100 | Ga0157373_10272751 | Ga0157373_102727512 | 138 |
| 106 | 3300013104 | Ga0157370_10025977 | Ga0157370_100259772 | 138 |
| 107 | 3300013104 | Ga0157370_10030611 | Ga0157370_100306116 | 138 |
| 108 | 3300013104 | Ga0157370_11204778 | Ga0157370_112047781 | 138 |
| 109 | 3300013105 | Ga0157369_10308172 | Ga0157369_103081722 | 138 |
| 110 | 3300013105 | Ga0157369_10628342 | Ga0157369_106283422 | 138 |
| 111 | 3300013296 | Ga0157374_10182136 | Ga0157374_101821363 | 138 |
| 112 | 3300013297 | Ga0157378_10316955 | Ga0157378_103169551 | 138 |
| 113 | 3300013297 | Ga0157378_10406893 | Ga0157378_104068933 | 138 |
| 114 | 3300013306 | Ga0163162_10243736 | Ga0163162_102437362 | 138 |
| 115 | 3300013306 | Ga0163162_10270773 | Ga0163162_102707733 | 138 |
| 116 | 3300013306 | Ga0163162_11831129 | Ga0163162_118311292 | 138 |
| 117 | 3300013307 | Ga0157372_11425884 | Ga0157372_114258841 | 138 |
| 118 | 3300013307 | Ga0157372_12148173 | Ga0157372_121481732 | 138 |
| 119 | 3300013308 | Ga0157375_10118439 | Ga0157375_101184394 | 138 |
| 120 | 3300014325 | Ga0163163_10000012 | Ga0163163_10000012121 | 138 |
| 121 | 3300014325 | Ga0163163_10169880 | Ga0163163_101698804 | 138 |
| 122 | 3300014325 | Ga0163163_10327960 | Ga0163163_103279603 | 138 |
| 123 | 3300014968 | Ga0157379_10003912 | Ga0157379_100039127 | 138 |
| 124 | 3300014968 | Ga0157379_10498286 | Ga0157379_104982862 | 138 |
| 125 | 3300014968 | Ga0157379_10696466 | Ga0157379_106964662 | 138 |
| 126 | 3300014969 | Ga0157376_10259642 | Ga0157376_102596422 | 138 |
| 127 | 3300017792 | Ga0163161_10077000 | Ga0163161_100770001 | 138 |
| 128 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006640 | 138 |
| 129 | 3300025261 | Ga0209233_1004865 | Ga0209233_10048656 | 138 |
| 130 | 3300025272 | Ga0209455_1011654 | Ga0209455_10116542 | 138 |
| 131 | 3300025901 | Ga0207688_10025364 | Ga0207688_100253644 | 138 |
| 132 | 3300025903 | Ga0207680_10246382 | Ga0207680_102463822 | 138 |
| 133 | 3300025907 | Ga0207645_10402500 | Ga0207645_104025002 | 138 |
| 134 | 3300025909 | Ga0207705_10067321 | Ga0207705_100673214 | 138 |
| 135 | 3300025911 | Ga0207654_10046246 | Ga0207654_100462464 | 138 |
| 136 | 3300025911 | Ga0207654_10215865 | Ga0207654_102158652 | 138 |
| 137 | 3300025912 | Ga0207707_10191064 | Ga0207707_101910642 | 138 |
| 138 | 3300025913 | Ga0207695_10017780 | Ga0207695_100177803 | 138 |
| 139 | 3300025913 | Ga0207695_10299379 | Ga0207695_102993792 | 138 |
| 140 | 3300025913 | Ga0207695_10310466 | Ga0207695_103104662 | 138 |
| 141 | 3300025913 | Ga0207695_10443734 | Ga0207695_104437342 | 138 |
| 142 | 3300025913 | Ga0207695_10512024 | Ga0207695_105120242 | 138 |
| 143 | 3300025913 | Ga0207695_10512993 | Ga0207695_105129932 | 138 |
| 144 | 3300025913 | Ga0207695_10840125 | Ga0207695_108401252 | 138 |
| 145 | 3300025913 | Ga0207695_10979182 | Ga0207695_109791822 | 138 |
| 146 | 3300025914 | Ga0207671_10180321 | Ga0207671_101803212 | 138 |
| 147 | 3300025914 | Ga0207671_10775268 | Ga0207671_107752681 | 138 |
| 148 | 3300025914 | Ga0207671_10854690 | Ga0207671_108546902 | 138 |
| 149 | 3300025918 | Ga0207662_11183613 | Ga0207662_111836131 | 138 |
| 150 | 3300025919 | Ga0207657_10346636 | Ga0207657_103466361 | 138 |
| 151 | 3300025921 | Ga0207652_10939330 | Ga0207652_109393302 | 138 |
| 152 | 3300025921 | Ga0207652_11277428 | Ga0207652_112774282 | 138 |
| 153 | 3300025925 | Ga0207650_10315676 | Ga0207650_103156763 | 138 |
| 154 | 3300025926 | Ga0207659_10408966 | Ga0207659_104089662 | 138 |
| 155 | 3300025928 | Ga0207700_10066687 | Ga0207700_100666874 | 138 |
| 156 | 3300025929 | Ga0207664_10715566 | Ga0207664_107155662 | 138 |
| 157 | 3300025931 | Ga0207644_10811211 | Ga0207644_108112112 | 138 |
| 158 | 3300025934 | Ga0207686_10434417 | Ga0207686_104344173 | 138 |
| 159 | 3300025934 | Ga0207686_10839866 | Ga0207686_108398662 | 138 |
| 160 | 3300025935 | Ga0207709_10186140 | Ga0207709_101861402 | 138 |
| 161 | 3300025938 | Ga0207704_10013802 | Ga0207704_100138021 | 138 |
| 162 | 3300025938 | Ga0207704_10199028 | Ga0207704_101990283 | 138 |
| 163 | 3300025941 | Ga0207711_10062650 | Ga0207711_100626503 | 138 |
| 164 | 3300025941 | Ga0207711_10427967 | Ga0207711_104279672 | 138 |
| 165 | 3300025942 | Ga0207689_10003177 | Ga0207689_100031775 | 138 |
| 166 | 3300025942 | Ga0207689_10190745 | Ga0207689_101907452 | 138 |
| 167 | 3300025942 | Ga0207689_10285516 | Ga0207689_102855162 | 138 |
| 168 | 3300025942 | Ga0207689_10791405 | Ga0207689_107914051 | 138 |
| 169 | 3300025944 | Ga0207661_10370500 | Ga0207661_103705002 | 138 |
| 170 | 3300025944 | Ga0207661_10507820 | Ga0207661_105078203 | 138 |
| 171 | 3300025949 | Ga0207667_10077854 | Ga0207667_100778545 | 138 |
| 172 | 3300025949 | Ga0207667_10662468 | Ga0207667_106624682 | 138 |
| 173 | 3300025961 | Ga0207712_11531567 | Ga0207712_115315671 | 138 |
| 174 | 3300026035 | Ga0207703_10050393 | Ga0207703_100503933 | 138 |
| 175 | 3300026035 | Ga0207703_10995148 | Ga0207703_109951482 | 138 |
| 176 | 3300026041 | Ga0207639_10020512 | Ga0207639_100205124 | 138 |
| 177 | 3300026041 | Ga0207639_10293699 | Ga0207639_102936992 | 138 |
| 178 | 3300026041 | Ga0207639_10448844 | Ga0207639_104488442 | 138 |
| 179 | 3300026078 | Ga0207702_10335334 | Ga0207702_103353342 | 138 |
| 180 | 3300026089 | Ga0207648_10012856 | Ga0207648_100128567 | 138 |
| 181 | 3300026116 | Ga0207674_10212101 | Ga0207674_102121014 | 138 |
| 182 | 3300026116 | Ga0207674_10258480 | Ga0207674_102584802 | 138 |
| 183 | 3300026116 | Ga0207674_10769696 | Ga0207674_107696962 | 138 |
| 184 | 3300026121 | Ga0207683_10012265 | Ga0207683_100122654 | 138 |
| 185 | 3300026121 | Ga0207683_10043437 | Ga0207683_100434374 | 138 |
| 186 | 3300026121 | Ga0207683_10388925 | Ga0207683_103889252 | 138 |
| 187 | 3300026142 | Ga0207698_10135508 | Ga0207698_101355082 | 138 |
| 188 | 3300028379 | Ga0268266_10000847 | Ga0268266_1000084723 | 138 |
| 189 | 3300028379 | Ga0268266_10005124 | Ga0268266_100051244 | 138 |
| 190 | 3300028379 | Ga0268266_10074199 | Ga0268266_100741994 | 138 |
| 191 | 3300028379 | Ga0268266_10078860 | Ga0268266_100788602 | 138 |
| 192 | 3300028380 | Ga0268265_12103456 | Ga0268265_121034561 | 138 |
| 193 | 3300028381 | Ga0268264_10775567 | Ga0268264_107755672 | 138 |
| 194 | 3300028800 | Ga0265338_10004163 | Ga0265338_1000416313 | 138 |
| 195 | 3300031235 | Ga0265330_10003149 | Ga0265330_100031498 | 138 |
| 196 | 3300031238 | Ga0265332_10017562 | Ga0265332_100175622 | 138 |
| 197 | 3300031241 | Ga0265325_10001683 | Ga0265325_1000168314 | 138 |
| 198 | 3300031247 | Ga0265340_10090079 | Ga0265340_100900792 | 138 |
| 199 | 3300031249 | Ga0265339_10006313 | Ga0265339_100063136 | 138 |
| 200 | 3300031249 | Ga0265339_10042424 | Ga0265339_100424244 | 138 |
| 201 | 3300031250 | Ga0265331_10035880 | Ga0265331_100358804 | 138 |
| 202 | 3300031250 | Ga0265331_10131481 | Ga0265331_101314812 | 138 |
| 203 | 3300031344 | Ga0265316_10019292 | Ga0265316_100192922 | 138 |
| 204 | 3300031344 | Ga0265316_10074673 | Ga0265316_100746733 | 138 |
| 205 | 3300031456 | Ga0307513_10214087 | Ga0307513_102140873 | 138 |
| 206 | 3300031595 | Ga0265313_10009088 | Ga0265313_100090887 | 138 |
| 207 | 3300031595 | Ga0265313_10112848 | Ga0265313_101128482 | 138 |
| 208 | 3300031711 | Ga0265314_10012288 | Ga0265314_100122888 | 138 |
| 209 | 3300031712 | Ga0265342_10026742 | Ga0265342_100267426 | 138 |
| 210 | 3300031712 | Ga0265342_10060988 | Ga0265342_100609882 | 138 |
| 211 | 3300031730 | Ga0307516_10070469 | Ga0307516_100704692 | 138 |
| 212 | 3300037418 | Ga0395900_0363077 | Ga0395900_0363077_939_1355 | 138 |
| 213 | 3300037466 | Ga0395898_0015029 | Ga0395898_0015029_216_632 | 138 |
| 214 | 3300038443 | Ga0395901_0349763 | Ga0395901_0349763_1020_1436 | 138 |
| 215 | 3300039450 | Ga0436363_0134827 | Ga0436363_0134827_38_460 | 138 |
| 216 | 3300044842 | Ga0466957_0814944 | Ga0466957_0814944_185_601 | 138 |
| 217 | 3300044901 | Ga0466960_0812365 | Ga0466960_0812365_133_549 | 138 |
| 218 | 3300046492 | Ga0495585_0390793 | Ga0495585_0390793_186_602 | 138 |
| 219 | 3300046516 | Ga0495628_0580095 | Ga0495628_0580095_35_451 | 138 |
| 220 | 3300046524 | Ga0495648_0316112 | Ga0495648_0316112_291_707 | 138 |
| 221 | 3300046536 | Ga0495587_0368170 | Ga0495587_0368170_225_641 | 138 |
| 222 | 3300046648 | Ga0495611_0131968 | Ga0495611_0131968_596_1012 | 138 |
| 223 | 3300046660 | Ga0495625_0383416 | Ga0495625_0383416_162_578 | 138 |
| 224 | 3300046660 | Ga0495625_0506820 | Ga0495625_0506820_228_644 | 138 |
| 225 | 3300046809 | Ga0495600_0595321 | Ga0495600_0595321_93_509 | 138 |
| 226 | 3300047472 | Ga0495686_0254891 | Ga0495686_0254891_292_708 | 138 |
| 227 | 3300048088 | Ga0495602_0041073 | Ga0495602_0041073_3720_4136 | 138 |
| 228 | 3300048924 | Ga0496121_0071754 | Ga0496121_0071754_976_1392 | 138 |
| 229 | 3300049568 | Ga0501031_0007877 | Ga0501031_0007877_4469_4885 | 138 |
| 230 | 3300049569 | Ga0501032_0019863 | Ga0501032_0019863_2614_3030 | 138 |
| 231 | 3300049569 | Ga0501032_0163522 | Ga0501032_0163522_717_1142 | 138 |
| 232 | 3300049569 | Ga0501032_0293860 | Ga0501032_0293860_221_637 | 138 |
| 233 | 3300049569 | Ga0501032_0711254 | Ga0501032_0711254_193_609 | 138 |
| 234 | 3300049570 | Ga0501033_0044818 | Ga0501033_0044818_2692_3108 | 138 |
| 235 | 3300049570 | Ga0501033_0144096 | Ga0501033_0144096_122_538 | 138 |
| 236 | 3300049570 | Ga0501033_0156420 | Ga0501033_0156420_840_1256 | 138 |
| 237 | 3300049570 | Ga0501033_0541501 | Ga0501033_0541501_138_554 | 138 |
| 238 | 3300049571 | Ga0501034_0006981 | Ga0501034_0006981_3067_3483 | 138 |
| 239 | 3300049571 | Ga0501034_0166706 | Ga0501034_0166706_1736_2152 | 138 |
| 240 | 3300049571 | Ga0501034_0661179 | Ga0501034_0661179_348_764 | 138 |
| 241 | 3300049571 | Ga0501034_0680964 | Ga0501034_0680964_375_791 | 138 |
| 242 | 3300049573 | Ga0501037_0008477 | Ga0501037_0008477_4599_5015 | 138 |
| 243 | 3300049574 | Ga0501038_0007322 | Ga0501038_0007322_5917_6333 | 138 |
| 244 | 3300049574 | Ga0501038_0215371 | Ga0501038_0215371_429_845 | 138 |
| 245 | 3300049574 | Ga0501038_0570231 | Ga0501038_0570231_182_598 | 138 |
| 246 | 3300049575 | Ga0501039_0001379 | Ga0501039_0001379_4696_5112 | 138 |
| 247 | 3300049579 | Ga0501043_0018860 | Ga0501043_0018860_4622_5038 | 138 |
| 248 | 3300049579 | Ga0501043_0154284 | Ga0501043_0154284_365_781 | 138 |
| 249 | 3300049579 | Ga0501043_0190958 | Ga0501043_0190958_683_1099 | 138 |
| 250 | 3300049579 | Ga0501043_0302009 | Ga0501043_0302009_200_625 | 138 |
| 251 | 3300049579 | Ga0501043_0596531 | Ga0501043_0596531_383_799 | 138 |
| 252 | 3300049580 | Ga0501046_0020811 | Ga0501046_0020811_1110_1526 | 138 |
| 253 | 3300049580 | Ga0501046_0255697 | Ga0501046_0255697_530_946 | 138 |
| 254 | 3300049580 | Ga0501046_1094643 | Ga0501046_1094643_85_501 | 138 |
| 255 | 3300049581 | Ga0501047_0015429 | Ga0501047_0015429_2812_3237 | 138 |
| 256 | 3300049581 | Ga0501047_0015784 | Ga0501047_0015784_492_908 | 138 |
| 257 | 3300049581 | Ga0501047_0027448 | Ga0501047_0027448_1212_1628 | 138 |
| 258 | 3300049581 | Ga0501047_0139561 | Ga0501047_0139561_761_1177 | 138 |
| 259 | 3300049581 | Ga0501047_1305409 | Ga0501047_1305409_107_523 | 138 |
| 260 | 3300049582 | Ga0501048_0025496 | Ga0501048_0025496_2083_2499 | 138 |
| 261 | 3300049583 | Ga0501067_0001970 | Ga0501067_0001970_6285_6701 | 138 |
| 262 | 3300049584 | Ga0501068_0014415 | Ga0501068_0014415_1725_2141 | 138 |
| 263 | 3300049585 | Ga0501069_0003406 | Ga0501069_0003406_5135_5551 | 138 |
| 264 | 3300049586 | Ga0501070_0011200 | Ga0501070_0011200_3025_3441 | 138 |
| 265 | 3300049586 | Ga0501070_0732681 | Ga0501070_0732681_220_645 | 138 |
| 266 | 3300049587 | Ga0501071_0648752 | Ga0501071_0648752_226_642 | 138 |
| 267 | 3300049589 | Ga0501073_0012247 | Ga0501073_0012247_4862_5278 | 138 |
| 268 | 3300049589 | Ga0501073_0200527 | Ga0501073_0200527_664_1080 | 138 |
| 269 | 3300049589 | Ga0501073_0740850 | Ga0501073_0740850_94_519 | 138 |
| 270 | 3300049592 | Ga0501076_0223735 | Ga0501076_0223735_469_885 | 138 |
| 271 | 3300049741 | Ga0501079_0004716 | Ga0501079_0004716_5649_6065 | 138 |
| 272 | 3300049742 | Ga0501080_0040900 | Ga0501080_0040900_1802_2218 | 138 |
| 273 | 3300049742 | Ga0501080_0074514 | Ga0501080_0074514_1783_2199 | 138 |
| 274 | 3300049744 | Ga0501083_0015213 | Ga0501083_0015213_2074_2490 | 138 |
| 275 | 3300049822 | Ga0501035_0003644 | Ga0501035_0003644_8661_9077 | 138 |
| 276 | 3300049822 | Ga0501035_0008954 | Ga0501035_0008954_623_1039 | 138 |
| 277 | 3300049822 | Ga0501035_0036634 | Ga0501035_0036634_3021_3446 | 138 |
| 278 | 3300049822 | Ga0501035_0180766 | Ga0501035_0180766_314_730 | 138 |
| 279 | 3300049822 | Ga0501035_1086961 | Ga0501035_1086961_160_576 | 138 |
| 280 | 3300049823 | Ga0501044_0006795 | Ga0501044_0006795_3567_3983 | 138 |
| 281 | 3300049823 | Ga0501044_0007302 | Ga0501044_0007302_8375_8791 | 138 |
| 282 | 3300049823 | Ga0501044_0008500 | Ga0501044_0008500_8917_9342 | 138 |
| 283 | 3300049823 | Ga0501044_0028768 | Ga0501044_0028768_3006_3422 | 138 |
| 284 | 3300049823 | Ga0501044_0051986 | Ga0501044_0051986_1999_2415 | 138 |
| 285 | 3300049823 | Ga0501044_0519005 | Ga0501044_0519005_91_507 | 138 |
| 286 | 3300049823 | Ga0501044_1164219 | Ga0501044_1164219_39_455 | 138 |
| 287 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_40779_41195 | 138 |
| 288 | 3300053087 | Ga0500643_020314 | Ga0500643_020314_330_746 | 138 |
| 289 | 3300053116 | Ga0500592_007035 | Ga0500592_007035_1275_1691 | 138 |
| 290 | 3300053119 | Ga0500595_002521 | Ga0500595_002521_4866_5282 | 138 |
| 291 | 3300053119 | Ga0500595_029268 | Ga0500595_029268_802_1218 | 138 |
| 292 | 3300053119 | Ga0500595_037337 | Ga0500595_037337_1147_1563 | 138 |
| 293 | 3300053130 | Ga0500642_0406288 | Ga0500642_0406288_75_491 | 138 |
| 294 | 3300053139 | Ga0500568_0017760 | Ga0500568_0017760_1662_2078 | 138 |
| 295 | 3300053140 | Ga0500573_0387569 | Ga0500573_0387569_113_529 | 138 |
| 296 | 3300053142 | Ga0500577_0098121 | Ga0500577_0098121_340_756 | 138 |
| 297 | 3300053727 | Ga0500611_021458 | Ga0500611_021458_412_828 | 138 |
| 298 | 3300054114 | Ga0501084_0003057 | Ga0501084_0003057_7470_7886 | 138 |
| 299 | 3300054114 | Ga0501084_0023056 | Ga0501084_0023056_2794_3210 | 138 |
| 300 | 3300060353 | Ga0501082_0009507 | Ga0501082_0009507_2379_2795 | 138 |
| 301 | 3300061734 | Ga0530510_1226568 | Ga0530510_1226568_32_448 | 138 |
| 302 | 3300003320 | rootH2_10001888 | rootH2_1000188812 | 139 |
| 303 | 3300005344 | Ga0070661_100000254 | Ga0070661_10000025421 | 139 |
| 304 | 3300009093 | Ga0105240_10296666 | Ga0105240_102966663 | 139 |
| 305 | 3300013104 | Ga0157370_11004401 | Ga0157370_110044011 | 139 |
| 306 | 3300025913 | Ga0207695_10342542 | Ga0207695_103425422 | 139 |
| 307 | 3300025920 | Ga0207649_10000026 | Ga0207649_1000002641 | 139 |
| 308 | 3300031250 | Ga0265331_10000008 | Ga0265331_10000008162 | 139 |
| 309 | 3300031251 | Ga0265327_10000036 | Ga0265327_1000003642 | 139 |
| 310 | 3300031712 | Ga0265342_10013775 | Ga0265342_100137758 | 139 |
| 311 | 3300035083 | Ga0373926_0129244 | Ga0373926_0129244_230_649 | 139 |
| 312 | 3300035111 | Ga0373923_0373472 | Ga0373923_0373472_221_640 | 139 |
| 313 | 3300035115 | Ga0373941_0067547 | Ga0373941_0067547_77_496 | 139 |
| 314 | 3300035116 | Ga0373945_0081986 | Ga0373945_0081986_613_1032 | 139 |
| 315 | 3300035170 | Ga0373943_0003007 | Ga0373943_0003007_5950_6369 | 139 |
| 316 | 3300035171 | Ga0373946_0023585 | Ga0373946_0023585_1115_1534 | 139 |
| 317 | 3300035692 | Ga0373935_0011561 | Ga0373935_0011561_4792_5211 | 139 |
| 318 | 3300035695 | Ga0373927_0396158 | Ga0373927_0396158_230_649 | 139 |
| 319 | 3300035725 | Ga0373947_0164233 | Ga0373947_0164233_873_1292 | 139 |
| 320 | 3300037068 | Ga0373925_0001182 | Ga0373925_0001182_449_868 | 139 |
| 321 | 3300037068 | Ga0373925_0067791 | Ga0373925_0067791_1187_1606 | 139 |
| 322 | 3300048929 | Ga0496126_0000463 | Ga0496126_0000463_57806_58225 | 139 |
| 323 | 3300049569 | Ga0501032_0044836 | Ga0501032_0044836_923_1342 | 139 |
| 324 | 3300049570 | Ga0501033_0027756 | Ga0501033_0027756_3557_3976 | 139 |
| 325 | 3300049571 | Ga0501034_0157235 | Ga0501034_0157235_429_848 | 139 |
| 326 | 3300049573 | Ga0501037_0075833 | Ga0501037_0075833_1964_2383 | 139 |
| 327 | 3300049579 | Ga0501043_0075617 | Ga0501043_0075617_2021_2440 | 139 |
| 328 | 3300049580 | Ga0501046_0525665 | Ga0501046_0525665_338_757 | 139 |
| 329 | 3300049584 | Ga0501068_0328283 | Ga0501068_0328283_474_893 | 139 |
| 330 | 3300049586 | Ga0501070_0047024 | Ga0501070_0047024_166_585 | 139 |
| 331 | 3300049586 | Ga0501070_0372033 | Ga0501070_0372033_403_822 | 139 |
| 332 | 3300049589 | Ga0501073_0124159 | Ga0501073_0124159_279_698 | 139 |
| 333 | 3300049742 | Ga0501080_0082630 | Ga0501080_0082630_1096_1515 | 139 |
| 334 | 3300049742 | Ga0501080_0138827 | Ga0501080_0138827_1720_2139 | 139 |
| 335 | 3300049822 | Ga0501035_0010036 | Ga0501035_0010036_7370_7789 | 139 |
| 336 | 3300049823 | Ga0501044_0222798 | Ga0501044_0222798_1138_1557 | 139 |
| 337 | 3300054114 | Ga0501084_0280206 | Ga0501084_0280206_744_1163 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vmf-assembly1.cif.gz_C | crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution | 0.9186 | 5 | 139 |
| 1vmh-assembly1.cif.gz_A | crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution | 0.913 | 6 | 137 |
| 2p6c-assembly1.cif.gz_A | crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. | 0.9097 | 1 | 139 |
| 1xbf-assembly1.cif.gz_C | x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum | 0.9094 | 4 | 137 |
| 1ve0-assembly1.cif.gz_A | crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii | 0.907 | 1 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8969 | 1 | 139 | 2.60.120.460 |
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8908 | 1 | 139 | 2.60.120.460 |
| af_O14155_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8851 | 1 | 138 | 2.60.120.460 |
| af_P0AF48_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.881 | 2 | 139 | 2.60.120.460 |
| af_O14155_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8792 | 1 | 138 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U0T9U8-F1-model_v4 | deleted | 0.9588 | 1 | 139 |
|
| AF-A0A0D6MWM4-F1-model_v4 | deleted | 0.9573 | 1 | 139 |
|
| AF-A0A6P2JMJ1-F1-model_v4 | YjbQ family protein | 0.9571 | 1 | 139 |
|
| AF-A0A1X7PM13-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9569 | 5 | 137 |
|
| AF-A0A228GMY0-F1-model_v4 | deleted | 0.9568 | 1 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar