F412979

General Info

Members Datasets Scaffolds Average Seq Length
337 185 674 79

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101112339|Ga0070707_1011123392
Length 80
Sequence MFPRLVVIGIVVAALLGALVHSVHGAGPERVYVVKPADTLWSIAESRYGGDPREGVWKLRQANHLTGGAVLAPGQKLLLP

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 11.57
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 31.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_101112339 3300005468 Bacteria 756
2 Ga0070658_10009482 3300005327 Archaea 7822
3 Ga0070658_10704046 3300005327 Bacteria 877
4 Ga0070683_100087423 3300005329 Bacteria 2923
5 Ga0070683_100254650 3300005329 Bacteria 1670
6 Ga0070682_101244688 3300005337 Bacteria 630
7 Ga0070682_101498547 3300005337 Unclassified 580
8 Ga0070682_102065346 3300005337 Unclassified 502
9 Ga0068868_100614420 3300005338 Unclassified 964
10 Ga0068868_100930788 3300005338 Bacteria 791
11 Ga0070675_101822330 3300005354 Unclassified 561
12 Ga0070659_100217393 3300005366 Bacteria 1576
13 Ga0070709_10202058 3300005434 Unclassified 1408
14 Ga0070709_10399468 3300005434 Unclassified 1026
15 Ga0070710_10435021 3300005437 Unclassified 886
16 Ga0070710_11089353 3300005437 Bacteria 586
17 Ga0070711_100856248 3300005439 Bacteria 774
18 Ga0070711_100871735 3300005439 Bacteria 767
19 Ga0070708_100242250 3300005445 Bacteria 1693
20 Ga0070678_101766440 3300005456 Unclassified 583
21 Ga0070681_10049353 3300005458 Bacteria 4203
22 Ga0070681_10526069 3300005458 Bacteria 1096
23 Ga0070681_11525684 3300005458 Unclassified 593
24 Ga0070706_100075254 3300005467 Bacteria 3124
25 Ga0070706_100118852 3300005467 Unclassified 2463
26 Ga0070707_100166816 3300005468 Bacteria 2146
27 Ga0070707_100509973 3300005468 Unclassified 1165
28 Ga0070707_100515497 3300005468 Unclassified 1158
29 Ga0070707_102070549 3300005468 Unclassified 537
30 Ga0070698_100091445 3300005471 Bacteria 3026
31 Ga0070698_100161537 3300005471 Bacteria 2184
32 Ga0070698_100295261 3300005471 Bacteria 1551
33 Ga0070698_101079883 3300005471 Bacteria 751
34 Ga0070698_101145723 3300005471 Unclassified 726
35 Ga0070699_100008276 3300005518 Bacteria 9017
36 Ga0070699_100417547 3300005518 Unclassified 1214
37 Ga0070699_100744614 3300005518 Unclassified 896
38 Ga0070699_100788092 3300005518 Bacteria 870
39 Ga0070679_100064501 3300005530 Bacteria 3651
40 Ga0070684_100448491 3300005535 Unclassified 1192
41 Ga0070697_101402641 3300005536 Bacteria 624
42 Ga0070696_100367622 3300005546 Unclassified 1118
43 Ga0070696_100390177 3300005546 Unclassified 1087
44 Ga0070665_102221517 3300005548 Unclassified 552
45 Ga0070704_102270724 3300005549 Unclassified 505
46 Ga0070664_100521079 3300005564 Bacteria 1097
47 Ga0068856_100192390 3300005614 Bacteria 2054
48 Ga0068856_102069379 3300005614 Bacteria 579
49 Ga0068864_101746503 3300005618 Unclassified 627
50 Ga0068863_101611043 3300005841 Unclassified 658
51 Ga0075365_10040894 3300006038 Bacteria 3025
52 Ga0075368_10513204 3300006042 Bacteria 536
53 Ga0075364_10102966 3300006051 Bacteria 1901
54 Ga0070716_100653815 3300006173 Bacteria 797
55 Ga0070716_101374128 3300006173 Bacteria 573
56 Ga0070712_100005380 3300006175 Bacteria 7924
57 Ga0070712_100155607 3300006175 Unclassified 1760
58 Ga0070712_101938483 3300006175 Bacteria 516
59 Ga0097621_102432320 3300006237 Bacteria 501
60 Ga0068871_101250365 3300006358 Unclassified 697
61 Ga0075431_100107412 3300006847 Unclassified 2880
62 Ga0075434_102144443 3300006871 Unclassified 563
63 Ga0075435_100354436 3300007076 Unclassified 1258
64 Ga0111539_10812795 3300009094 Unclassified 1088
65 Ga0105245_10094401 3300009098 Bacteria 2757
66 Ga0105245_12835841 3300009098 Unclassified 537
67 Ga0114129_10454966 3300009147 Bacteria 1678
68 Ga0114129_10933486 3300009147 Bacteria 1097
69 Ga0114129_11786201 3300009147 Unclassified 748
70 Ga0114129_11968850 3300009147 Bacteria 707
71 Ga0114129_13036642 3300009147 Bacteria 551
72 Ga0105243_11099945 3300009148 Unclassified 803
73 Ga0105241_11153949 3300009174 Bacteria 732
74 Ga0105246_11165740 3300011119 Bacteria 707
75 Ga0105246_12048377 3300011119 Unclassified 553
76 Ga0157373_10109988 3300013100 Bacteria 1937
77 Ga0157373_10343340 3300013100 Bacteria 1064
78 Ga0157371_11655837 3300013102 Unclassified 502
79 Ga0157369_10016604 3300013105 Bacteria 8277
80 Ga0157369_11266226 3300013105 Bacteria 752
81 Ga0157374_10148790 3300013296 Bacteria 2276
82 Ga0157378_10555324 3300013297 Unclassified 1154
83 Ga0157372_12493534 3300013307 Archaea 594
84 Ga0157375_10043526 3300013308 Bacteria 4355
85 Ga0163163_10262510 3300014325 Bacteria 1778
86 Ga0182008_10023987 3300014497 Bacteria 3108
87 Ga0182008_10098827 3300014497 Bacteria 1441
88 Ga0157376_10040314 3300014969 Bacteria 3816
89 Ga0182007_10139752 3300015262 Bacteria 818
90 Ga0197907_10513294 3300020069 Unclassified 533
91 Ga0206356_11155746 3300020070 Bacteria 1324
92 Ga0207692_10457776 3300025898 Unclassified 804
93 Ga0207699_10131181 3300025906 Unclassified 1635
94 Ga0207699_10698827 3300025906 Unclassified 742
95 Ga0207699_10831240 3300025906 Bacteria 680
96 Ga0207705_10152230 3300025909 Bacteria 1734
97 Ga0207705_10175467 3300025909 Archaea 1615
98 Ga0207684_11718190 3300025910 Bacteria 505
99 Ga0207693_10017446 3300025915 Bacteria 5726
100 Ga0207693_10280209 3300025915 Bacteria 1306
101 Ga0207663_10172282 3300025916 Unclassified 1538
102 Ga0207660_10289038 3300025917 Bacteria 1303
103 Ga0207657_10024610 3300025919 Bacteria 5570
104 Ga0207652_10033399 3300025921 Bacteria 4332
105 Ga0207646_10073373 3300025922 Bacteria 3057
106 Ga0207646_10160406 3300025922 Bacteria 2029
107 Ga0207646_10262716 3300025922 Unclassified 1560
108 Ga0207646_10352473 3300025922 Unclassified 1330
109 Ga0207646_11057288 3300025922 Unclassified 716
110 Ga0207687_10056720 3300025927 Bacteria 2748
111 Ga0207664_10157649 3300025929 Bacteria 1933
112 Ga0207690_10327095 3300025932 Bacteria 1206
113 Ga0207665_10560008 3300025939 Bacteria 889
114 Ga0207665_10985192 3300025939 Bacteria 670
115 Ga0207711_10740033 3300025941 Bacteria 917
116 Ga0207661_10169718 3300025944 Bacteria 1899
117 Ga0207679_10208866 3300025945 Bacteria 1636
118 Ga0207677_10559770 3300026023 Unclassified 998
119 Ga0207702_11062466 3300026078 Unclassified 803
120 Ga0265319_1004321 3300028563 Bacteria 7062
121 Ga0265319_1030688 3300028563 Unclassified 1876
122 Ga0265334_10009422 3300028573 Bacteria 4129
123 Ga0265318_10000065 3300028577 Bacteria 102014
124 Ga0265318_10005617 3300028577 Bacteria 5875
125 Ga0265323_10043167 3300028653 Unclassified 1629
126 Ga0265322_10008026 3300028654 Bacteria 3079
127 Ga0265322_10009372 3300028654 Bacteria 2842
128 Ga0265336_10107915 3300028666 Unclassified 829
129 Ga0265336_10132972 3300028666 Bacteria 741
130 Ga0265338_10005902 3300028800 Bacteria 15784
131 Ga0265338_10039038 3300028800 Bacteria 4487
132 Ga0265338_10078845 3300028800 Bacteria 2775
133 Ga0265338_10147697 3300028800 Bacteria 1831
134 Ga0265338_10338298 3300028800 Unclassified 1085
135 Ga0265324_10139067 3300029957 Unclassified 825
136 Ga0265330_10028891 3300031235 Bacteria 2495
137 Ga0265330_10156151 3300031235 Bacteria 969
138 Ga0265330_10210238 3300031235 Bacteria 822
139 Ga0265330_10422202 3300031235 Bacteria 565
140 Ga0265332_10009518 3300031238 Bacteria 4336
141 Ga0265328_10241398 3300031239 Unclassified 690
142 Ga0265320_10082307 3300031240 Bacteria 1501
143 Ga0265325_10053166 3300031241 Bacteria 2077
144 Ga0265325_10056812 3300031241 Bacteria 1998
145 Ga0265325_10111830 3300031241 Bacteria 1326
146 Ga0265325_10287850 3300031241 Unclassified 735
147 Ga0265329_10005149 3300031242 Bacteria 5319
148 Ga0265329_10183128 3300031242 Unclassified 685
149 Ga0265340_10183375 3300031247 Unclassified 945
150 Ga0265340_10282402 3300031247 Bacteria 737
151 Ga0265339_10006175 3300031249 Bacteria 7893
152 Ga0265339_10197936 3300031249 Bacteria 992
153 Ga0265339_10220957 3300031249 Unclassified 926
154 Ga0265331_10346246 3300031250 Unclassified 665
155 Ga0265331_10437161 3300031250 Bacteria 587
156 Ga0265327_10026720 3300031251 Bacteria 3337
157 Ga0265327_10036954 3300031251 Bacteria 2679
158 Ga0265327_10487613 3300031251 Bacteria 531
159 Ga0265316_10013688 3300031344 Bacteria 7195
160 Ga0265316_10088477 3300031344 Bacteria 2364
161 Ga0265316_10328355 3300031344 Bacteria 1110
162 Ga0265313_10060039 3300031595 Bacteria 1785
163 Ga0265313_10382869 3300031595 Bacteria 554
164 Ga0265314_10012609 3300031711 Bacteria 6881
165 Ga0265314_10689394 3300031711 Unclassified 517
166 Ga0265342_10047131 3300031712 Bacteria 2588
167 Ga0265342_10068015 3300031712 Bacteria 2083
168 Ga0265342_10082433 3300031712 Bacteria 1855
169 Ga0265342_10558842 3300031712 Bacteria 580
170 Ga0307409_101508425 3300031995 Bacteria 700
171 Ga0307415_101046956 3300032126 Bacteria 761
172 Ga0373953_0245924 3300035117 Bacteria 777
173 Ga0373956_0177898 3300035119 Bacteria 1005
174 Ga0373943_0678829 3300035170 Unclassified 610
175 Ga0373955_0180781 3300035172 Bacteria 1251
176 Ga0373931_0542949 3300035691 Bacteria 754
177 Ga0373933_0293625 3300035724 Bacteria 1051
178 Ga0373937_0016053 3300036401 Bacteria 6642
179 Ga0395899_0009391 3300037312 Bacteria 7510
180 Ga0395899_0023692 3300037312 Bacteria 4646
181 Ga0395899_0071892 3300037312 Bacteria 2531
182 Ga0395899_0283048 3300037312 Archaea 1127
183 Ga0395900_0000988 3300037418 Bacteria 36988
184 Ga0395900_0002063 3300037418 Bacteria 22548
185 Ga0395900_0029608 3300037418 Bacteria 5617
186 Ga0395900_0125938 3300037418 Bacteria 2627
187 Ga0395900_0169780 3300037418 Bacteria 2221
188 Ga0395900_0255798 3300037418 Bacteria 1751
189 Ga0395900_0578180 3300037418 Unclassified 1065
190 Ga0395900_0968538 3300037418 Bacteria 772
191 Ga0395898_0005501 3300037466 Bacteria 13678
192 Ga0395898_0021055 3300037466 Bacteria 6616
193 Ga0395898_0076606 3300037466 Unclassified 3229
194 Ga0395898_0101093 3300037466 Bacteria 2769
195 Ga0395898_0236647 3300037466 Unclassified 1741
196 Ga0395898_0287803 3300037466 Bacteria 1567
197 Ga0395898_0442293 3300037466 Bacteria 1238
198 Ga0395898_0920411 3300037466 Unclassified 812
199 Ga0395898_1827462 3300037466 Unclassified 528
200 Ga0395898_1916900 3300037466 Unclassified 513
201 Ga0395905_0002715 3300037471 Bacteria 19391
202 Ga0395905_0003527 3300037471 Bacteria 16686
203 Ga0395905_0006339 3300037471 Bacteria 11921
204 Ga0395905_0053556 3300037471 Bacteria 3776
205 Ga0395905_0192669 3300037471 Bacteria 1912
206 Ga0395905_0300467 3300037471 Unclassified 1492
207 Ga0395905_1649149 3300037471 Unclassified 546
208 Ga0395901_0001046 3300038443 Bacteria 29844
209 Ga0395901_0001699 3300038443 Bacteria 22721
210 Ga0395901_0017122 3300038443 Bacteria 7389
211 Ga0395901_0026916 3300038443 Bacteria 5904
212 Ga0395901_0124759 3300038443 Bacteria 2705
213 Ga0395901_0167086 3300038443 Bacteria 2309
214 Ga0395901_0311363 3300038443 Archaea 1630
215 Ga0395901_0410610 3300038443 Bacteria 1390
216 Ga0395901_1609925 3300038443 Bacteria 603
217 Ga0451853_0144259 3300041512 Unclassified 593
218 Ga0466966_0004033 3300044684 Bacteria 9698
219 Ga0466963_0007463 3300044694 Bacteria 6522
220 Ga0466963_0008804 3300044694 Bacteria 6063
221 Ga0466963_0151370 3300044694 Unclassified 1611
222 Ga0466963_0278870 3300044694 Bacteria 1175
223 Ga0466964_0292550 3300044706 Bacteria 818
224 Ga0466964_0684217 3300044706 Bacteria 570
225 Ga0466964_0918455 3300044706 Unclassified 502
226 Ga0466971_0291099 3300044719 Unclassified 783
227 Ga0466968_0006248 3300044735 Bacteria 4483
228 Ga0466968_0035485 3300044735 Unclassified 2087
229 Ga0466968_0519283 3300044735 Bacteria 595
230 Ga0466970_0420233 3300044765 Bacteria 764
231 Ga0466957_0081610 3300044842 Bacteria 2014
232 Ga0466957_0265076 3300044842 Bacteria 1146
233 Ga0466957_0478962 3300044842 Unclassified 861
234 Ga0466959_0006828 3300045049 Bacteria 7955
235 Ga0451576_1252105 3300045051 Bacteria 774
236 Ga0466958_0191493 3300045836 Bacteria 1300
237 Ga0466958_0430090 3300045836 Unclassified 854
238 Ga0466967_0008612 3300045976 Bacteria 7497
239 Ga0466967_0009864 3300045976 Bacteria 7121
240 Ga0466967_0057185 3300045976 Bacteria 3442
241 Ga0466967_0062554 3300045976 Bacteria 3304
242 Ga0466967_1508723 3300045976 Unclassified 669
243 Ga0466967_2057970 3300045976 Unclassified 567
244 Ga0495592_0566487 3300046454 Unclassified 697
245 Ga0495641_0440248 3300046461 Bacteria 593
246 Ga0495651_0012027 3300046462 Bacteria 6661
247 Ga0495653_0043065 3300046463 Bacteria 3512
248 Ga0495584_0018474 3300046491 Unclassified 3544
249 Ga0495585_0103556 3300046492 Unclassified 1520
250 Ga0495596_0045585 3300046500 Bacteria 1724
251 Ga0495628_0186999 3300046516 Bacteria 1565
252 Ga0495631_0121859 3300046518 Bacteria 1122
253 Ga0495637_0249401 3300046520 Unclassified 639
254 Ga0495663_0367216 3300046525 Unclassified 526
255 Ga0495663_0380479 3300046525 Unclassified 517
256 Ga0495652_1116075 3300046529 Bacteria 511
257 Ga0495654_0242543 3300046530 Bacteria 754
258 Ga0495586_0447187 3300046535 Bacteria 745
259 Ga0495667_0016943 3300046559 Bacteria 4921
260 Ga0495667_0529402 3300046559 Unclassified 737
261 Ga0495656_0195148 3300046615 Bacteria 1002
262 Ga0495634_0250533 3300046642 Bacteria 1083
263 Ga0495611_0348153 3300046648 Unclassified 680
264 Ga0495635_0415899 3300046663 Unclassified 892
265 Ga0495588_0548601 3300046674 Unclassified 606
266 Ga0495599_0124856 3300046678 Bacteria 1600
267 Ga0495623_0322455 3300046679 Bacteria 848
268 Ga0495646_0265548 3300046680 Bacteria 916
269 Ga0495613_0157829 3300046689 Bacteria 1615
270 Ga0495589_0043407 3300046794 Bacteria 2238
271 Ga0495600_0069826 3300046809 Bacteria 2296
272 Ga0495581_0316342 3300047315 Bacteria 912
273 Ga0495581_0644840 3300047315 Unclassified 612
274 Ga0495604_0588269 3300047317 Bacteria 715
275 Ga0495636_0482982 3300047318 Unclassified 598
276 Ga0495674_0321001 3300047319 Bacteria 1262
277 Ga0495677_0368853 3300047445 Unclassified 567
278 Ga0495684_0033347 3300047471 Bacteria 3950
279 Ga0495602_0050380 3300048088 Bacteria 3721
280 Ga0495602_0208855 3300048088 Bacteria 1484
281 Ga0495615_0242137 3300048090 Unclassified 569
282 Ga0496100_0266646 3300048903 Bacteria 1272
283 Ga0496100_1048934 3300048903 Bacteria 642
284 Ga0496101_0334109 3300048904 Bacteria 1190
285 Ga0496101_0857188 3300048904 Unclassified 716
286 Ga0496102_0963340 3300048905 Bacteria 774
287 Ga0496102_1253278 3300048905 Bacteria 661
288 Ga0496103_0328330 3300048906 Unclassified 984
289 Ga0496103_0610831 3300048906 Bacteria 694
290 Ga0496103_1006662 3300048906 Bacteria 519
291 Ga0496104_0092642 3300048907 Bacteria 2889
292 Ga0496104_0916540 3300048907 Bacteria 781
293 Ga0496105_0129929 3300048908 Bacteria 2077
294 Ga0496106_1415255 3300048909 Unclassified 537
295 Ga0496107_0075900 3300048910 Bacteria 2447
296 Ga0496107_0672193 3300048910 Bacteria 763
297 Ga0496108_0000888 3300048911 Bacteria 23275
298 Ga0496108_0011826 3300048911 Bacteria 7101
299 Ga0496108_0012735 3300048911 Bacteria 6849
300 Ga0496109_0000579 3300048912 Bacteria 30650
301 Ga0496109_0007084 3300048912 Bacteria 9465
302 Ga0496109_0059987 3300048912 Unclassified 3476
303 Ga0496110_0100685 3300048913 Unclassified 2590
304 Ga0496110_0110340 3300048913 Bacteria 2471
305 Ga0496110_0453289 3300048913 Unclassified 1169
306 Ga0496111_0010635 3300048914 Bacteria 6184
307 Ga0496111_0018348 3300048914 Bacteria 4847
308 Ga0496111_0029739 3300048914 Bacteria 3881
309 Ga0496111_0678300 3300048914 Bacteria 751
310 Ga0496112_0010813 3300048915 Bacteria 8303
311 Ga0496112_0022196 3300048915 Bacteria 6049
312 Ga0496112_0700712 3300048915 Unclassified 940
313 Ga0496112_0966667 3300048915 Bacteria 772
314 Ga0496113_0036060 3300048916 Bacteria 3622
315 Ga0496113_0607368 3300048916 Bacteria 876
316 Ga0496113_0712499 3300048916 Unclassified 800
317 Ga0496114_0543740 3300048917 Bacteria 1026
318 Ga0496114_0828437 3300048917 Unclassified 805
319 Ga0496115_0237244 3300048918 Bacteria 1503
320 Ga0496115_1000783 3300048918 Bacteria 639
321 Ga0501036_1022881 3300049572 Bacteria 676
322 Ga0501036_1233970 3300049572 Unclassified 609
323 Ga0501040_0250243 3300049576 Bacteria 1264
324 Ga0501067_0087425 3300049583 Bacteria 1729
325 Ga0501067_0707579 3300049583 Unclassified 566
326 Ga0501069_0012316 3300049585 Bacteria 4545
327 Ga0501069_0054283 3300049585 Bacteria 2232
328 Ga0501069_0809114 3300049585 Unclassified 568
329 Ga0501081_0349280 3300049743 Unclassified 1090
330 nmdc:mga05p37_157827_c1 3300050507 Bacteria 2771
331 nmdc:mga06r32_251637_c1 3300050510 Unclassified 1754
332 nmdc:mga0rr50_1402041_c1 3300050513 Unclassified 591
333 Ga0495601_0401904 3300053077 Unclassified 888
334 Ga0495619_0329187 3300053085 Bacteria 1057
335 Ga0500641_0306138 3300053096 Bacteria 651
336 Ga0466962_0317969 3300061719 Unclassified 772
337 Ga0530510_0116301 3300061734 Bacteria 1961
338 Ga0070707_101112339
339 Ga0070658_10009482
340 Ga0070658_10704046
341 Ga0070683_100087423
342 Ga0070683_100254650
343 Ga0070682_101244688
344 Ga0070682_101498547
345 Ga0070682_102065346
346 Ga0068868_100614420
347 Ga0068868_100930788
348 Ga0070675_101822330
349 Ga0070659_100217393
350 Ga0070709_10202058
351 Ga0070709_10399468
352 Ga0070710_10435021
353 Ga0070710_11089353
354 Ga0070711_100856248
355 Ga0070711_100871735
356 Ga0070708_100242250
357 Ga0070678_101766440
358 Ga0070681_10049353
359 Ga0070681_10526069
360 Ga0070681_11525684
361 Ga0070706_100075254
362 Ga0070706_100118852
363 Ga0070707_100166816
364 Ga0070707_100509973
365 Ga0070707_100515497
366 Ga0070707_102070549
367 Ga0070698_100091445
368 Ga0070698_100161537
369 Ga0070698_100295261
370 Ga0070698_101079883
371 Ga0070698_101145723
372 Ga0070699_100008276
373 Ga0070699_100417547
374 Ga0070699_100744614
375 Ga0070699_100788092
376 Ga0070679_100064501
377 Ga0070684_100448491
378 Ga0070697_101402641
379 Ga0070696_100367622
380 Ga0070696_100390177
381 Ga0070665_102221517
382 Ga0070704_102270724
383 Ga0070664_100521079
384 Ga0068856_100192390
385 Ga0068856_102069379
386 Ga0068864_101746503
387 Ga0068863_101611043
388 Ga0075365_10040894
389 Ga0075368_10513204
390 Ga0075364_10102966
391 Ga0070716_100653815
392 Ga0070716_101374128
393 Ga0070712_100005380
394 Ga0070712_100155607
395 Ga0070712_101938483
396 Ga0097621_102432320
397 Ga0068871_101250365
398 Ga0075431_100107412
399 Ga0075434_102144443
400 Ga0075435_100354436
401 Ga0111539_10812795
402 Ga0105245_10094401
403 Ga0105245_12835841
404 Ga0114129_10454966
405 Ga0114129_10933486
406 Ga0114129_11786201
407 Ga0114129_11968850
408 Ga0114129_13036642
409 Ga0105243_11099945
410 Ga0105241_11153949
411 Ga0105246_11165740
412 Ga0105246_12048377
413 Ga0157373_10109988
414 Ga0157373_10343340
415 Ga0157371_11655837
416 Ga0157369_10016604
417 Ga0157369_11266226
418 Ga0157374_10148790
419 Ga0157378_10555324
420 Ga0157372_12493534
421 Ga0157375_10043526
422 Ga0163163_10262510
423 Ga0182008_10023987
424 Ga0182008_10098827
425 Ga0157376_10040314
426 Ga0182007_10139752
427 Ga0197907_10513294
428 Ga0206356_11155746
429 Ga0207692_10457776
430 Ga0207699_10131181
431 Ga0207699_10698827
432 Ga0207699_10831240
433 Ga0207705_10152230
434 Ga0207705_10175467
435 Ga0207684_11718190
436 Ga0207693_10017446
437 Ga0207693_10280209
438 Ga0207663_10172282
439 Ga0207660_10289038
440 Ga0207657_10024610
441 Ga0207652_10033399
442 Ga0207646_10073373
443 Ga0207646_10160406
444 Ga0207646_10262716
445 Ga0207646_10352473
446 Ga0207646_11057288
447 Ga0207687_10056720
448 Ga0207664_10157649
449 Ga0207690_10327095
450 Ga0207665_10560008
451 Ga0207665_10985192
452 Ga0207711_10740033
453 Ga0207661_10169718
454 Ga0207679_10208866
455 Ga0207677_10559770
456 Ga0207702_11062466
457 Ga0265319_1004321
458 Ga0265319_1030688
459 Ga0265334_10009422
460 Ga0265318_10000065
461 Ga0265318_10005617
462 Ga0265323_10043167
463 Ga0265322_10008026
464 Ga0265322_10009372
465 Ga0265336_10107915
466 Ga0265336_10132972
467 Ga0265338_10005902
468 Ga0265338_10039038
469 Ga0265338_10078845
470 Ga0265338_10147697
471 Ga0265338_10338298
472 Ga0265324_10139067
473 Ga0265330_10028891
474 Ga0265330_10156151
475 Ga0265330_10210238
476 Ga0265330_10422202
477 Ga0265332_10009518
478 Ga0265328_10241398
479 Ga0265320_10082307
480 Ga0265325_10053166
481 Ga0265325_10056812
482 Ga0265325_10111830
483 Ga0265325_10287850
484 Ga0265329_10005149
485 Ga0265329_10183128
486 Ga0265340_10183375
487 Ga0265340_10282402
488 Ga0265339_10006175
489 Ga0265339_10197936
490 Ga0265339_10220957
491 Ga0265331_10346246
492 Ga0265331_10437161
493 Ga0265327_10026720
494 Ga0265327_10036954
495 Ga0265327_10487613
496 Ga0265316_10013688
497 Ga0265316_10088477
498 Ga0265316_10328355
499 Ga0265313_10060039
500 Ga0265313_10382869
501 Ga0265314_10012609
502 Ga0265314_10689394
503 Ga0265342_10047131
504 Ga0265342_10068015
505 Ga0265342_10082433
506 Ga0265342_10558842
507 Ga0307409_101508425
508 Ga0307415_101046956
509 Ga0373953_0245924
510 Ga0373956_0177898
511 Ga0373943_0678829
512 Ga0373955_0180781
513 Ga0373931_0542949
514 Ga0373933_0293625
515 Ga0373937_0016053
516 Ga0395899_0009391
517 Ga0395899_0023692
518 Ga0395899_0071892
519 Ga0395899_0283048
520 Ga0395900_0000988
521 Ga0395900_0002063
522 Ga0395900_0029608
523 Ga0395900_0125938
524 Ga0395900_0169780
525 Ga0395900_0255798
526 Ga0395900_0578180
527 Ga0395900_0968538
528 Ga0395898_0005501
529 Ga0395898_0021055
530 Ga0395898_0076606
531 Ga0395898_0101093
532 Ga0395898_0236647
533 Ga0395898_0287803
534 Ga0395898_0442293
535 Ga0395898_0920411
536 Ga0395898_1827462
537 Ga0395898_1916900
538 Ga0395905_0002715
539 Ga0395905_0003527
540 Ga0395905_0006339
541 Ga0395905_0053556
542 Ga0395905_0192669
543 Ga0395905_0300467
544 Ga0395905_1649149
545 Ga0395901_0001046
546 Ga0395901_0001699
547 Ga0395901_0017122
548 Ga0395901_0026916
549 Ga0395901_0124759
550 Ga0395901_0167086
551 Ga0395901_0311363
552 Ga0395901_0410610
553 Ga0395901_1609925
554 Ga0451853_0144259
555 Ga0466966_0004033
556 Ga0466963_0007463
557 Ga0466963_0008804
558 Ga0466963_0151370
559 Ga0466963_0278870
560 Ga0466964_0292550
561 Ga0466964_0684217
562 Ga0466964_0918455
563 Ga0466971_0291099
564 Ga0466968_0006248
565 Ga0466968_0035485
566 Ga0466968_0519283
567 Ga0466970_0420233
568 Ga0466957_0081610
569 Ga0466957_0265076
570 Ga0466957_0478962
571 Ga0466959_0006828
572 Ga0451576_1252105
573 Ga0466958_0191493
574 Ga0466958_0430090
575 Ga0466967_0008612
576 Ga0466967_0009864
577 Ga0466967_0057185
578 Ga0466967_0062554
579 Ga0466967_1508723
580 Ga0466967_2057970
581 Ga0495592_0566487
582 Ga0495641_0440248
583 Ga0495651_0012027
584 Ga0495653_0043065
585 Ga0495584_0018474
586 Ga0495585_0103556
587 Ga0495596_0045585
588 Ga0495628_0186999
589 Ga0495631_0121859
590 Ga0495637_0249401
591 Ga0495663_0367216
592 Ga0495663_0380479
593 Ga0495652_1116075
594 Ga0495654_0242543
595 Ga0495586_0447187
596 Ga0495667_0016943
597 Ga0495667_0529402
598 Ga0495656_0195148
599 Ga0495634_0250533
600 Ga0495611_0348153
601 Ga0495635_0415899
602 Ga0495588_0548601
603 Ga0495599_0124856
604 Ga0495623_0322455
605 Ga0495646_0265548
606 Ga0495613_0157829
607 Ga0495589_0043407
608 Ga0495600_0069826
609 Ga0495581_0316342
610 Ga0495581_0644840
611 Ga0495604_0588269
612 Ga0495636_0482982
613 Ga0495674_0321001
614 Ga0495677_0368853
615 Ga0495684_0033347
616 Ga0495602_0050380
617 Ga0495602_0208855
618 Ga0495615_0242137
619 Ga0496100_0266646
620 Ga0496100_1048934
621 Ga0496101_0334109
622 Ga0496101_0857188
623 Ga0496102_0963340
624 Ga0496102_1253278
625 Ga0496103_0328330
626 Ga0496103_0610831
627 Ga0496103_1006662
628 Ga0496104_0092642
629 Ga0496104_0916540
630 Ga0496105_0129929
631 Ga0496106_1415255
632 Ga0496107_0075900
633 Ga0496107_0672193
634 Ga0496108_0000888
635 Ga0496108_0011826
636 Ga0496108_0012735
637 Ga0496109_0000579
638 Ga0496109_0007084
639 Ga0496109_0059987
640 Ga0496110_0100685
641 Ga0496110_0110340
642 Ga0496110_0453289
643 Ga0496111_0010635
644 Ga0496111_0018348
645 Ga0496111_0029739
646 Ga0496111_0678300
647 Ga0496112_0010813
648 Ga0496112_0022196
649 Ga0496112_0700712
650 Ga0496112_0966667
651 Ga0496113_0036060
652 Ga0496113_0607368
653 Ga0496113_0712499
654 Ga0496114_0543740
655 Ga0496114_0828437
656 Ga0496115_0237244
657 Ga0496115_1000783
658 Ga0501036_1022881
659 Ga0501036_1233970
660 Ga0501040_0250243
661 Ga0501067_0087425
662 Ga0501067_0707579
663 Ga0501069_0012316
664 Ga0501069_0054283
665 Ga0501069_0809114
666 Ga0501081_0349280
667 nmdc:mga05p37_157827_c1
668 nmdc:mga06r32_251637_c1
669 nmdc:mga0rr50_1402041_c1
670 Ga0495601_0401904
671 Ga0495619_0329187
672 Ga0500641_0306138
673 Ga0466962_0317969
674 Ga0530510_0116301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01476

LysM

LysM domain

32

80

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xcm-assembly1.cif.gz_B crystal structure of the putative nlpc/p60 d,l endopeptidase from t. thermophilus 0.8399 30 79
5jcd-assembly2.cif.gz_B crystal structure of oscebip 0.8315 31 80
4uz3-assembly3.cif.gz_C crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl-chitohexaose 0.8307 29 79
5ls2-assembly1.cif.gz_A receptor mediated chitin perception in legumes is functionally seperable from nod factor perception 0.8206 31 80
4uz3-assembly2.cif.gz_B crystal structure of the n-terminal lysm domains from the putative nlpc/p60 d,l endopeptidase from t. thermophilus bound to n-acetyl-chitohexaose 0.8071 30 79
ID Description Score Start End Superfamily
af_I1JZ72_160_227_3.10.350.10 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.921 29 80 3.10.350.10
4b9hA01 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8403 25 79 3.10.350.10
4a1iG01 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8396 30 79 3.10.350.10
4uz3C00 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8307 29 79 3.10.350.10
af_I1KQ51_169_229_3.10.350.10 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8253 25 79 3.10.350.10
ID Description Score Start End GO Terms
AF-A0A7W0PZQ7-F1-model_v4 LysM peptidoglycan-binding domain-containing protein 0.9572 32 79
AF-A0A2D3D3D9-F1-model_v4 LysM domain-containing protein 0.9552 30 81 GO:0016020
AF-A0A538KRP6-F1-model_v4 LysM peptidoglycan-binding domain-containing protein 0.9437 25 79
AF-A0A4Q0VR57-F1-model_v4 LysM peptidoglycan-binding domain-containing protein 0.939 29 79
AF-A0A841EZB9-F1-model_v4 LysM repeat protein 0.9309 29 79

Map