F412962

General Info

Members Datasets Scaffolds Average Seq Length
337 173 672 474

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100029525|Ga0070705_1000295252
Length 556
Sequence MRASEEFGSELDPRWSAGQSAASLLWDQGIALGRAARRGPTLTNPKSKIESHLPHFSPVARIAEHQMKQPMNSNGTLTPVVSRRDFLWRYGGGLGGIALVHLLGRQGLLADVAGALPRPSAEWNGGLHHRAKVKRVIQLFMNGGASQMDTFDYKPELAKRHGEKFEPPGQHVEAATSVPGSILKSPFEFKQHGQTGRWVSSALPQTAKQVDDLAFFMALASKTNVHGPASYMMNTGFLLPGFPCFGAWLSYALGSLNENLPCFVVLPDAKGLPYNQKGNFSSGFLPVTHQGTILKPSATNPINDLFPPRTASQITAQSEKEGLSLLERMNRRHLQQHPGDSRLESRIASYELAARLQLSAPEALDLSSETAATRKLYGLEEKASADFGRSCLLARRLIERGVRFVQVWSGQGGPTGNWDNHASIEKELPPMAQATDQPIAGLLADLKARGLFEDTLVIWSTEFGRMPFSQGGTGRDHNGGTSVAWLAGAGVRAGAVHGESDEWGWKAAKEKTYCYDLHATVLHLLGIDHTKLTFRHNGTARRLTDVHGEVIDTVLA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
170 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
171 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
172 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
173 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 0
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0
Rhizoplane 1.19
Rhizosphere 91.39
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100029525 3300005440 Bacteria 3017
2 MRS1b_contig_5894787 2162886011 Bacteria 2859
3 JGI25152J39213_1009428 3300002773 Bacteria 2320
4 JGI25153J46596_10001528 3300003215 Bacteria 13742
5 Ga0055526_1002267 3300003771 Bacteria 13145
6 Ga0065712_10071261 3300005290 Bacteria 5385
7 Ga0065712_10076057 3300005290 Bacteria 3741
8 Ga0065707_10093990 3300005295 Bacteria 3553
9 Ga0070658_10000326 3300005327 Bacteria 40784
10 Ga0070658_10003468 3300005327 Bacteria 12958
11 Ga0070658_10004197 3300005327 Bacteria 11799
12 Ga0070683_100000018 3300005329 Bacteria 193063
13 Ga0070666_10042902 3300005335 Bacteria 3027
14 Ga0070680_100081080 3300005336 Bacteria 2677
15 Ga0070660_100077044 3300005339 Bacteria 2612
16 Ga0070689_100001632 3300005340 Bacteria 14337
17 Ga0070689_100028695 3300005340 Bacteria 4208
18 Ga0070689_100074684 3300005340 Bacteria 2653
19 Ga0070669_100033862 3300005353 Bacteria 3697
20 Ga0070675_100045833 3300005354 Bacteria 3579
21 Ga0070673_100157771 3300005364 Bacteria 1927
22 Ga0070688_100061750 3300005365 Bacteria 2370
23 Ga0070701_10008221 3300005438 Bacteria 4500
24 Ga0070705_100209574 3300005440 Bacteria 1342
25 Ga0070694_100009057 3300005444 Bacteria 6101
26 Ga0070708_100077345 3300005445 Bacteria 3007
27 Ga0070706_100118578 3300005467 Bacteria 2466
28 Ga0070707_100004150 3300005468 Bacteria 13581
29 Ga0070707_100025110 3300005468 Bacteria 5652
30 Ga0070707_100042085 3300005468 Bacteria 4372
31 Ga0070698_100036467 3300005471 Bacteria 5078
32 Ga0070698_100058662 3300005471 Bacteria 3890
33 Ga0070698_100199134 3300005471 Bacteria 1939
34 Ga0070698_100243077 3300005471 Bacteria 1733
35 Ga0070699_100009243 3300005518 Bacteria 8543
36 Ga0070699_100044959 3300005518 Bacteria 3822
37 Ga0070684_100000743 3300005535 Bacteria 22555
38 Ga0070684_100123751 3300005535 Bacteria 2328
39 Ga0070697_100018534 3300005536 Bacteria 5488
40 Ga0068853_100029950 3300005539 Bacteria 4593
41 Ga0070672_100008972 3300005543 Bacteria 6873
42 Ga0070686_100012908 3300005544 Bacteria 4770
43 Ga0070686_100016234 3300005544 Bacteria 4327
44 Ga0070696_100000801 3300005546 Bacteria 20230
45 Ga0070665_100000741 3300005548 Bacteria 43468
46 Ga0070665_100001150 3300005548 Bacteria 32536
47 Ga0070665_100198269 3300005548 Bacteria 2008
48 Ga0070704_100017511 3300005549 Bacteria 4557
49 Ga0068855_100005092 3300005563 Bacteria 16020
50 Ga0068855_100010738 3300005563 Bacteria 11052
51 Ga0068855_100021446 3300005563 Bacteria 7747
52 Ga0068855_100038034 3300005563 Bacteria 5720
53 Ga0068852_100033619 3300005616 Bacteria 4260
54 Ga0068852_100231410 3300005616 Bacteria 1762
55 Ga0068859_100023477 3300005617 Bacteria 6189
56 Ga0068859_100208114 3300005617 Bacteria 2042
57 Ga0068861_100005946 3300005719 Bacteria 8287
58 Ga0068863_100016272 3300005841 Bacteria 7136
59 Ga0068863_100019874 3300005841 Bacteria 6425
60 Ga0068863_100037959 3300005841 Bacteria 4584
61 Ga0068863_100118648 3300005841 Bacteria 2522
62 Ga0068858_100089815 3300005842 Bacteria 2859
63 Ga0068862_100077939 3300005844 Bacteria 2870
64 Ga0068862_100152274 3300005844 Unclassified 2059
65 Ga0068862_100194239 3300005844 Bacteria 1828
66 Ga0068862_100261028 3300005844 Bacteria 1581
67 Ga0081455_10017585 3300005937 Bacteria 6845
68 Ga0070717_10033595 3300006028 Bacteria 4139
69 Ga0075362_10048779 3300006177 Bacteria 1890
70 Ga0097621_100055361 3300006237 Bacteria 3239
71 Ga0075428_100001477 3300006844 Bacteria 25151
72 Ga0075428_100004030 3300006844 Bacteria 16134
73 Ga0075428_100025928 3300006844 Bacteria 6492
74 Ga0075428_100041384 3300006844 Bacteria 5068
75 Ga0075430_100101225 3300006846 Bacteria 2406
76 Ga0075431_100013534 3300006847 Bacteria 8244
77 Ga0075431_100016486 3300006847 Bacteria 7499
78 Ga0075431_100041840 3300006847 Bacteria 4725
79 Ga0075431_100043526 3300006847 Bacteria 4632
80 Ga0075431_100056574 3300006847 Bacteria 4045
81 Ga0075431_100084174 3300006847 Bacteria 3283
82 Ga0075431_100091489 3300006847 Bacteria 3140
83 Ga0075433_10040300 3300006852 Bacteria 4043
84 Ga0075433_10109210 3300006852 Bacteria 2454
85 Ga0075429_100111234 3300006880 Bacteria 2394
86 Ga0075436_100006954 3300006914 Bacteria 7742
87 Ga0075436_100083322 3300006914 Bacteria 2219
88 Ga0097620_100023478 3300006931 Bacteria 6189
89 Ga0097620_100208120 3300006931 Bacteria 2042
90 Ga0075435_100179489 3300007076 Bacteria 1789
91 Ga0105240_10000183 3300009093 Bacteria 127268
92 Ga0105240_10000550 3300009093 Bacteria 69293
93 Ga0105240_10002125 3300009093 Bacteria 32374
94 Ga0105240_10127572 3300009093 Bacteria 3055
95 Ga0111539_10002554 3300009094 Bacteria 24101
96 Ga0111539_10025358 3300009094 Bacteria 7267
97 Ga0111539_10027199 3300009094 Bacteria 6985
98 Ga0111539_10075979 3300009094 Bacteria 3956
99 Ga0111539_10130732 3300009094 Bacteria 2940
100 Ga0111539_10192713 3300009094 Bacteria 2378
101 Ga0111539_10247602 3300009094 Bacteria 2075
102 Ga0111539_10318440 3300009094 Bacteria 1810
103 Ga0111539_10330240 3300009094 Bacteria 1775
104 Ga0111539_10337163 3300009094 Bacteria 1755
105 Ga0114129_10000598 3300009147 Bacteria 44512
106 Ga0114129_10002168 3300009147 Bacteria 27047
107 Ga0114129_10024883 3300009147 Bacteria 8488
108 Ga0114129_10082617 3300009147 Bacteria 4463
109 Ga0114129_10121418 3300009147 Bacteria 3595
110 Ga0114129_10234115 3300009147 Bacteria 2472
111 Ga0114129_10404702 3300009147 Bacteria 1798
112 Ga0105248_10185059 3300009177 Bacteria 2347
113 Ga0105237_10004367 3300009545 Bacteria 16386
114 Ga0105238_10000045 3300009551 Bacteria 148069
115 Ga0105238_10000112 3300009551 Bacteria 89923
116 Ga0105238_10000119 3300009551 Bacteria 85885
117 Ga0105238_10000323 3300009551 Bacteria 52117
118 Ga0105249_10029894 3300009553 Bacteria 4922
119 Ga0157370_10033783 3300013104 Bacteria 4985
120 Ga0157369_10054818 3300013105 Bacteria 4304
121 Ga0163162_10415087 3300013306 Bacteria 1478
122 Ga0157375_10000025 3300013308 Bacteria 224384
123 Ga0157375_10000117 3300013308 Bacteria 77610
124 Ga0163163_10000211 3300014325 Bacteria 60430
125 Ga0163163_10181694 3300014325 Bacteria 2151
126 Ga0163163_10331179 3300014325 Bacteria 1577
127 Ga0157380_10001193 3300014326 Bacteria 16816
128 Ga0213876_10016983 3300021384 Bacteria 3845
129 Ga0213875_10000034 3300021388 Bacteria 167200
130 Ga0207425_1000957 3300025245 Bacteria 13595
131 Ga0209129_1000113 3300025258 Bacteria 145178
132 Ga0209564_1000186 3300025295 Bacteria 147120
133 Ga0209758_1000172 3300025297 Bacteria 147763
134 Ga0209050_1000713 3300025298 Bacteria 48846
135 Ga0207699_10079707 3300025906 Bacteria 2027
136 Ga0207705_10000969 3300025909 Bacteria 23493
137 Ga0207705_10003587 3300025909 Bacteria 11825
138 Ga0207705_10017901 3300025909 Bacteria 5068
139 Ga0207684_10088810 3300025910 Bacteria 2633
140 Ga0207695_10000279 3300025913 Bacteria 127268
141 Ga0207695_10000644 3300025913 Bacteria 69302
142 Ga0207695_10001924 3300025913 Bacteria 32293
143 Ga0207671_10012300 3300025914 Bacteria 6889
144 Ga0207657_10072292 3300025919 Bacteria 2918
145 Ga0207646_10003308 3300025922 Bacteria 18332
146 Ga0207646_10005065 3300025922 Bacteria 14008
147 Ga0207646_10030247 3300025922 Bacteria 4912
148 Ga0207694_10000531 3300025924 Bacteria 34519
149 Ga0207694_10001568 3300025924 Bacteria 19356
150 Ga0207694_10002901 3300025924 Bacteria 13788
151 Ga0207694_10005435 3300025924 Bacteria 9802
152 Ga0207686_10052862 3300025934 Bacteria 2537
153 Ga0207670_10005184 3300025936 Bacteria 7126
154 Ga0207670_10027311 3300025936 Bacteria 3606
155 Ga0207670_10047143 3300025936 Bacteria 2868
156 Ga0207661_10000025 3300025944 Bacteria 195900
157 Ga0207667_10001281 3300025949 Bacteria 31543
158 Ga0207667_10002190 3300025949 Bacteria 24531
159 Ga0207667_10014247 3300025949 Bacteria 9070
160 Ga0207703_10006060 3300026035 Bacteria 9669
161 Ga0207639_10007678 3300026041 Bacteria 7362
162 Ga0207639_10060987 3300026041 Bacteria 2911
163 Ga0207641_10178133 3300026088 Bacteria 1945
164 Ga0207676_10159606 3300026095 Bacteria 1952
165 Ga0207674_10000792 3300026116 Bacteria 41258
166 Ga0207674_10191393 3300026116 Unclassified 1996
167 Ga0207675_100011638 3300026118 Bacteria 8227
168 Ga0207698_10014576 3300026142 Bacteria 5233
169 Ga0207428_10004921 3300027907 Bacteria 12590
170 Ga0207428_10053912 3300027907 Bacteria 3204
171 Ga0207428_10061441 3300027907 Bacteria 2974
172 Ga0207428_10131883 3300027907 Bacteria 1911
173 Ga0268266_10000396 3300028379 Bacteria 66056
174 Ga0268266_10004270 3300028379 Bacteria 13749
175 Ga0268265_10043158 3300028380 Bacteria 3350
176 Ga0268265_10108513 3300028380 Bacteria 2260
177 Ga0268265_10142407 3300028380 Unclassified 2009
178 Ga0268264_10058983 3300028381 Bacteria 3215
179 Ga0265338_10013484 3300028800 Bacteria 9219
180 Ga0265328_10007711 3300031239 Bacteria 4475
181 Ga0265325_10000635 3300031241 Bacteria 25513
182 Ga0265329_10004464 3300031242 Bacteria 5808
183 Ga0265339_10001496 3300031249 Bacteria 17282
184 Ga0265339_10003379 3300031249 Bacteria 11170
185 Ga0265331_10000084 3300031250 Bacteria 130246
186 Ga0265331_10009857 3300031250 Bacteria 5325
187 Ga0265327_10000688 3300031251 Bacteria 54070
188 Ga0265327_10001955 3300031251 Bacteria 23633
189 Ga0265327_10002546 3300031251 Bacteria 18965
190 Ga0265327_10004366 3300031251 Bacteria 12570
191 Ga0265327_10004973 3300031251 Bacteria 11415
192 Ga0265327_10018898 3300031251 Bacteria 4255
193 Ga0265313_10000654 3300031595 Bacteria 35694
194 Ga0265313_10004137 3300031595 Bacteria 11282
195 Ga0265314_10000121 3300031711 Bacteria 120823
196 Ga0265314_10000751 3300031711 Bacteria 38851
197 Ga0265314_10003871 3300031711 Bacteria 14252
198 Ga0265314_10003883 3300031711 Bacteria 14222
199 Ga0265314_10016145 3300031711 Bacteria 5912
200 Ga0265314_10061262 3300031711 Bacteria 2563
201 Ga0265342_10019362 3300031712 Bacteria 4388
202 Ga0307409_100036543 3300031995 Bacteria 3612
203 Ga0373955_0011221 3300035172 Bacteria 4260
204 Ga0373961_0008610 3300035241 Bacteria 2484
205 Ga0373927_0001087 3300035695 Bacteria 20683
206 Ga0373927_0150033 3300035695 Bacteria 1527
207 Ga0373937_0021164 3300036401 Bacteria 5837
208 Ga0373937_0035281 3300036401 Bacteria 4552
209 Ga0373937_0296117 3300036401 Bacteria 1529
210 Ga0373925_0000437 3300037068 Bacteria 42142
211 Ga0436364_0205750 3300037853 Bacteria 121129
212 Ga0395901_0092442 3300038443 Bacteria 3167
213 Ga0395901_0250817 3300038443 Bacteria 1844
214 Ga0436365_0154570 3300039437 Bacteria 3361
215 Ga0436365_0946555 3300039437 Bacteria 4862
216 Ga0436365_1263484 3300039437 Bacteria 4638
217 Ga0451853_1622125 3300041512 Bacteria 2641
218 Ga0451577_0000689 3300042876 Bacteria 53024
219 Ga0451577_0002131 3300042876 Bacteria 24277
220 Ga0466969_0000157 3300044656 Bacteria 36880
221 Ga0453683_0033386 3300044673 Bacteria 3245
222 Ga0453684_0242751 3300044712 Bacteria 2073
223 Ga0451576_0021527 3300045051 Bacteria 7009
224 Ga0451576_0062657 3300045051 Bacteria 3876
225 Ga0451576_0097058 3300045051 Bacteria 3065
226 Ga0451576_0123400 3300045051 Unclassified 2698
227 Ga0451576_0144728 3300045051 Bacteria 2478
228 Ga0451576_0167882 3300045051 Bacteria 2290
229 Ga0451576_0335684 3300045051 Bacteria 1582
230 Ga0451576_0345859 3300045051 Bacteria 1557
231 Ga0495590_0001390 3300046457 Bacteria 10499
232 Ga0495651_0019498 3300046462 Bacteria 5258
233 Ga0495580_0002417 3300046472 Bacteria 16317
234 Ga0495639_0051899 3300046475 Bacteria 1866
235 Ga0495662_0001738 3300046476 Bacteria 10880
236 Ga0495662_0085977 3300046476 Bacteria 1532
237 Ga0495664_0013231 3300046477 Bacteria 4680
238 Ga0495608_0002040 3300046511 Bacteria 14516
239 Ga0495608_0007604 3300046511 Bacteria 7639
240 Ga0495628_0029972 3300046516 Bacteria 4407
241 Ga0495630_0000003 3300046517 Bacteria 524289
242 Ga0495630_0002168 3300046517 Bacteria 13669
243 Ga0495630_0075298 3300046517 Bacteria 2543
244 Ga0495630_0089509 3300046517 Bacteria 2325
245 Ga0495652_0030638 3300046529 Bacteria 4716
246 Ga0495665_0055260 3300046531 Bacteria 2097
247 Ga0495640_0038983 3300046533 Bacteria 3338
248 Ga0495587_0025271 3300046536 Bacteria 3630
249 Ga0495587_0038813 3300046536 Bacteria 2853
250 Ga0495645_0001185 3300046543 Bacteria 17805
251 Ga0495645_0047950 3300046543 Bacteria 3112
252 Ga0495645_0112828 3300046543 Bacteria 1922
253 Ga0495645_0145923 3300046543 Bacteria 1648
254 Ga0495667_0023233 3300046559 Bacteria 4178
255 Ga0495634_0057897 3300046642 Bacteria 2585
256 Ga0495625_0002996 3300046660 Bacteria 17484
257 Ga0495635_0024348 3300046663 Bacteria 4219
258 Ga0495599_0011902 3300046678 Bacteria 5353
259 Ga0495599_0123156 3300046678 Bacteria 1611
260 Ga0495623_0014896 3300046679 Bacteria 5029
261 Ga0495623_0018990 3300046679 Bacteria 4439
262 Ga0495658_0034407 3300046683 Bacteria 2780
263 Ga0495613_0016322 3300046689 Bacteria 5534
264 Ga0495613_0060239 3300046689 Bacteria 2781
265 Ga0495613_0098590 3300046689 Bacteria 2112
266 Ga0495624_0026016 3300046690 Bacteria 3839
267 Ga0495600_0001808 3300046809 Bacteria 11972
268 Ga0495604_0089936 3300047317 Bacteria 2281
269 Ga0495604_0160298 3300047317 Bacteria 1590
270 Ga0495674_0004379 3300047319 Bacteria 13576
271 Ga0495674_0020622 3300047319 Bacteria 6102
272 Ga0495684_0003971 3300047471 Bacteria 11536
273 Ga0495684_0025976 3300047471 Bacteria 4500
274 Ga0495602_0027208 3300048088 Bacteria 5501
275 Ga0496104_0394729 3300048907 Bacteria 1296
276 Ga0496107_0032759 3300048910 Bacteria 3715
277 Ga0496111_0166107 3300048914 Bacteria 1639
278 Ga0496115_0094751 3300048918 Bacteria 2443
279 Ga0496118_0027454 3300048921 Bacteria 4817
280 Ga0496121_0037772 3300048924 Bacteria 4284
281 Ga0501034_0002032 3300049571 Bacteria 25431
282 Ga0501034_0002498 3300049571 Bacteria 22074
283 Ga0501034_0003263 3300049571 Bacteria 18533
284 Ga0501034_0009539 3300049571 Bacteria 10161
285 Ga0501034_0138882 3300049571 Bacteria 2410
286 Ga0501034_0254266 3300049571 Bacteria 1701
287 Ga0501046_0003763 3300049580 Bacteria 13887
288 Ga0501047_0020046 3300049581 Bacteria 6421
289 Ga0501047_0048240 3300049581 Bacteria 4112
290 Ga0501047_0174748 3300049581 Bacteria 2016
291 Ga0501047_0231491 3300049581 Bacteria 1701
292 Ga0501068_0088029 3300049584 Bacteria 1913
293 Ga0501070_0080408 3300049586 Bacteria 2697
294 Ga0501080_0004032 3300049742 Bacteria 13012
295 Ga0501080_0009356 3300049742 Bacteria 8935
296 nmdc:mga05p37_129728_c1 3300050507 Bacteria 2654
297 nmdc:mga05p37_1311_c1 3300050507 Bacteria 28942
298 nmdc:mga05p37_2277_c1 3300050507 Bacteria 22372
299 nmdc:mga05p37_42337_c1 3300050507 Bacteria 5595
300 nmdc:mga05p37_86872_c1 3300050507 Bacteria 3855
301 nmdc:mga09592_84386_c1 3300050508 Bacteria 2708
302 nmdc:mga06r32_120063_c1 3300050510 Bacteria 2592
303 nmdc:mga06r32_179142_c1 3300050510 Bacteria 2104
304 nmdc:mga06r32_193298_c1 3300050510 Bacteria 2022
305 nmdc:mga06r32_206413_c1 3300050510 Bacteria 1953
306 nmdc:mga06r32_242349_c1 3300050510 Bacteria 1790
307 nmdc:mga06r32_26273_c1 3300050510 Bacteria 5427
308 nmdc:mga06r32_351052_c1 3300050510 Bacteria 1459
309 nmdc:mga06r32_44580_c1 3300050510 Bacteria 4224
310 nmdc:mga06r32_54998_c1 3300050510 Bacteria 3817
311 nmdc:mga06r32_62788_c1 3300050510 Bacteria 3579
312 nmdc:mga06r32_85554_c1 3300050510 Bacteria 3074
313 nmdc:mga08y16_132209_c1 3300050511 Unclassified 2594
314 nmdc:mga08y16_178755_c1 3300050511 Bacteria 2203
315 nmdc:mga08y16_20073_c1 3300050511 Bacteria 7050
316 nmdc:mga08y16_23880_c1 3300050511 Bacteria 6457
317 nmdc:mga08y16_37357_c1 3300050511 Bacteria 5101
318 nmdc:mga08y16_39882_c1 3300050511 Bacteria 4925
319 nmdc:mga08y16_4523_c1 3300050511 Bacteria 14513
320 nmdc:mga0n895_144486_c1 3300050512 Bacteria 2408
321 nmdc:mga08x19_18535_c1 3300050514 Bacteria 4265
322 nmdc:mga08x19_4408_c1 3300050514 Bacteria 8344
323 nmdc:mga0a205_123835_c1 3300050515 Bacteria 2485
324 nmdc:mga0a205_150041_c1 3300050515 Bacteria 2231
325 nmdc:mga0a205_236093_c1 3300050515 Bacteria 1710
326 nmdc:mga0a205_8483_c2 3300050515 Bacteria 7799
327 nmdc:mga0a205_91820_c1 3300050515 Bacteria 2934
328 Ga0500568_0011713 3300053139 Bacteria 4054
329 Ga0501084_0007242 3300054114 Bacteria 9145
330 2673167658 2671180531 Bacteria 9045424
331 2687234654 2684623219 Bacteria 8442773
332 2687235379 2684623219 Bacteria 8442773
333 2687236825 2684623219 Bacteria 8442773
334 2688067136 2687453257 Bacteria 6784659
335 2836165644 2836160341 Unclassified 5867367
336 2920113623 2920107658 Bacteria 10042636
337 Ga0070705_100029525
338 MRS1b_contig_5894787
339 JGI25152J39213_1009428
340 JGI25153J46596_10001528
341 Ga0055526_1002267
342 Ga0065712_10071261
343 Ga0065712_10076057
344 Ga0065707_10093990
345 Ga0070658_10000326
346 Ga0070658_10003468
347 Ga0070658_10004197
348 Ga0070683_100000018
349 Ga0070666_10042902
350 Ga0070680_100081080
351 Ga0070660_100077044
352 Ga0070689_100001632
353 Ga0070689_100028695
354 Ga0070689_100074684
355 Ga0070669_100033862
356 Ga0070675_100045833
357 Ga0070673_100157771
358 Ga0070688_100061750
359 Ga0070701_10008221
360 Ga0070705_100209574
361 Ga0070694_100009057
362 Ga0070708_100077345
363 Ga0070706_100118578
364 Ga0070707_100004150
365 Ga0070707_100025110
366 Ga0070707_100042085
367 Ga0070698_100036467
368 Ga0070698_100058662
369 Ga0070698_100199134
370 Ga0070698_100243077
371 Ga0070699_100009243
372 Ga0070699_100044959
373 Ga0070684_100000743
374 Ga0070684_100123751
375 Ga0070697_100018534
376 Ga0068853_100029950
377 Ga0070672_100008972
378 Ga0070686_100012908
379 Ga0070686_100016234
380 Ga0070696_100000801
381 Ga0070665_100000741
382 Ga0070665_100001150
383 Ga0070665_100198269
384 Ga0070704_100017511
385 Ga0068855_100005092
386 Ga0068855_100010738
387 Ga0068855_100021446
388 Ga0068855_100038034
389 Ga0068852_100033619
390 Ga0068852_100231410
391 Ga0068859_100023477
392 Ga0068859_100208114
393 Ga0068861_100005946
394 Ga0068863_100016272
395 Ga0068863_100019874
396 Ga0068863_100037959
397 Ga0068863_100118648
398 Ga0068858_100089815
399 Ga0068862_100077939
400 Ga0068862_100152274
401 Ga0068862_100194239
402 Ga0068862_100261028
403 Ga0081455_10017585
404 Ga0070717_10033595
405 Ga0075362_10048779
406 Ga0097621_100055361
407 Ga0075428_100001477
408 Ga0075428_100004030
409 Ga0075428_100025928
410 Ga0075428_100041384
411 Ga0075430_100101225
412 Ga0075431_100013534
413 Ga0075431_100016486
414 Ga0075431_100041840
415 Ga0075431_100043526
416 Ga0075431_100056574
417 Ga0075431_100084174
418 Ga0075431_100091489
419 Ga0075433_10040300
420 Ga0075433_10109210
421 Ga0075429_100111234
422 Ga0075436_100006954
423 Ga0075436_100083322
424 Ga0097620_100023478
425 Ga0097620_100208120
426 Ga0075435_100179489
427 Ga0105240_10000183
428 Ga0105240_10000550
429 Ga0105240_10002125
430 Ga0105240_10127572
431 Ga0111539_10002554
432 Ga0111539_10025358
433 Ga0111539_10027199
434 Ga0111539_10075979
435 Ga0111539_10130732
436 Ga0111539_10192713
437 Ga0111539_10247602
438 Ga0111539_10318440
439 Ga0111539_10330240
440 Ga0111539_10337163
441 Ga0114129_10000598
442 Ga0114129_10002168
443 Ga0114129_10024883
444 Ga0114129_10082617
445 Ga0114129_10121418
446 Ga0114129_10234115
447 Ga0114129_10404702
448 Ga0105248_10185059
449 Ga0105237_10004367
450 Ga0105238_10000045
451 Ga0105238_10000112
452 Ga0105238_10000119
453 Ga0105238_10000323
454 Ga0105249_10029894
455 Ga0157370_10033783
456 Ga0157369_10054818
457 Ga0163162_10415087
458 Ga0157375_10000025
459 Ga0157375_10000117
460 Ga0163163_10000211
461 Ga0163163_10181694
462 Ga0163163_10331179
463 Ga0157380_10001193
464 Ga0213876_10016983
465 Ga0213875_10000034
466 Ga0207425_1000957
467 Ga0209129_1000113
468 Ga0209564_1000186
469 Ga0209758_1000172
470 Ga0209050_1000713
471 Ga0207699_10079707
472 Ga0207705_10000969
473 Ga0207705_10003587
474 Ga0207705_10017901
475 Ga0207684_10088810
476 Ga0207695_10000279
477 Ga0207695_10000644
478 Ga0207695_10001924
479 Ga0207671_10012300
480 Ga0207657_10072292
481 Ga0207646_10003308
482 Ga0207646_10005065
483 Ga0207646_10030247
484 Ga0207694_10000531
485 Ga0207694_10001568
486 Ga0207694_10002901
487 Ga0207694_10005435
488 Ga0207686_10052862
489 Ga0207670_10005184
490 Ga0207670_10027311
491 Ga0207670_10047143
492 Ga0207661_10000025
493 Ga0207667_10001281
494 Ga0207667_10002190
495 Ga0207667_10014247
496 Ga0207703_10006060
497 Ga0207639_10007678
498 Ga0207639_10060987
499 Ga0207641_10178133
500 Ga0207676_10159606
501 Ga0207674_10000792
502 Ga0207674_10191393
503 Ga0207675_100011638
504 Ga0207698_10014576
505 Ga0207428_10004921
506 Ga0207428_10053912
507 Ga0207428_10061441
508 Ga0207428_10131883
509 Ga0268266_10000396
510 Ga0268266_10004270
511 Ga0268265_10043158
512 Ga0268265_10108513
513 Ga0268265_10142407
514 Ga0268264_10058983
515 Ga0265338_10013484
516 Ga0265328_10007711
517 Ga0265325_10000635
518 Ga0265329_10004464
519 Ga0265339_10001496
520 Ga0265339_10003379
521 Ga0265331_10000084
522 Ga0265331_10009857
523 Ga0265327_10000688
524 Ga0265327_10001955
525 Ga0265327_10002546
526 Ga0265327_10004366
527 Ga0265327_10004973
528 Ga0265327_10018898
529 Ga0265313_10000654
530 Ga0265313_10004137
531 Ga0265314_10000121
532 Ga0265314_10000751
533 Ga0265314_10003871
534 Ga0265314_10003883
535 Ga0265314_10016145
536 Ga0265314_10061262
537 Ga0265342_10019362
538 Ga0307409_100036543
539 Ga0373955_0011221
540 Ga0373961_0008610
541 Ga0373927_0001087
542 Ga0373927_0150033
543 Ga0373937_0021164
544 Ga0373937_0035281
545 Ga0373937_0296117
546 Ga0373925_0000437
547 Ga0436364_0205750
548 Ga0395901_0092442
549 Ga0395901_0250817
550 Ga0436365_0154570
551 Ga0436365_0946555
552 Ga0436365_1263484
553 Ga0451853_1622125
554 Ga0451577_0000689
555 Ga0451577_0002131
556 Ga0466969_0000157
557 Ga0453683_0033386
558 Ga0453684_0242751
559 Ga0451576_0021527
560 Ga0451576_0062657
561 Ga0451576_0097058
562 Ga0451576_0123400
563 Ga0451576_0144728
564 Ga0451576_0167882
565 Ga0451576_0335684
566 Ga0451576_0345859
567 Ga0495590_0001390
568 Ga0495651_0019498
569 Ga0495580_0002417
570 Ga0495639_0051899
571 Ga0495662_0001738
572 Ga0495662_0085977
573 Ga0495664_0013231
574 Ga0495608_0002040
575 Ga0495608_0007604
576 Ga0495628_0029972
577 Ga0495630_0000003
578 Ga0495630_0002168
579 Ga0495630_0075298
580 Ga0495630_0089509
581 Ga0495652_0030638
582 Ga0495665_0055260
583 Ga0495640_0038983
584 Ga0495587_0025271
585 Ga0495587_0038813
586 Ga0495645_0001185
587 Ga0495645_0047950
588 Ga0495645_0112828
589 Ga0495645_0145923
590 Ga0495667_0023233
591 Ga0495634_0057897
592 Ga0495625_0002996
593 Ga0495635_0024348
594 Ga0495599_0011902
595 Ga0495599_0123156
596 Ga0495623_0014896
597 Ga0495623_0018990
598 Ga0495658_0034407
599 Ga0495613_0016322
600 Ga0495613_0060239
601 Ga0495613_0098590
602 Ga0495624_0026016
603 Ga0495600_0001808
604 Ga0495604_0089936
605 Ga0495604_0160298
606 Ga0495674_0004379
607 Ga0495674_0020622
608 Ga0495684_0003971
609 Ga0495684_0025976
610 Ga0495602_0027208
611 Ga0496104_0394729
612 Ga0496107_0032759
613 Ga0496111_0166107
614 Ga0496115_0094751
615 Ga0496118_0027454
616 Ga0496121_0037772
617 Ga0501034_0002032
618 Ga0501034_0002498
619 Ga0501034_0003263
620 Ga0501034_0009539
621 Ga0501034_0138882
622 Ga0501034_0254266
623 Ga0501046_0003763
624 Ga0501047_0020046
625 Ga0501047_0048240
626 Ga0501047_0174748
627 Ga0501047_0231491
628 Ga0501068_0088029
629 Ga0501070_0080408
630 Ga0501080_0004032
631 Ga0501080_0009356
632 nmdc:mga05p37_129728_c1
633 nmdc:mga05p37_1311_c1
634 nmdc:mga05p37_2277_c1
635 nmdc:mga05p37_42337_c1
636 nmdc:mga05p37_86872_c1
637 nmdc:mga09592_84386_c1
638 nmdc:mga06r32_120063_c1
639 nmdc:mga06r32_179142_c1
640 nmdc:mga06r32_193298_c1
641 nmdc:mga06r32_206413_c1
642 nmdc:mga06r32_242349_c1
643 nmdc:mga06r32_26273_c1
644 nmdc:mga06r32_351052_c1
645 nmdc:mga06r32_44580_c1
646 nmdc:mga06r32_54998_c1
647 nmdc:mga06r32_62788_c1
648 nmdc:mga06r32_85554_c1
649 nmdc:mga08y16_132209_c1
650 nmdc:mga08y16_178755_c1
651 nmdc:mga08y16_20073_c1
652 nmdc:mga08y16_23880_c1
653 nmdc:mga08y16_37357_c1
654 nmdc:mga08y16_39882_c1
655 nmdc:mga08y16_4523_c1
656 nmdc:mga0n895_144486_c1
657 nmdc:mga08x19_18535_c1
658 nmdc:mga08x19_4408_c1
659 nmdc:mga0a205_123835_c1
660 nmdc:mga0a205_150041_c1
661 nmdc:mga0a205_236093_c1
662 nmdc:mga0a205_8483_c2
663 nmdc:mga0a205_91820_c1
664 Ga0500568_0011713
665 Ga0501084_0007242
666 2673167658
667 2687234654
668 2687235379
669 2687236825
670 2688067136
671 2836165644
672 2920113623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

133

555

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zg9-assembly2.cif.gz_B structural basis for inhibition of human autotaxin by four novel compounds 0.6989 305 382
3wav-assembly1.cif.gz_A crystal structure of autotaxin in complex with compound 10 0.6987 300 382
4zg7-assembly1.cif.gz_A structural basis for inhibition of human autotaxin by four novel compounds 0.6972 305 382
6leh-assembly1.cif.gz_A crystal structure of autotaxin in complex with an inhibitor 0.6941 300 382
5ohi-assembly1.cif.gz_A crystal structure of autotaxin in complex with bi-2545 0.6921 300 382
ID Description Score Start End Superfamily
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7209 302 382 3.40.720.10
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6604 302 443 3.40.720.10
4b56B01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6529 297 455 3.40.720.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5997 49 442 3.40.720.10
1ejjA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5898 52 443 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A3M1M612-F1-model_v4 DUF1501 domain-containing protein 0.9734 134 472
AF-A0A225DNH9-F1-model_v4 Sulfatase 0.973 351 472
AF-A0A3B8KYX2-F1-model_v4 DUF1501 domain-containing protein 0.9727 358 472
AF-A0A3M1M612-F1-model_v4 DUF1501 domain-containing protein 0.9705 134 472
AF-A0A353Z806-F1-model_v4 DUF1501 domain-containing protein 0.9663 347 472

Map