F412926

General Info

Members Datasets Scaffolds Average Seq Length
337 190 674 100

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100231711|Ga0070683_1002317112
Length 104
Sequence MGESVQEFFRNLEARADPAKTAGMTNSYVFDIDGAGQWKVDVDDGKVAVTEGDAGGDADAVISASEETFEKIVAGEQNPTSAYMTGKLKVKGDMGAAMKLQKLF

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
106 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
110 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
111 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 9.79
Rhizosphere 87.54
Stem 0
Stem Tuber 0
Unclassified 15.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100231711 3300005329 Bacteria 1756
2 JGI25407J50210_10004674 3300003373 Bacteria 3338
3 JGI25407J50210_10074081 3300003373 Unclassified 849
4 Ga0070658_10533557 3300005327 Bacteria 1015
5 Ga0070680_100012054 3300005336 Bacteria 6710
6 Ga0070680_100112895 3300005336 Bacteria 2263
7 Ga0070682_100020316 3300005337 Bacteria 3907
8 Ga0070660_100016173 3300005339 Bacteria 5410
9 Ga0070660_101031979 3300005339 Bacteria 695
10 Ga0070661_100830721 3300005344 Bacteria 759
11 Ga0070659_100036725 3300005366 Bacteria 3820
12 Ga0070659_101967285 3300005366 Bacteria 525
13 Ga0070709_10102517 3300005434 Unclassified 1909
14 Ga0070713_100246728 3300005436 Bacteria 1627
15 Ga0070711_100092458 3300005439 Bacteria 2183
16 Ga0070705_101022051 3300005440 Bacteria 672
17 Ga0070708_100826543 3300005445 Bacteria 871
18 Ga0070681_10132557 3300005458 Bacteria 2424
19 Ga0070681_10726314 3300005458 Bacteria 909
20 Ga0070681_11988614 3300005458 Unclassified 509
21 Ga0070706_100511711 3300005467 Unclassified 1117
22 Ga0070698_100102954 3300005471 Bacteria 2825
23 Ga0070679_100072507 3300005530 Bacteria 3435
24 Ga0070679_100076583 3300005530 Bacteria 3334
25 Ga0070679_102133797 3300005530 Bacteria 510
26 Ga0070697_100780058 3300005536 Bacteria 845
27 Ga0070696_100103626 3300005546 Bacteria 2042
28 Ga0070696_101216000 3300005546 Unclassified 637
29 Ga0070693_100211697 3300005547 Bacteria 1265
30 Ga0070693_100601829 3300005547 Bacteria 794
31 Ga0068856_100169382 3300005614 Bacteria 2196
32 Ga0070702_100264803 3300005615 Unclassified 1172
33 Ga0068852_100090627 3300005616 Bacteria 2734
34 Ga0081455_10006181 3300005937 Bacteria 12915
35 Ga0081455_10017233 3300005937 Bacteria 6934
36 Ga0081455_10482862 3300005937 Bacteria 837
37 Ga0081455_10972816 3300005937 Bacteria 526
38 Ga0081538_10000651 3300005981 Bacteria 38466
39 Ga0081538_10017955 3300005981 Bacteria 5341
40 Ga0081538_10020158 3300005981 Bacteria 4924
41 Ga0081538_10175762 3300005981 Bacteria 925
42 Ga0081539_10045941 3300005985 Bacteria 2506
43 Ga0070717_10041047 3300006028 Bacteria 3771
44 Ga0070717_10226430 3300006028 Unclassified 1645
45 Ga0075365_10006072 3300006038 Bacteria 6599
46 Ga0075364_10099274 3300006051 Unclassified 1938
47 Ga0075432_10028078 3300006058 Bacteria 1940
48 Ga0070716_100291450 3300006173 Unclassified 1131
49 Ga0070716_100799984 3300006173 Bacteria 730
50 Ga0070712_100008220 3300006175 Bacteria 6554
51 Ga0070712_100095027 3300006175 Unclassified 2192
52 Ga0075362_10082684 3300006177 Bacteria 1482
53 Ga0075427_10015851 3300006194 Bacteria 1166
54 Ga0075428_100219870 3300006844 Unclassified 2051
55 Ga0075428_100352258 3300006844 Bacteria 1580
56 Ga0075430_100095375 3300006846 Bacteria 2486
57 Ga0075430_100230553 3300006846 Bacteria 1535
58 Ga0075431_100029011 3300006847 Bacteria 5691
59 Ga0075431_100726739 3300006847 Unclassified 969
60 Ga0075433_10203052 3300006852 Bacteria 1762
61 Ga0075433_11001996 3300006852 Unclassified 728
62 Ga0075434_100601843 3300006871 Unclassified 1118
63 Ga0105240_12276244 3300009093 Unclassified 561
64 Ga0111539_10015728 3300009094 Bacteria 9401
65 Ga0111539_10299214 3300009094 Unclassified 1873
66 Ga0105245_10669230 3300009098 Unclassified 1069
67 Ga0114129_10099557 3300009147 Bacteria 4024
68 Ga0114129_10456095 3300009147 Bacteria 1676
69 Ga0105242_10855630 3300009176 Bacteria 905
70 Ga0105249_12171852 3300009553 Bacteria 628
71 Ga0157324_1039958 3300012506 Bacteria 570
72 Ga0157370_10385435 3300013104 Bacteria 1291
73 Ga0157374_12506698 3300013296 Bacteria 543
74 Ga0157372_10553986 3300013307 Bacteria 1340
75 Ga0182008_10097550 3300014497 Bacteria 1451
76 Ga0182006_1103201 3300015261 Bacteria 1010
77 Ga0206354_11178367 3300020081 Bacteria 1350
78 Ga0206353_10659483 3300020082 Bacteria 2802
79 Ga0206353_10885169 3300020082 Unclassified 543
80 Ga0207699_10343897 3300025906 Bacteria 1051
81 Ga0207705_10749201 3300025909 Bacteria 759
82 Ga0207707_10170151 3300025912 Bacteria 1904
83 Ga0207707_10541538 3300025912 Bacteria 990
84 Ga0207707_10598171 3300025912 Unclassified 934
85 Ga0207693_10013575 3300025915 Bacteria 6565
86 Ga0207693_10506076 3300025915 Bacteria 943
87 Ga0207660_10161160 3300025917 Bacteria 1731
88 Ga0207660_10300749 3300025917 Bacteria 1277
89 Ga0207657_10005076 3300025919 Bacteria 13809
90 Ga0207652_10402442 3300025921 Bacteria 1235
91 Ga0207652_10733359 3300025921 Bacteria 880
92 Ga0207646_10633278 3300025922 Bacteria 959
93 Ga0207694_10976459 3300025924 Bacteria 717
94 Ga0207687_10752218 3300025927 Bacteria 829
95 Ga0207700_10242868 3300025928 Bacteria 1536
96 Ga0207690_10481835 3300025932 Bacteria 1001
97 Ga0207690_11653387 3300025932 Bacteria 535
98 Ga0207686_10993524 3300025934 Bacteria 681
99 Ga0207665_10166370 3300025939 Bacteria 1590
100 Ga0207711_11396202 3300025941 Bacteria 643
101 Ga0207661_10375483 3300025944 Bacteria 1286
102 Ga0207640_10293004 3300025981 Bacteria 1284
103 Ga0207698_10111619 3300026142 Bacteria 2293
104 Ga0207428_10020889 3300027907 Bacteria 5551
105 Ga0207428_10044308 3300027907 Bacteria 3590
106 Ga0265337_1133277 3300028556 Unclassified 673
107 Ga0265319_1009613 3300028563 Bacteria 4103
108 Ga0265319_1209951 3300028563 Bacteria 596
109 Ga0265334_10008902 3300028573 Bacteria 4259
110 Ga0265318_10000400 3300028577 Bacteria 33867
111 Ga0265318_10101606 3300028577 Bacteria 1058
112 Ga0265323_10121478 3300028653 Unclassified 851
113 Ga0265322_10003775 3300028654 Bacteria 4553
114 Ga0265336_10040244 3300028666 Bacteria 1431
115 Ga0265336_10056850 3300028666 Unclassified 1175
116 Ga0265338_10004790 3300028800 Bacteria 18080
117 Ga0265338_10007252 3300028800 Bacteria 13838
118 Ga0265338_10181010 3300028800 Bacteria 1607
119 Ga0265338_10925902 3300028800 Bacteria 592
120 Ga0265330_10005800 3300031235 Bacteria 6129
121 Ga0265330_10035109 3300031235 Bacteria 2239
122 Ga0265332_10001216 3300031238 Bacteria 14908
123 Ga0265332_10033337 3300031238 Bacteria 2242
124 Ga0265328_10068110 3300031239 Bacteria 1307
125 Ga0265328_10106736 3300031239 Bacteria 1039
126 Ga0265320_10022511 3300031240 Bacteria 3369
127 Ga0265325_10003479 3300031241 Bacteria 10265
128 Ga0265325_10034897 3300031241 Bacteria 2673
129 Ga0265329_10002550 3300031242 Bacteria 8219
130 Ga0265340_10003891 3300031247 Bacteria 8414
131 Ga0265339_10029240 3300031249 Bacteria 3127
132 Ga0265339_10043901 3300031249 Bacteria 2468
133 Ga0265339_10189765 3300031249 Bacteria 1019
134 Ga0265331_10004229 3300031250 Bacteria 8989
135 Ga0265331_10043195 3300031250 Bacteria 2184
136 Ga0265327_10014245 3300031251 Bacteria 5211
137 Ga0265316_10008149 3300031344 Bacteria 9750
138 Ga0265316_10041457 3300031344 Bacteria 3684
139 Ga0265316_10144566 3300031344 Bacteria 1784
140 Ga0307408_100107425 3300031548 Bacteria 2137
141 Ga0307408_100181348 3300031548 Bacteria 1689
142 Ga0265313_10011083 3300031595 Bacteria 5623
143 Ga0265313_10034315 3300031595 Bacteria 2567
144 Ga0265314_10011708 3300031711 Bacteria 7216
145 Ga0265314_10017676 3300031711 Bacteria 5588
146 Ga0265314_10087712 3300031711 Bacteria 2034
147 Ga0265342_10010721 3300031712 Bacteria 6329
148 Ga0265342_10032331 3300031712 Bacteria 3227
149 Ga0265342_10382627 3300031712 Bacteria 729
150 Ga0307406_10850735 3300031901 Bacteria 773
151 Ga0307416_100563505 3300032002 Bacteria 1214
152 Ga0307415_100993769 3300032126 Bacteria 779
153 Ga0307415_101068544 3300032126 Bacteria 754
154 Ga0373924_0538405 3300035410 Unclassified 525
155 Ga0395899_0018006 3300037312 Bacteria 5375
156 Ga0395899_0085753 3300037312 Bacteria 2288
157 Ga0395899_0151174 3300037312 Bacteria 1645
158 Ga0395899_0164927 3300037312 Bacteria 1563
159 Ga0395899_0255622 3300037312 Bacteria 1200
160 Ga0395899_0363618 3300037312 Bacteria 965
161 Ga0395900_0094353 3300037418 Bacteria 3073
162 Ga0395900_0108566 3300037418 Bacteria 2851
163 Ga0395900_0114740 3300037418 Bacteria 2764
164 Ga0395900_0205620 3300037418 Bacteria 1990
165 Ga0395900_0248731 3300037418 Bacteria 1780
166 Ga0395900_0271446 3300037418 Bacteria 1690
167 Ga0395900_0341993 3300037418 Bacteria 1471
168 Ga0395900_0454594 3300037418 Unclassified 1236
169 Ga0395900_1014482 3300037418 Bacteria 749
170 Ga0395900_1095608 3300037418 Unclassified 714
171 Ga0395900_1299262 3300037418 Bacteria 641
172 Ga0395898_0012640 3300037466 Bacteria 8727
173 Ga0395898_0028500 3300037466 Bacteria 5594
174 Ga0395898_0041906 3300037466 Bacteria 4519
175 Ga0395898_0083178 3300037466 Bacteria 3085
176 Ga0395898_0201943 3300037466 Bacteria 1897
177 Ga0395898_0636523 3300037466 Bacteria 1009
178 Ga0395905_0022577 3300037471 Bacteria 5950
179 Ga0395905_0041027 3300037471 Bacteria 4342
180 Ga0395905_0494075 3300037471 Bacteria 1123
181 Ga0395905_1208818 3300037471 Bacteria 659
182 Ga0395905_1365914 3300037471 Bacteria 612
183 Ga0395901_0006349 3300038443 Bacteria 11975
184 Ga0395901_0012466 3300038443 Bacteria 8628
185 Ga0395901_0244777 3300038443 Bacteria 1869
186 Ga0395901_0358191 3300038443 Bacteria 1505
187 Ga0395901_0396842 3300038443 Bacteria 1417
188 Ga0395901_0897432 3300038443 Unclassified 868
189 Ga0395901_0897737 3300038443 Bacteria 868
190 Ga0395901_1216290 3300038443 Bacteria 718
191 Ga0439453_0132229 3300041408 Unclassified 580
192 Ga0451789_1349803 3300041443 Bacteria 573
193 Ga0451849_0412168 3300041505 Bacteria 619
194 Ga0451853_0868894 3300041512 Bacteria 829
195 Ga0439454_006967 3300042011 Bacteria 1407
196 Ga0450920_017968 3300042122 Bacteria 1353
197 Ga0450907_040785 3300042146 Bacteria 795
198 Ga0439464_0046169 3300042439 Unclassified 1252
199 Ga0439460_0038347 3300042461 Bacteria 1397
200 Ga0439460_0105777 3300042461 Unclassified 908
201 Ga0450918_004509 3300042531 Bacteria 2534
202 Ga0466966_0003846 3300044684 Bacteria 9911
203 Ga0466961_0308574 3300044693 Bacteria 966
204 Ga0466961_0548658 3300044693 Unclassified 696
205 Ga0466963_0001711 3300044694 Bacteria 11944
206 Ga0466964_0091373 3300044706 Bacteria 1325
207 Ga0466968_0511938 3300044735 Bacteria 599
208 Ga0466960_0946578 3300044901 Unclassified 527
209 Ga0466959_0002927 3300045049 Bacteria 11011
210 Ga0466967_0000095 3300045976 Bacteria 31561
211 Ga0466967_0023464 3300045976 Bacteria 5055
212 Ga0466967_0049268 3300045976 Bacteria 3683
213 Ga0466967_0295092 3300045976 Bacteria 1558
214 Ga0466967_0300454 3300045976 Bacteria 1544
215 Ga0466967_0360409 3300045976 Bacteria 1409
216 Ga0466967_1761362 3300045976 Bacteria 617
217 Ga0495592_0416656 3300046454 Unclassified 848
218 Ga0495653_0665479 3300046463 Bacteria 635
219 Ga0495630_0846123 3300046517 Bacteria 698
220 Ga0495652_0316563 3300046529 Bacteria 1129
221 Ga0495667_0462351 3300046559 Bacteria 797
222 Ga0495680_0696009 3300047322 Unclassified 672
223 Ga0496100_0077185 3300048903 Bacteria 2239
224 Ga0496100_0526822 3300048903 Bacteria 912
225 Ga0496100_1603193 3300048903 Bacteria 514
226 Ga0496101_0203784 3300048904 Unclassified 1530
227 Ga0496102_0015884 3300048905 Bacteria 6567
228 Ga0496102_0233184 3300048905 Unclassified 1735
229 Ga0496103_0790534 3300048906 Archaea 599
230 Ga0496104_0009591 3300048907 Bacteria 8618
231 Ga0496104_0423968 3300048907 Unclassified 1242
232 Ga0496105_0005632 3300048908 Bacteria 9529
233 Ga0496106_0778124 3300048909 Bacteria 760
234 Ga0496107_0154942 3300048910 Bacteria 1696
235 Ga0496107_0657404 3300048910 Bacteria 772
236 Ga0496107_0992618 3300048910 Unclassified 609
237 Ga0496108_0013755 3300048911 Bacteria 6601
238 Ga0496108_0142725 3300048911 Unclassified 2063
239 Ga0496108_0589296 3300048911 Unclassified 969
240 Ga0496109_0010701 3300048912 Bacteria 7849
241 Ga0496109_0490620 3300048912 Bacteria 1159
242 Ga0496109_0643144 3300048912 Bacteria 997
243 Ga0496111_0012754 3300048914 Bacteria 5699
244 Ga0496111_0397641 3300048914 Bacteria 1018
245 Ga0496112_0010028 3300048915 Bacteria 8575
246 Ga0496112_0035457 3300048915 Bacteria 4860
247 Ga0496112_0433201 3300048915 Bacteria 1253
248 Ga0496112_1566693 3300048915 Unclassified 572
249 Ga0496113_0149537 3300048916 Unclassified 1841
250 Ga0496113_0927980 3300048916 Unclassified 688
251 Ga0496114_0082244 3300048917 Bacteria 2722
252 Ga0496114_0157544 3300048917 Unclassified 1972
253 Ga0496114_1035647 3300048917 Unclassified 704
254 Ga0496115_0019315 3300048918 Bacteria 5243
255 Ga0501031_0009822 3300049568 Bacteria 6230
256 Ga0501031_0630448 3300049568 Bacteria 689
257 Ga0501032_0041117 3300049569 Bacteria 3141
258 Ga0501033_0005434 3300049570 Bacteria 10096
259 Ga0501036_0036970 3300049572 Bacteria 4130
260 Ga0501036_0174401 3300049572 Bacteria 1811
261 Ga0501036_0724634 3300049572 Unclassified 821
262 Ga0501037_0965194 3300049573 Bacteria 556
263 Ga0501038_0003737 3300049574 Bacteria 14178
264 Ga0501038_0356744 3300049574 Bacteria 1138
265 Ga0501039_0014193 3300049575 Bacteria 6100
266 Ga0501039_0187258 3300049575 Bacteria 1628
267 Ga0501040_0045686 3300049576 Bacteria 2988
268 Ga0501040_0093323 3300049576 Bacteria 2093
269 Ga0501040_0484926 3300049576 Bacteria 891
270 Ga0501041_0057943 3300049577 Bacteria 2369
271 Ga0501041_0101935 3300049577 Bacteria 1778
272 Ga0501042_0010853 3300049578 Bacteria 6127
273 Ga0501042_0049980 3300049578 Bacteria 2983
274 Ga0501042_0781413 3300049578 Bacteria 695
275 Ga0501043_0007479 3300049579 Bacteria 8675
276 Ga0501046_0022302 3300049580 Bacteria 5216
277 Ga0501047_0070190 3300049581 Bacteria 3373
278 Ga0501048_0056158 3300049582 Bacteria 2793
279 Ga0501048_0164242 3300049582 Bacteria 1572
280 Ga0501048_0915492 3300049582 Bacteria 631
281 Ga0501067_0242127 3300049583 Bacteria 1004
282 Ga0501067_0504861 3300049583 Bacteria 677
283 Ga0501068_0004865 3300049584 Bacteria 7312
284 Ga0501069_0012556 3300049585 Bacteria 4504
285 Ga0501070_0007003 3300049586 Bacteria 9593
286 Ga0501071_0011168 3300049587 Bacteria 6040
287 Ga0501072_0071109 3300049588 Bacteria 2749
288 Ga0501072_0110742 3300049588 Bacteria 2185
289 Ga0501072_0323162 3300049588 Unclassified 1226
290 Ga0501072_0370601 3300049588 Bacteria 1137
291 Ga0501073_0029499 3300049589 Bacteria 3919
292 Ga0501074_0021401 3300049590 Bacteria 4695
293 Ga0501075_0030468 3300049591 Bacteria 3996
294 Ga0501075_0479227 3300049591 Bacteria 949
295 Ga0501076_0031688 3300049592 Bacteria 4125
296 Ga0501076_0057144 3300049592 Bacteria 3098
297 Ga0501076_0084214 3300049592 Bacteria 2554
298 Ga0501077_0268338 3300049593 Bacteria 1085
299 Ga0501077_0679018 3300049593 Bacteria 662
300 Ga0501079_0213509 3300049741 Bacteria 1507
301 Ga0501079_0243695 3300049741 Bacteria 1405
302 Ga0501079_0312580 3300049741 Bacteria 1229
303 Ga0501079_0762302 3300049741 Bacteria 762
304 Ga0501080_0009930 3300049742 Bacteria 8698
305 Ga0501081_0220723 3300049743 Bacteria 1378
306 Ga0501083_0012424 3300049744 Bacteria 5957
307 Ga0501083_0097512 3300049744 Bacteria 1940
308 Ga0501035_0264558 3300049822 Bacteria 1457
309 Ga0501035_0359816 3300049822 Bacteria 1216
310 Ga0501044_0017178 3300049823 Bacteria 7763
311 Ga0501045_0025365 3300049824 Bacteria 4261
312 Ga0501045_0118920 3300049824 Bacteria 1961
313 nmdc:mga03683_503445_c1 3300050489 Bacteria 587
314 nmdc:mga00v17_57344_c1 3300050491 Unclassified 2383
315 nmdc:mga0yw44_105493_c1 3300050492 Unclassified 1800
316 nmdc:mga05p37_1015129_c1 3300050507 Bacteria 879
317 nmdc:mga05p37_1447637_c1 3300050507 Bacteria 688
318 nmdc:mga05p37_347857_c1 3300050507 Unclassified 1746
319 nmdc:mga05p37_382837_c1 3300050507 Bacteria 1648
320 nmdc:mga09592_215989_c1 3300050508 Bacteria 1662
321 nmdc:mga09592_232877_c1 3300050508 Bacteria 1596
322 nmdc:mga0qj67_133900_c1 3300050509 Bacteria 2008
323 nmdc:mga0qj67_373869_c1 3300050509 Bacteria 1151
324 nmdc:mga06r32_18202_c1 3300050510 Bacteria 6428
325 nmdc:mga08y16_178869_c1 3300050511 Bacteria 2203
326 nmdc:mga08y16_265661_c1 3300050511 Bacteria 1772
327 nmdc:mga0n895_570803_c1 3300050512 Unclassified 1136
328 nmdc:mga0rr50_1126924_c1 3300050513 Bacteria 667
329 nmdc:mga0a205_300933_c1 3300050515 Bacteria 1477
330 Ga0500641_0443895 3300053096 Bacteria 501
331 Ga0501084_0121559 3300054114 Bacteria 2195
332 Ga0501082_0129920 3300060353 Bacteria 2185
333 Ga0501082_0743358 3300060353 Unclassified 858
334 Ga0501082_0828078 3300060353 Bacteria 810
335 Ga0501082_1475408 3300060353 Unclassified 594
336 Ga0530510_0042803 3300061734 Bacteria 3271
337 Ga0530510_1243955 3300061734 Unclassified 571
338 Ga0070683_100231711
339 JGI25407J50210_10004674
340 JGI25407J50210_10074081
341 Ga0070658_10533557
342 Ga0070680_100012054
343 Ga0070680_100112895
344 Ga0070682_100020316
345 Ga0070660_100016173
346 Ga0070660_101031979
347 Ga0070661_100830721
348 Ga0070659_100036725
349 Ga0070659_101967285
350 Ga0070709_10102517
351 Ga0070713_100246728
352 Ga0070711_100092458
353 Ga0070705_101022051
354 Ga0070708_100826543
355 Ga0070681_10132557
356 Ga0070681_10726314
357 Ga0070681_11988614
358 Ga0070706_100511711
359 Ga0070698_100102954
360 Ga0070679_100072507
361 Ga0070679_100076583
362 Ga0070679_102133797
363 Ga0070697_100780058
364 Ga0070696_100103626
365 Ga0070696_101216000
366 Ga0070693_100211697
367 Ga0070693_100601829
368 Ga0068856_100169382
369 Ga0070702_100264803
370 Ga0068852_100090627
371 Ga0081455_10006181
372 Ga0081455_10017233
373 Ga0081455_10482862
374 Ga0081455_10972816
375 Ga0081538_10000651
376 Ga0081538_10017955
377 Ga0081538_10020158
378 Ga0081538_10175762
379 Ga0081539_10045941
380 Ga0070717_10041047
381 Ga0070717_10226430
382 Ga0075365_10006072
383 Ga0075364_10099274
384 Ga0075432_10028078
385 Ga0070716_100291450
386 Ga0070716_100799984
387 Ga0070712_100008220
388 Ga0070712_100095027
389 Ga0075362_10082684
390 Ga0075427_10015851
391 Ga0075428_100219870
392 Ga0075428_100352258
393 Ga0075430_100095375
394 Ga0075430_100230553
395 Ga0075431_100029011
396 Ga0075431_100726739
397 Ga0075433_10203052
398 Ga0075433_11001996
399 Ga0075434_100601843
400 Ga0105240_12276244
401 Ga0111539_10015728
402 Ga0111539_10299214
403 Ga0105245_10669230
404 Ga0114129_10099557
405 Ga0114129_10456095
406 Ga0105242_10855630
407 Ga0105249_12171852
408 Ga0157324_1039958
409 Ga0157370_10385435
410 Ga0157374_12506698
411 Ga0157372_10553986
412 Ga0182008_10097550
413 Ga0182006_1103201
414 Ga0206354_11178367
415 Ga0206353_10659483
416 Ga0206353_10885169
417 Ga0207699_10343897
418 Ga0207705_10749201
419 Ga0207707_10170151
420 Ga0207707_10541538
421 Ga0207707_10598171
422 Ga0207693_10013575
423 Ga0207693_10506076
424 Ga0207660_10161160
425 Ga0207660_10300749
426 Ga0207657_10005076
427 Ga0207652_10402442
428 Ga0207652_10733359
429 Ga0207646_10633278
430 Ga0207694_10976459
431 Ga0207687_10752218
432 Ga0207700_10242868
433 Ga0207690_10481835
434 Ga0207690_11653387
435 Ga0207686_10993524
436 Ga0207665_10166370
437 Ga0207711_11396202
438 Ga0207661_10375483
439 Ga0207640_10293004
440 Ga0207698_10111619
441 Ga0207428_10020889
442 Ga0207428_10044308
443 Ga0265337_1133277
444 Ga0265319_1009613
445 Ga0265319_1209951
446 Ga0265334_10008902
447 Ga0265318_10000400
448 Ga0265318_10101606
449 Ga0265323_10121478
450 Ga0265322_10003775
451 Ga0265336_10040244
452 Ga0265336_10056850
453 Ga0265338_10004790
454 Ga0265338_10007252
455 Ga0265338_10181010
456 Ga0265338_10925902
457 Ga0265330_10005800
458 Ga0265330_10035109
459 Ga0265332_10001216
460 Ga0265332_10033337
461 Ga0265328_10068110
462 Ga0265328_10106736
463 Ga0265320_10022511
464 Ga0265325_10003479
465 Ga0265325_10034897
466 Ga0265329_10002550
467 Ga0265340_10003891
468 Ga0265339_10029240
469 Ga0265339_10043901
470 Ga0265339_10189765
471 Ga0265331_10004229
472 Ga0265331_10043195
473 Ga0265327_10014245
474 Ga0265316_10008149
475 Ga0265316_10041457
476 Ga0265316_10144566
477 Ga0307408_100107425
478 Ga0307408_100181348
479 Ga0265313_10011083
480 Ga0265313_10034315
481 Ga0265314_10011708
482 Ga0265314_10017676
483 Ga0265314_10087712
484 Ga0265342_10010721
485 Ga0265342_10032331
486 Ga0265342_10382627
487 Ga0307406_10850735
488 Ga0307416_100563505
489 Ga0307415_100993769
490 Ga0307415_101068544
491 Ga0373924_0538405
492 Ga0395899_0018006
493 Ga0395899_0085753
494 Ga0395899_0151174
495 Ga0395899_0164927
496 Ga0395899_0255622
497 Ga0395899_0363618
498 Ga0395900_0094353
499 Ga0395900_0108566
500 Ga0395900_0114740
501 Ga0395900_0205620
502 Ga0395900_0248731
503 Ga0395900_0271446
504 Ga0395900_0341993
505 Ga0395900_0454594
506 Ga0395900_1014482
507 Ga0395900_1095608
508 Ga0395900_1299262
509 Ga0395898_0012640
510 Ga0395898_0028500
511 Ga0395898_0041906
512 Ga0395898_0083178
513 Ga0395898_0201943
514 Ga0395898_0636523
515 Ga0395905_0022577
516 Ga0395905_0041027
517 Ga0395905_0494075
518 Ga0395905_1208818
519 Ga0395905_1365914
520 Ga0395901_0006349
521 Ga0395901_0012466
522 Ga0395901_0244777
523 Ga0395901_0358191
524 Ga0395901_0396842
525 Ga0395901_0897432
526 Ga0395901_0897737
527 Ga0395901_1216290
528 Ga0439453_0132229
529 Ga0451789_1349803
530 Ga0451849_0412168
531 Ga0451853_0868894
532 Ga0439454_006967
533 Ga0450920_017968
534 Ga0450907_040785
535 Ga0439464_0046169
536 Ga0439460_0038347
537 Ga0439460_0105777
538 Ga0450918_004509
539 Ga0466966_0003846
540 Ga0466961_0308574
541 Ga0466961_0548658
542 Ga0466963_0001711
543 Ga0466964_0091373
544 Ga0466968_0511938
545 Ga0466960_0946578
546 Ga0466959_0002927
547 Ga0466967_0000095
548 Ga0466967_0023464
549 Ga0466967_0049268
550 Ga0466967_0295092
551 Ga0466967_0300454
552 Ga0466967_0360409
553 Ga0466967_1761362
554 Ga0495592_0416656
555 Ga0495653_0665479
556 Ga0495630_0846123
557 Ga0495652_0316563
558 Ga0495667_0462351
559 Ga0495680_0696009
560 Ga0496100_0077185
561 Ga0496100_0526822
562 Ga0496100_1603193
563 Ga0496101_0203784
564 Ga0496102_0015884
565 Ga0496102_0233184
566 Ga0496103_0790534
567 Ga0496104_0009591
568 Ga0496104_0423968
569 Ga0496105_0005632
570 Ga0496106_0778124
571 Ga0496107_0154942
572 Ga0496107_0657404
573 Ga0496107_0992618
574 Ga0496108_0013755
575 Ga0496108_0142725
576 Ga0496108_0589296
577 Ga0496109_0010701
578 Ga0496109_0490620
579 Ga0496109_0643144
580 Ga0496111_0012754
581 Ga0496111_0397641
582 Ga0496112_0010028
583 Ga0496112_0035457
584 Ga0496112_0433201
585 Ga0496112_1566693
586 Ga0496113_0149537
587 Ga0496113_0927980
588 Ga0496114_0082244
589 Ga0496114_0157544
590 Ga0496114_1035647
591 Ga0496115_0019315
592 Ga0501031_0009822
593 Ga0501031_0630448
594 Ga0501032_0041117
595 Ga0501033_0005434
596 Ga0501036_0036970
597 Ga0501036_0174401
598 Ga0501036_0724634
599 Ga0501037_0965194
600 Ga0501038_0003737
601 Ga0501038_0356744
602 Ga0501039_0014193
603 Ga0501039_0187258
604 Ga0501040_0045686
605 Ga0501040_0093323
606 Ga0501040_0484926
607 Ga0501041_0057943
608 Ga0501041_0101935
609 Ga0501042_0010853
610 Ga0501042_0049980
611 Ga0501042_0781413
612 Ga0501043_0007479
613 Ga0501046_0022302
614 Ga0501047_0070190
615 Ga0501048_0056158
616 Ga0501048_0164242
617 Ga0501048_0915492
618 Ga0501067_0242127
619 Ga0501067_0504861
620 Ga0501068_0004865
621 Ga0501069_0012556
622 Ga0501070_0007003
623 Ga0501071_0011168
624 Ga0501072_0071109
625 Ga0501072_0110742
626 Ga0501072_0323162
627 Ga0501072_0370601
628 Ga0501073_0029499
629 Ga0501074_0021401
630 Ga0501075_0030468
631 Ga0501075_0479227
632 Ga0501076_0031688
633 Ga0501076_0057144
634 Ga0501076_0084214
635 Ga0501077_0268338
636 Ga0501077_0679018
637 Ga0501079_0213509
638 Ga0501079_0243695
639 Ga0501079_0312580
640 Ga0501079_0762302
641 Ga0501080_0009930
642 Ga0501081_0220723
643 Ga0501083_0012424
644 Ga0501083_0097512
645 Ga0501035_0264558
646 Ga0501035_0359816
647 Ga0501044_0017178
648 Ga0501045_0025365
649 Ga0501045_0118920
650 nmdc:mga03683_503445_c1
651 nmdc:mga00v17_57344_c1
652 nmdc:mga0yw44_105493_c1
653 nmdc:mga05p37_1015129_c1
654 nmdc:mga05p37_1447637_c1
655 nmdc:mga05p37_347857_c1
656 nmdc:mga05p37_382837_c1
657 nmdc:mga09592_215989_c1
658 nmdc:mga09592_232877_c1
659 nmdc:mga0qj67_133900_c1
660 nmdc:mga0qj67_373869_c1
661 nmdc:mga06r32_18202_c1
662 nmdc:mga08y16_178869_c1
663 nmdc:mga08y16_265661_c1
664 nmdc:mga0n895_570803_c1
665 nmdc:mga0rr50_1126924_c1
666 nmdc:mga0a205_300933_c1
667 Ga0500641_0443895
668 Ga0501084_0121559
669 Ga0501082_0129920
670 Ga0501082_0743358
671 Ga0501082_0828078
672 Ga0501082_1475408
673 Ga0530510_0042803
674 Ga0530510_1243955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14864

Alkyl_sulf_C

Alkyl sulfatase C-terminal

2

104

0.91

PF02036

SCP2

SCP-2 sterol transfer family

5

104

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c44-assembly1.cif.gz_A sterol carrier protein 2 (scp2) from rabbit 0.8825 5 101
4av7-assembly3.cif.gz_F structure determination of the double mutant s233y f250g from the sec- alkyl sulfatase pisa1 0.861 4 102
2yhe-assembly3.cif.gz_C structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp. 0.8557 7 101
2cg2-assembly1.cif.gz_A-2 crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with sulfate 0.8533 8 102
2cfz-assembly1.cif.gz_A-2 crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with 1-dodecanol 0.8469 8 102
ID Description Score Start End Superfamily
af_Q7KPQ9_334_441_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8704 6 101 3.30.1050.10
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8625 27 101 3.30.1050.10
af_Q08347_515_642_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8588 5 102 3.30.1050.10
af_Q9VB10_297_412_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8582 7 101 3.30.1050.10
2yheA03 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.858 7 101 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A7V9I600-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9849 17 102 GO:0005829
AF-A0A7W0N2H3-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9826 6 102 GO:0005829
AF-A0A7W1N4I3-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9718 6 102 GO:0005829
AF-A0A7Z9HTR3-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9708 4 99 GO:0005829
AF-A0A7W0P806-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9699 4 102 GO:0005829

Map