F412836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 336 | 226 | 672 | 461 |
Family's Representative Sequence
| Representative Sequence | 3300049573|Ga0501037_0065141|Ga0501037_0065141_683_2377 |
| Length | 528 |
| Sequence | MRYSVSTQDEFDLRDVLARRGPERYDLQASYLNPQLPRMLHAIGFDRIYTRAEGAYLYDDAGHDYLDMLSGFGVFALGRHHPVVRQAVHDALDLGLADLTQFDAPPLAGALAERLLAHVPHLDRVYFGNSGTEAVEAALKYARFATGRKRIIFCDHAFHGLTAGSLSVNGARDFRKGFGPLLPDTAIPFGDLGALERELKRGDVAAFLIEPVQGKGVAVAPPGFLRAAHELLREHKALLIADEVQCGLGRTGDFFAFQHDGVEPDLVATAKALSGGYVPVGATMGRDWIFNKVYSSMDRVLVHDSTFGSNAQAMAAGLATLHVMEAEGVVDNARKMGELLQQRLADLVDRYELLHEVRGRGLMIGIEFGRPDTWKRRAPWAALQLARKGLFAQTVVHALFHRHRILTQVSGDHVEVIKLIPPLTIGEAEVDRFVAAFIDVMDEAHRGTPLTNSITRDFGRMLVRQARGPELGIAVRRRRVGTHREPEHRGRRAAEPGRVRHRADQAHRPAPHRHHQHLVTGPSLAPAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 115 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 120 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 121 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 122 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 123 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 134 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 135 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 195 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 196 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 219 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 220 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 221 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 222 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 223 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 224 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 225 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 226 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.32 |
| Metatranscriptomes | 0.3 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 9.52 |
| Rhizosphere | 85.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501037_0065141 | 3300049573 | Bacteria | 2655 |
| 2 | JGI25153J46596_10040772 | 3300003215 | Bacteria | 1436 |
| 3 | rootH2_10008205 | 3300003320 | Bacteria | 4044 |
| 4 | rootH1_10289385 | 3300003323 | Bacteria | 3183 |
| 5 | Ga0070683_100040034 | 3300005329 | Bacteria | 4306 |
| 6 | Ga0068869_100007942 | 3300005334 | Bacteria | 6817 |
| 7 | Ga0070666_10075154 | 3300005335 | Bacteria | 2304 |
| 8 | Ga0070682_100005523 | 3300005337 | Bacteria | 7038 |
| 9 | Ga0070660_100016167 | 3300005339 | Bacteria | 5410 |
| 10 | Ga0070689_100064051 | 3300005340 | Bacteria | 2861 |
| 11 | Ga0070691_10009595 | 3300005341 | Bacteria | 4417 |
| 12 | Ga0070687_100010638 | 3300005343 | Bacteria | 3990 |
| 13 | Ga0070668_100003489 | 3300005347 | Bacteria | 11592 |
| 14 | Ga0070669_100031096 | 3300005353 | Bacteria | 3855 |
| 15 | Ga0070674_100023308 | 3300005356 | Bacteria | 4004 |
| 16 | Ga0070673_100019493 | 3300005364 | Bacteria | 4870 |
| 17 | Ga0070659_100025152 | 3300005366 | Bacteria | 4570 |
| 18 | Ga0070709_10004553 | 3300005434 | Bacteria | 7487 |
| 19 | Ga0070714_100048886 | 3300005435 | Bacteria | 3599 |
| 20 | Ga0070714_100187933 | 3300005435 | Bacteria | 1883 |
| 21 | Ga0070713_100007081 | 3300005436 | Bacteria | 7840 |
| 22 | Ga0070713_100180150 | 3300005436 | Bacteria | 1898 |
| 23 | Ga0070710_10011258 | 3300005437 | Bacteria | 4418 |
| 24 | Ga0070711_100007616 | 3300005439 | Bacteria | 6590 |
| 25 | Ga0070711_100059605 | 3300005439 | Bacteria | 2651 |
| 26 | Ga0070711_100081832 | 3300005439 | Bacteria | 2302 |
| 27 | Ga0070705_100013089 | 3300005440 | Bacteria | 4234 |
| 28 | Ga0070694_100015797 | 3300005444 | Bacteria | 4748 |
| 29 | Ga0070708_100032408 | 3300005445 | Bacteria | 4533 |
| 30 | Ga0070663_100009920 | 3300005455 | Bacteria | 5917 |
| 31 | Ga0070662_100056363 | 3300005457 | Bacteria | 2853 |
| 32 | Ga0070685_10057158 | 3300005466 | Bacteria | 2270 |
| 33 | Ga0070698_100000958 | 3300005471 | Bacteria | 31586 |
| 34 | Ga0070679_100001302 | 3300005530 | Bacteria | 22036 |
| 35 | Ga0070679_100014459 | 3300005530 | Bacteria | 7580 |
| 36 | Ga0070684_100058242 | 3300005535 | Bacteria | 3376 |
| 37 | Ga0068853_100030865 | 3300005539 | Bacteria | 4528 |
| 38 | Ga0070686_100042515 | 3300005544 | Bacteria | 2847 |
| 39 | Ga0070695_100014353 | 3300005545 | Bacteria | 4774 |
| 40 | Ga0070696_100018250 | 3300005546 | Bacteria | 4740 |
| 41 | Ga0070693_100015943 | 3300005547 | Bacteria | 3880 |
| 42 | Ga0070665_100123458 | 3300005548 | Bacteria | 2592 |
| 43 | Ga0070704_100001417 | 3300005549 | Bacteria | 12795 |
| 44 | Ga0068857_100212457 | 3300005577 | Bacteria | 1766 |
| 45 | Ga0068854_100077828 | 3300005578 | Bacteria | 2441 |
| 46 | Ga0068852_100003545 | 3300005616 | Bacteria | 10917 |
| 47 | Ga0068852_100016511 | 3300005616 | Bacteria | 5761 |
| 48 | Ga0068859_100000488 | 3300005617 | Bacteria | 39249 |
| 49 | Ga0068864_100087851 | 3300005618 | Bacteria | 2737 |
| 50 | Ga0068861_100015703 | 3300005719 | Bacteria | 5343 |
| 51 | Ga0068863_100013541 | 3300005841 | Bacteria | 7868 |
| 52 | Ga0068863_100025519 | 3300005841 | Bacteria | 5634 |
| 53 | Ga0068858_100024327 | 3300005842 | Bacteria | 5643 |
| 54 | Ga0068860_100006769 | 3300005843 | Bacteria | 11495 |
| 55 | Ga0081540_1000961 | 3300005983 | Bacteria | 26017 |
| 56 | Ga0070717_10003177 | 3300006028 | Bacteria | 11736 |
| 57 | Ga0070717_10023500 | 3300006028 | Bacteria | 4886 |
| 58 | Ga0070717_10064503 | 3300006028 | Bacteria | 3042 |
| 59 | Ga0070715_10001540 | 3300006163 | Bacteria | 6747 |
| 60 | Ga0070716_100002203 | 3300006173 | Bacteria | 8979 |
| 61 | Ga0070712_100075095 | 3300006175 | Bacteria | 2430 |
| 62 | Ga0097621_100029174 | 3300006237 | Bacteria | 4355 |
| 63 | Ga0068871_100045097 | 3300006358 | Bacteria | 3547 |
| 64 | Ga0075433_10113606 | 3300006852 | Bacteria | 2402 |
| 65 | Ga0075434_100017609 | 3300006871 | Bacteria | 6886 |
| 66 | Ga0075436_100009307 | 3300006914 | Bacteria | 6719 |
| 67 | Ga0097620_100000488 | 3300006931 | Bacteria | 39249 |
| 68 | Ga0075435_100007080 | 3300007076 | Bacteria | 7963 |
| 69 | Ga0105245_10006294 | 3300009098 | Bacteria | 10451 |
| 70 | Ga0105245_10009629 | 3300009098 | Bacteria | 8428 |
| 71 | Ga0105247_10018292 | 3300009101 | Bacteria | 4204 |
| 72 | Ga0105247_10020004 | 3300009101 | Bacteria | 4023 |
| 73 | Ga0105243_10102010 | 3300009148 | Bacteria | 2383 |
| 74 | Ga0105241_10066324 | 3300009174 | Bacteria | 2791 |
| 75 | Ga0105241_10068986 | 3300009174 | Bacteria | 2741 |
| 76 | Ga0105248_10006486 | 3300009177 | Bacteria | 12831 |
| 77 | Ga0105237_10017374 | 3300009545 | Bacteria | 7458 |
| 78 | Ga0105238_10028104 | 3300009551 | Bacteria | 5730 |
| 79 | Ga0105238_10163728 | 3300009551 | Bacteria | 2200 |
| 80 | Ga0105249_10001272 | 3300009553 | Bacteria | 22114 |
| 81 | Ga0105239_10023503 | 3300010375 | Bacteria | 6789 |
| 82 | Ga0105239_10040999 | 3300010375 | Bacteria | 5074 |
| 83 | Ga0105239_10244146 | 3300010375 | Bacteria | 2016 |
| 84 | Ga0105246_10006105 | 3300011119 | Bacteria | 7353 |
| 85 | Ga0157371_10022927 | 3300013102 | Bacteria | 4566 |
| 86 | Ga0157370_10010551 | 3300013104 | Bacteria | 9729 |
| 87 | Ga0157369_10047289 | 3300013105 | Bacteria | 4673 |
| 88 | Ga0157374_10029165 | 3300013296 | Bacteria | 4993 |
| 89 | Ga0157374_10196903 | 3300013296 | Bacteria | 1972 |
| 90 | Ga0157378_10124016 | 3300013297 | Bacteria | 2384 |
| 91 | Ga0157372_10015213 | 3300013307 | Bacteria | 8240 |
| 92 | Ga0157372_10191654 | 3300013307 | Bacteria | 2368 |
| 93 | Ga0163163_10030552 | 3300014325 | Bacteria | 5192 |
| 94 | Ga0157379_10020854 | 3300014968 | Bacteria | 5799 |
| 95 | Ga0157376_10032459 | 3300014969 | Bacteria | 4193 |
| 96 | Ga0163161_10004549 | 3300017792 | Bacteria | 9657 |
| 97 | Ga0206353_11027924 | 3300020082 | Bacteria | 2917 |
| 98 | Ga0207692_10002680 | 3300025898 | Bacteria | 6851 |
| 99 | Ga0207680_10052107 | 3300025903 | Bacteria | 2450 |
| 100 | Ga0207647_10084249 | 3300025904 | Bacteria | 1903 |
| 101 | Ga0207685_10034812 | 3300025905 | Bacteria | 1833 |
| 102 | Ga0207643_10034273 | 3300025908 | Bacteria | 2845 |
| 103 | Ga0207684_10030852 | 3300025910 | Bacteria | 4562 |
| 104 | Ga0207695_10113519 | 3300025913 | Bacteria | 2685 |
| 105 | Ga0207671_10058141 | 3300025914 | Bacteria | 2866 |
| 106 | Ga0207693_10001556 | 3300025915 | Bacteria | 20261 |
| 107 | Ga0207660_10155362 | 3300025917 | Bacteria | 1761 |
| 108 | Ga0207662_10044369 | 3300025918 | Bacteria | 2625 |
| 109 | Ga0207657_10014682 | 3300025919 | Bacteria | 7631 |
| 110 | Ga0207652_10133063 | 3300025921 | Bacteria | 2219 |
| 111 | Ga0207652_10249246 | 3300025921 | Bacteria | 1601 |
| 112 | Ga0207681_10064766 | 3300025923 | Bacteria | 2525 |
| 113 | Ga0207687_10003238 | 3300025927 | Bacteria | 11033 |
| 114 | Ga0207700_10117298 | 3300025928 | Bacteria | 2152 |
| 115 | Ga0207664_10004283 | 3300025929 | Bacteria | 9658 |
| 116 | Ga0207664_10018440 | 3300025929 | Bacteria | 5138 |
| 117 | Ga0207664_10029061 | 3300025929 | Bacteria | 4208 |
| 118 | Ga0207706_10078702 | 3300025933 | Bacteria | 2899 |
| 119 | Ga0207686_10020683 | 3300025934 | Bacteria | 3763 |
| 120 | Ga0207665_10000823 | 3300025939 | Bacteria | 21005 |
| 121 | Ga0207665_10002701 | 3300025939 | Bacteria | 11894 |
| 122 | Ga0207689_10032355 | 3300025942 | Bacteria | 4352 |
| 123 | Ga0207661_10046892 | 3300025944 | Bacteria | 3428 |
| 124 | Ga0207667_10052764 | 3300025949 | Bacteria | 4280 |
| 125 | Ga0207651_10056543 | 3300025960 | Bacteria | 2701 |
| 126 | Ga0207712_10013525 | 3300025961 | Bacteria | 5233 |
| 127 | Ga0207639_10017098 | 3300026041 | Bacteria | 5139 |
| 128 | Ga0207678_10001775 | 3300026067 | Bacteria | 19743 |
| 129 | Ga0207708_10100018 | 3300026075 | Bacteria | 2243 |
| 130 | Ga0207683_10001505 | 3300026121 | Bacteria | 21009 |
| 131 | Ga0207698_10018555 | 3300026142 | Bacteria | 4743 |
| 132 | Ga0268266_10037119 | 3300028379 | Bacteria | 4151 |
| 133 | Ga0268266_10079337 | 3300028379 | Bacteria | 2858 |
| 134 | Ga0268264_10206796 | 3300028381 | Bacteria | 1799 |
| 135 | Ga0265336_10006781 | 3300028666 | Bacteria | 4102 |
| 136 | Ga0307517_10080829 | 3300028786 | Bacteria | 2778 |
| 137 | Ga0265338_10002561 | 3300028800 | Bacteria | 26893 |
| 138 | Ga0265338_10020499 | 3300028800 | Bacteria | 6950 |
| 139 | Ga0265340_10001192 | 3300031247 | Bacteria | 14844 |
| 140 | Ga0265340_10031699 | 3300031247 | Bacteria | 2642 |
| 141 | Ga0265339_10077100 | 3300031249 | Bacteria | 1767 |
| 142 | Ga0265327_10000303 | 3300031251 | Bacteria | 95597 |
| 143 | Ga0265327_10041511 | 3300031251 | Bacteria | 2479 |
| 144 | Ga0307509_10021594 | 3300031507 | Bacteria | 7274 |
| 145 | Ga0307514_10001295 | 3300031649 | Bacteria | 32437 |
| 146 | Ga0307507_10000003 | 3300033179 | Bacteria | 371707 |
| 147 | Ga0373929_0004042 | 3300035085 | Bacteria | 2629 |
| 148 | Ga0373940_0003787 | 3300035088 | Bacteria | 3128 |
| 149 | Ga0373941_0001471 | 3300035115 | Bacteria | 4974 |
| 150 | Ga0373962_0003944 | 3300035242 | Bacteria | 3572 |
| 151 | Ga0373931_0015264 | 3300035691 | Bacteria | 3766 |
| 152 | Ga0373937_0079447 | 3300036401 | Bacteria | 3032 |
| 153 | Ga0373937_0096555 | 3300036401 | Bacteria | 2741 |
| 154 | Ga0373925_0002475 | 3300037068 | Bacteria | 14765 |
| 155 | Ga0395900_0244161 | 3300037418 | Bacteria | 1800 |
| 156 | Ga0395898_0151680 | 3300037466 | Bacteria | 2217 |
| 157 | Ga0395901_0078894 | 3300038443 | Bacteria | 3438 |
| 158 | Ga0436365_1371133 | 3300039437 | Bacteria | 5312 |
| 159 | Ga0439449_0000455 | 3300042007 | Bacteria | 15259 |
| 160 | Ga0450894_000041 | 3300042131 | Bacteria | 18796 |
| 161 | Ga0450906_003083 | 3300042145 | Bacteria | 3611 |
| 162 | Ga0466969_0000716 | 3300044656 | Bacteria | 17970 |
| 163 | Ga0466969_0012044 | 3300044656 | Bacteria | 4570 |
| 164 | Ga0466969_0022401 | 3300044656 | Bacteria | 3261 |
| 165 | Ga0466972_0049661 | 3300044658 | Bacteria | 2026 |
| 166 | Ga0466965_0001681 | 3300044683 | Bacteria | 9079 |
| 167 | Ga0466965_0031613 | 3300044683 | Bacteria | 2582 |
| 168 | Ga0466966_0004363 | 3300044684 | Bacteria | 9330 |
| 169 | Ga0466966_0008524 | 3300044684 | Bacteria | 6789 |
| 170 | Ga0466966_0023551 | 3300044684 | Bacteria | 4029 |
| 171 | Ga0466961_0008184 | 3300044693 | Bacteria | 6660 |
| 172 | Ga0466961_0015083 | 3300044693 | Bacteria | 4960 |
| 173 | Ga0466961_0016970 | 3300044693 | Bacteria | 4677 |
| 174 | Ga0466961_0022551 | 3300044693 | Bacteria | 4050 |
| 175 | Ga0466961_0026012 | 3300044693 | Bacteria | 3762 |
| 176 | Ga0466961_0026675 | 3300044693 | Bacteria | 3714 |
| 177 | Ga0466963_0008612 | 3300044694 | Bacteria | 6123 |
| 178 | Ga0466963_0008990 | 3300044694 | Bacteria | 5998 |
| 179 | Ga0466963_0043640 | 3300044694 | Bacteria | 2949 |
| 180 | Ga0466963_0108156 | 3300044694 | Bacteria | 1907 |
| 181 | Ga0466963_0113174 | 3300044694 | Bacteria | 1864 |
| 182 | Ga0466963_0150924 | 3300044694 | Bacteria | 1613 |
| 183 | Ga0466964_0002200 | 3300044706 | Bacteria | 6900 |
| 184 | Ga0466964_0029365 | 3300044706 | Bacteria | 2170 |
| 185 | Ga0466971_0000279 | 3300044719 | Bacteria | 19515 |
| 186 | Ga0466971_0002955 | 3300044719 | Bacteria | 7214 |
| 187 | Ga0466971_0008419 | 3300044719 | Bacteria | 4499 |
| 188 | Ga0466970_0003692 | 3300044765 | Bacteria | 7477 |
| 189 | Ga0466970_0019312 | 3300044765 | Bacteria | 3533 |
| 190 | Ga0466970_0057246 | 3300044765 | Bacteria | 2084 |
| 191 | Ga0466957_0004145 | 3300044842 | Bacteria | 8031 |
| 192 | Ga0466959_0000323 | 3300045049 | Bacteria | 28214 |
| 193 | Ga0466959_0026304 | 3300045049 | Bacteria | 4313 |
| 194 | Ga0466959_0038142 | 3300045049 | Bacteria | 3550 |
| 195 | Ga0466959_0152300 | 3300045049 | Bacteria | 1629 |
| 196 | Ga0466958_0019987 | 3300045836 | Bacteria | 3902 |
| 197 | Ga0466958_0020219 | 3300045836 | Bacteria | 3881 |
| 198 | Ga0466958_0030425 | 3300045836 | Bacteria | 3207 |
| 199 | Ga0466958_0081057 | 3300045836 | Bacteria | 1997 |
| 200 | Ga0466958_0106021 | 3300045836 | Bacteria | 1752 |
| 201 | Ga0466967_0022529 | 3300045976 | Bacteria | 5142 |
| 202 | Ga0466967_0033684 | 3300045976 | Bacteria | 4339 |
| 203 | Ga0466967_0066933 | 3300045976 | Bacteria | 3202 |
| 204 | Ga0466967_0072942 | 3300045976 | Bacteria | 3078 |
| 205 | Ga0466967_0075528 | 3300045976 | Bacteria | 3029 |
| 206 | Ga0466967_0086183 | 3300045976 | Bacteria | 2845 |
| 207 | Ga0466967_0103772 | 3300045976 | Bacteria | 2602 |
| 208 | Ga0466967_0287451 | 3300045976 | Bacteria | 1579 |
| 209 | Ga0495592_0007465 | 3300046454 | Bacteria | 8192 |
| 210 | Ga0495592_0011590 | 3300046454 | Bacteria | 6676 |
| 211 | Ga0495592_0012501 | 3300046454 | Bacteria | 6451 |
| 212 | Ga0495651_0001725 | 3300046462 | Bacteria | 16867 |
| 213 | Ga0495651_0001849 | 3300046462 | Bacteria | 16376 |
| 214 | Ga0495651_0037801 | 3300046462 | Bacteria | 3758 |
| 215 | Ga0495653_0000616 | 3300046463 | Bacteria | 27212 |
| 216 | Ga0495580_0029813 | 3300046472 | Bacteria | 3957 |
| 217 | Ga0495662_0000604 | 3300046476 | Bacteria | 16590 |
| 218 | Ga0495664_0037441 | 3300046477 | Bacteria | 2863 |
| 219 | Ga0495664_0049771 | 3300046477 | Bacteria | 2487 |
| 220 | Ga0495594_0020327 | 3300046499 | Bacteria | 3536 |
| 221 | Ga0495594_0059262 | 3300046499 | Bacteria | 2117 |
| 222 | Ga0495608_0005793 | 3300046511 | Bacteria | 8804 |
| 223 | Ga0495628_0044055 | 3300046516 | Bacteria | 3551 |
| 224 | Ga0495628_0103642 | 3300046516 | Bacteria | 2193 |
| 225 | Ga0495666_0013498 | 3300046526 | Bacteria | 4073 |
| 226 | Ga0495652_0003784 | 3300046529 | Bacteria | 14769 |
| 227 | Ga0495652_0004405 | 3300046529 | Bacteria | 13463 |
| 228 | Ga0495652_0024439 | 3300046529 | Bacteria | 5348 |
| 229 | Ga0495665_0016770 | 3300046531 | Bacteria | 3943 |
| 230 | Ga0495645_0055243 | 3300046543 | Bacteria | 2883 |
| 231 | Ga0495667_0000339 | 3300046559 | Bacteria | 29607 |
| 232 | Ga0495634_0068928 | 3300046642 | Bacteria | 2335 |
| 233 | Ga0495635_0002753 | 3300046663 | Bacteria | 12054 |
| 234 | Ga0495635_0006875 | 3300046663 | Bacteria | 7947 |
| 235 | Ga0495657_0001909 | 3300046675 | Bacteria | 17732 |
| 236 | Ga0495657_0016030 | 3300046675 | Bacteria | 5467 |
| 237 | Ga0495599_0025639 | 3300046678 | Bacteria | 3691 |
| 238 | Ga0495623_0015279 | 3300046679 | Bacteria | 4961 |
| 239 | Ga0495646_0037871 | 3300046680 | Bacteria | 2981 |
| 240 | Ga0495613_0018854 | 3300046689 | Bacteria | 5141 |
| 241 | Ga0495600_0005662 | 3300046809 | Bacteria | 7547 |
| 242 | Ga0495600_0018192 | 3300046809 | Bacteria | 4474 |
| 243 | Ga0495604_0016179 | 3300047317 | Bacteria | 5960 |
| 244 | Ga0495604_0017878 | 3300047317 | Bacteria | 5672 |
| 245 | Ga0495674_0006389 | 3300047319 | Bacteria | 11298 |
| 246 | Ga0495674_0017780 | 3300047319 | Bacteria | 6620 |
| 247 | Ga0495676_0009043 | 3300047321 | Bacteria | 9088 |
| 248 | Ga0495680_0000696 | 3300047322 | Bacteria | 37699 |
| 249 | Ga0495675_0033892 | 3300047444 | Bacteria | 3259 |
| 250 | Ga0495684_0031197 | 3300047471 | Bacteria | 4091 |
| 251 | Ga0495684_0058540 | 3300047471 | Bacteria | 2935 |
| 252 | Ga0495593_0013378 | 3300047673 | Bacteria | 4682 |
| 253 | Ga0495602_0033651 | 3300048088 | Bacteria | 4804 |
| 254 | Ga0495602_0215372 | 3300048088 | Bacteria | 1454 |
| 255 | Ga0496101_0014878 | 3300048904 | Bacteria | 5236 |
| 256 | Ga0496102_0000013 | 3300048905 | Bacteria | 311668 |
| 257 | Ga0496102_0016141 | 3300048905 | Bacteria | 6523 |
| 258 | Ga0496102_0105923 | 3300048905 | Bacteria | 2616 |
| 259 | Ga0496102_0202474 | 3300048905 | Bacteria | 1871 |
| 260 | Ga0496103_0000231 | 3300048906 | Bacteria | 54600 |
| 261 | Ga0496103_0020669 | 3300048906 | Bacteria | 3956 |
| 262 | Ga0496103_0057203 | 3300048906 | Bacteria | 2421 |
| 263 | Ga0496103_0088251 | 3300048906 | Bacteria | 1955 |
| 264 | Ga0496104_0000353 | 3300048907 | Bacteria | 41013 |
| 265 | Ga0496104_0125259 | 3300048907 | Bacteria | 2467 |
| 266 | Ga0496105_0000894 | 3300048908 | Bacteria | 20376 |
| 267 | Ga0496106_0029895 | 3300048909 | Bacteria | 4061 |
| 268 | Ga0496107_0041041 | 3300048910 | Bacteria | 3323 |
| 269 | Ga0496107_0144770 | 3300048910 | Bacteria | 1757 |
| 270 | Ga0496108_0003370 | 3300048911 | Bacteria | 12829 |
| 271 | Ga0496108_0042988 | 3300048911 | Bacteria | 3773 |
| 272 | Ga0496108_0161728 | 3300048911 | Bacteria | 1935 |
| 273 | Ga0496109_0010124 | 3300048912 | Bacteria | 8044 |
| 274 | Ga0496109_0016558 | 3300048912 | Bacteria | 6447 |
| 275 | Ga0496110_0011267 | 3300048913 | Bacteria | 7309 |
| 276 | Ga0496110_0037223 | 3300048913 | Bacteria | 4229 |
| 277 | Ga0496111_0028703 | 3300048914 | Bacteria | 3943 |
| 278 | Ga0496112_0001080 | 3300048915 | Bacteria | 20167 |
| 279 | Ga0496112_0006118 | 3300048915 | Bacteria | 10519 |
| 280 | Ga0496112_0074585 | 3300048915 | Bacteria | 3354 |
| 281 | Ga0496112_0148837 | 3300048915 | Bacteria | 2309 |
| 282 | Ga0496112_0156787 | 3300048915 | Bacteria | 2243 |
| 283 | Ga0496113_0010158 | 3300048916 | Bacteria | 6213 |
| 284 | Ga0496113_0015066 | 3300048916 | Bacteria | 5298 |
| 285 | Ga0496114_0015265 | 3300048917 | Bacteria | 6174 |
| 286 | Ga0496115_0066216 | 3300048918 | Bacteria | 2919 |
| 287 | Ga0496119_0000276 | 3300048922 | Bacteria | 72490 |
| 288 | Ga0496120_0003864 | 3300048923 | Bacteria | 13147 |
| 289 | Ga0496126_0000075 | 3300048929 | Bacteria | 235121 |
| 290 | Ga0496126_0208588 | 3300048929 | Bacteria | 1646 |
| 291 | Ga0501031_0023861 | 3300049568 | Bacteria | 3988 |
| 292 | Ga0501032_0015084 | 3300049569 | Bacteria | 5457 |
| 293 | Ga0501032_0096958 | 3300049569 | Bacteria | 1954 |
| 294 | Ga0501033_0018579 | 3300049570 | Bacteria | 5254 |
| 295 | Ga0501033_0063527 | 3300049570 | Bacteria | 2717 |
| 296 | Ga0501033_0079861 | 3300049570 | Bacteria | 2400 |
| 297 | Ga0501033_0152163 | 3300049570 | Bacteria | 1669 |
| 298 | Ga0501034_0002162 | 3300049571 | Bacteria | 24379 |
| 299 | Ga0501034_0005694 | 3300049571 | Bacteria | 13545 |
| 300 | Ga0501034_0144879 | 3300049571 | Bacteria | 2353 |
| 301 | Ga0501036_0008872 | 3300049572 | Bacteria | 8256 |
| 302 | Ga0501036_0040311 | 3300049572 | Bacteria | 3949 |
| 303 | Ga0501038_0012135 | 3300049574 | Bacteria | 7868 |
| 304 | Ga0501038_0053230 | 3300049574 | Bacteria | 3485 |
| 305 | Ga0501039_0000885 | 3300049575 | Bacteria | 21756 |
| 306 | Ga0501043_0006787 | 3300049579 | Bacteria | 9139 |
| 307 | Ga0501047_0117840 | 3300049581 | Bacteria | 2537 |
| 308 | Ga0501048_0004231 | 3300049582 | Bacteria | 10938 |
| 309 | Ga0501068_0081056 | 3300049584 | Bacteria | 1992 |
| 310 | Ga0501070_0002002 | 3300049586 | Bacteria | 17911 |
| 311 | Ga0501070_0014360 | 3300049586 | Bacteria | 6665 |
| 312 | Ga0501074_0002670 | 3300049590 | Bacteria | 12485 |
| 313 | Ga0501081_0075710 | 3300049743 | Bacteria | 2350 |
| 314 | Ga0501035_0018514 | 3300049822 | Bacteria | 6416 |
| 315 | Ga0501035_0163763 | 3300049822 | Bacteria | 1924 |
| 316 | Ga0501044_0010050 | 3300049823 | Bacteria | 10283 |
| 317 | Ga0501044_0044114 | 3300049823 | Bacteria | 4630 |
| 318 | Ga0501044_0203099 | 3300049823 | Bacteria | 1939 |
| 319 | nmdc:mga08y16_182650_c1 | 3300050511 | Bacteria | 2177 |
| 320 | nmdc:mga0rr50_37385_c1 | 3300050513 | Bacteria | 3504 |
| 321 | nmdc:mga0a205_179155_c1 | 3300050515 | Bacteria | 2014 |
| 322 | Ga0495601_0069761 | 3300053077 | Bacteria | 2242 |
| 323 | Ga0495601_0135921 | 3300053077 | Bacteria | 1602 |
| 324 | Ga0495612_0059126 | 3300053078 | Bacteria | 1584 |
| 325 | Ga0466962_0001078 | 3300061719 | Bacteria | 12533 |
| 326 | Ga0466962_0001198 | 3300061719 | Bacteria | 11914 |
| 327 | Ga0466962_0001350 | 3300061719 | Bacteria | 11344 |
| 328 | Ga0466962_0015358 | 3300061719 | Bacteria | 3691 |
| 329 | 2804849138 | 2802429296 | Bacteria | 7227771 |
| 330 | 2811843212 | 2808606982 | Bacteria | 7791042 |
| 331 | 2867374905 | 2867369537 | Bacteria | 6501581 |
| 332 | 2912764094 | 2912757875 | Bacteria | 7940295 |
| 333 | 2954009662 | 2954002825 | Bacteria | 9173742 |
| 334 | 2995470861 | 2995463766 | Bacteria | 8577691 |
| 335 | 3006486732 | 3006486233 | Bacteria | 8157040 |
| 336 | 8025535280 | 8025530807 | Bacteria | 8495698 |
| 337 | Ga0501037_0065141 | |||
| 338 | JGI25153J46596_10040772 | |||
| 339 | rootH2_10008205 | |||
| 340 | rootH1_10289385 | |||
| 341 | Ga0070683_100040034 | |||
| 342 | Ga0068869_100007942 | |||
| 343 | Ga0070666_10075154 | |||
| 344 | Ga0070682_100005523 | |||
| 345 | Ga0070660_100016167 | |||
| 346 | Ga0070689_100064051 | |||
| 347 | Ga0070691_10009595 | |||
| 348 | Ga0070687_100010638 | |||
| 349 | Ga0070668_100003489 | |||
| 350 | Ga0070669_100031096 | |||
| 351 | Ga0070674_100023308 | |||
| 352 | Ga0070673_100019493 | |||
| 353 | Ga0070659_100025152 | |||
| 354 | Ga0070709_10004553 | |||
| 355 | Ga0070714_100048886 | |||
| 356 | Ga0070714_100187933 | |||
| 357 | Ga0070713_100007081 | |||
| 358 | Ga0070713_100180150 | |||
| 359 | Ga0070710_10011258 | |||
| 360 | Ga0070711_100007616 | |||
| 361 | Ga0070711_100059605 | |||
| 362 | Ga0070711_100081832 | |||
| 363 | Ga0070705_100013089 | |||
| 364 | Ga0070694_100015797 | |||
| 365 | Ga0070708_100032408 | |||
| 366 | Ga0070663_100009920 | |||
| 367 | Ga0070662_100056363 | |||
| 368 | Ga0070685_10057158 | |||
| 369 | Ga0070698_100000958 | |||
| 370 | Ga0070679_100001302 | |||
| 371 | Ga0070679_100014459 | |||
| 372 | Ga0070684_100058242 | |||
| 373 | Ga0068853_100030865 | |||
| 374 | Ga0070686_100042515 | |||
| 375 | Ga0070695_100014353 | |||
| 376 | Ga0070696_100018250 | |||
| 377 | Ga0070693_100015943 | |||
| 378 | Ga0070665_100123458 | |||
| 379 | Ga0070704_100001417 | |||
| 380 | Ga0068857_100212457 | |||
| 381 | Ga0068854_100077828 | |||
| 382 | Ga0068852_100003545 | |||
| 383 | Ga0068852_100016511 | |||
| 384 | Ga0068859_100000488 | |||
| 385 | Ga0068864_100087851 | |||
| 386 | Ga0068861_100015703 | |||
| 387 | Ga0068863_100013541 | |||
| 388 | Ga0068863_100025519 | |||
| 389 | Ga0068858_100024327 | |||
| 390 | Ga0068860_100006769 | |||
| 391 | Ga0081540_1000961 | |||
| 392 | Ga0070717_10003177 | |||
| 393 | Ga0070717_10023500 | |||
| 394 | Ga0070717_10064503 | |||
| 395 | Ga0070715_10001540 | |||
| 396 | Ga0070716_100002203 | |||
| 397 | Ga0070712_100075095 | |||
| 398 | Ga0097621_100029174 | |||
| 399 | Ga0068871_100045097 | |||
| 400 | Ga0075433_10113606 | |||
| 401 | Ga0075434_100017609 | |||
| 402 | Ga0075436_100009307 | |||
| 403 | Ga0097620_100000488 | |||
| 404 | Ga0075435_100007080 | |||
| 405 | Ga0105245_10006294 | |||
| 406 | Ga0105245_10009629 | |||
| 407 | Ga0105247_10018292 | |||
| 408 | Ga0105247_10020004 | |||
| 409 | Ga0105243_10102010 | |||
| 410 | Ga0105241_10066324 | |||
| 411 | Ga0105241_10068986 | |||
| 412 | Ga0105248_10006486 | |||
| 413 | Ga0105237_10017374 | |||
| 414 | Ga0105238_10028104 | |||
| 415 | Ga0105238_10163728 | |||
| 416 | Ga0105249_10001272 | |||
| 417 | Ga0105239_10023503 | |||
| 418 | Ga0105239_10040999 | |||
| 419 | Ga0105239_10244146 | |||
| 420 | Ga0105246_10006105 | |||
| 421 | Ga0157371_10022927 | |||
| 422 | Ga0157370_10010551 | |||
| 423 | Ga0157369_10047289 | |||
| 424 | Ga0157374_10029165 | |||
| 425 | Ga0157374_10196903 | |||
| 426 | Ga0157378_10124016 | |||
| 427 | Ga0157372_10015213 | |||
| 428 | Ga0157372_10191654 | |||
| 429 | Ga0163163_10030552 | |||
| 430 | Ga0157379_10020854 | |||
| 431 | Ga0157376_10032459 | |||
| 432 | Ga0163161_10004549 | |||
| 433 | Ga0206353_11027924 | |||
| 434 | Ga0207692_10002680 | |||
| 435 | Ga0207680_10052107 | |||
| 436 | Ga0207647_10084249 | |||
| 437 | Ga0207685_10034812 | |||
| 438 | Ga0207643_10034273 | |||
| 439 | Ga0207684_10030852 | |||
| 440 | Ga0207695_10113519 | |||
| 441 | Ga0207671_10058141 | |||
| 442 | Ga0207693_10001556 | |||
| 443 | Ga0207660_10155362 | |||
| 444 | Ga0207662_10044369 | |||
| 445 | Ga0207657_10014682 | |||
| 446 | Ga0207652_10133063 | |||
| 447 | Ga0207652_10249246 | |||
| 448 | Ga0207681_10064766 | |||
| 449 | Ga0207687_10003238 | |||
| 450 | Ga0207700_10117298 | |||
| 451 | Ga0207664_10004283 | |||
| 452 | Ga0207664_10018440 | |||
| 453 | Ga0207664_10029061 | |||
| 454 | Ga0207706_10078702 | |||
| 455 | Ga0207686_10020683 | |||
| 456 | Ga0207665_10000823 | |||
| 457 | Ga0207665_10002701 | |||
| 458 | Ga0207689_10032355 | |||
| 459 | Ga0207661_10046892 | |||
| 460 | Ga0207667_10052764 | |||
| 461 | Ga0207651_10056543 | |||
| 462 | Ga0207712_10013525 | |||
| 463 | Ga0207639_10017098 | |||
| 464 | Ga0207678_10001775 | |||
| 465 | Ga0207708_10100018 | |||
| 466 | Ga0207683_10001505 | |||
| 467 | Ga0207698_10018555 | |||
| 468 | Ga0268266_10037119 | |||
| 469 | Ga0268266_10079337 | |||
| 470 | Ga0268264_10206796 | |||
| 471 | Ga0265336_10006781 | |||
| 472 | Ga0307517_10080829 | |||
| 473 | Ga0265338_10002561 | |||
| 474 | Ga0265338_10020499 | |||
| 475 | Ga0265340_10001192 | |||
| 476 | Ga0265340_10031699 | |||
| 477 | Ga0265339_10077100 | |||
| 478 | Ga0265327_10000303 | |||
| 479 | Ga0265327_10041511 | |||
| 480 | Ga0307509_10021594 | |||
| 481 | Ga0307514_10001295 | |||
| 482 | Ga0307507_10000003 | |||
| 483 | Ga0373929_0004042 | |||
| 484 | Ga0373940_0003787 | |||
| 485 | Ga0373941_0001471 | |||
| 486 | Ga0373962_0003944 | |||
| 487 | Ga0373931_0015264 | |||
| 488 | Ga0373937_0079447 | |||
| 489 | Ga0373937_0096555 | |||
| 490 | Ga0373925_0002475 | |||
| 491 | Ga0395900_0244161 | |||
| 492 | Ga0395898_0151680 | |||
| 493 | Ga0395901_0078894 | |||
| 494 | Ga0436365_1371133 | |||
| 495 | Ga0439449_0000455 | |||
| 496 | Ga0450894_000041 | |||
| 497 | Ga0450906_003083 | |||
| 498 | Ga0466969_0000716 | |||
| 499 | Ga0466969_0012044 | |||
| 500 | Ga0466969_0022401 | |||
| 501 | Ga0466972_0049661 | |||
| 502 | Ga0466965_0001681 | |||
| 503 | Ga0466965_0031613 | |||
| 504 | Ga0466966_0004363 | |||
| 505 | Ga0466966_0008524 | |||
| 506 | Ga0466966_0023551 | |||
| 507 | Ga0466961_0008184 | |||
| 508 | Ga0466961_0015083 | |||
| 509 | Ga0466961_0016970 | |||
| 510 | Ga0466961_0022551 | |||
| 511 | Ga0466961_0026012 | |||
| 512 | Ga0466961_0026675 | |||
| 513 | Ga0466963_0008612 | |||
| 514 | Ga0466963_0008990 | |||
| 515 | Ga0466963_0043640 | |||
| 516 | Ga0466963_0108156 | |||
| 517 | Ga0466963_0113174 | |||
| 518 | Ga0466963_0150924 | |||
| 519 | Ga0466964_0002200 | |||
| 520 | Ga0466964_0029365 | |||
| 521 | Ga0466971_0000279 | |||
| 522 | Ga0466971_0002955 | |||
| 523 | Ga0466971_0008419 | |||
| 524 | Ga0466970_0003692 | |||
| 525 | Ga0466970_0019312 | |||
| 526 | Ga0466970_0057246 | |||
| 527 | Ga0466957_0004145 | |||
| 528 | Ga0466959_0000323 | |||
| 529 | Ga0466959_0026304 | |||
| 530 | Ga0466959_0038142 | |||
| 531 | Ga0466959_0152300 | |||
| 532 | Ga0466958_0019987 | |||
| 533 | Ga0466958_0020219 | |||
| 534 | Ga0466958_0030425 | |||
| 535 | Ga0466958_0081057 | |||
| 536 | Ga0466958_0106021 | |||
| 537 | Ga0466967_0022529 | |||
| 538 | Ga0466967_0033684 | |||
| 539 | Ga0466967_0066933 | |||
| 540 | Ga0466967_0072942 | |||
| 541 | Ga0466967_0075528 | |||
| 542 | Ga0466967_0086183 | |||
| 543 | Ga0466967_0103772 | |||
| 544 | Ga0466967_0287451 | |||
| 545 | Ga0495592_0007465 | |||
| 546 | Ga0495592_0011590 | |||
| 547 | Ga0495592_0012501 | |||
| 548 | Ga0495651_0001725 | |||
| 549 | Ga0495651_0001849 | |||
| 550 | Ga0495651_0037801 | |||
| 551 | Ga0495653_0000616 | |||
| 552 | Ga0495580_0029813 | |||
| 553 | Ga0495662_0000604 | |||
| 554 | Ga0495664_0037441 | |||
| 555 | Ga0495664_0049771 | |||
| 556 | Ga0495594_0020327 | |||
| 557 | Ga0495594_0059262 | |||
| 558 | Ga0495608_0005793 | |||
| 559 | Ga0495628_0044055 | |||
| 560 | Ga0495628_0103642 | |||
| 561 | Ga0495666_0013498 | |||
| 562 | Ga0495652_0003784 | |||
| 563 | Ga0495652_0004405 | |||
| 564 | Ga0495652_0024439 | |||
| 565 | Ga0495665_0016770 | |||
| 566 | Ga0495645_0055243 | |||
| 567 | Ga0495667_0000339 | |||
| 568 | Ga0495634_0068928 | |||
| 569 | Ga0495635_0002753 | |||
| 570 | Ga0495635_0006875 | |||
| 571 | Ga0495657_0001909 | |||
| 572 | Ga0495657_0016030 | |||
| 573 | Ga0495599_0025639 | |||
| 574 | Ga0495623_0015279 | |||
| 575 | Ga0495646_0037871 | |||
| 576 | Ga0495613_0018854 | |||
| 577 | Ga0495600_0005662 | |||
| 578 | Ga0495600_0018192 | |||
| 579 | Ga0495604_0016179 | |||
| 580 | Ga0495604_0017878 | |||
| 581 | Ga0495674_0006389 | |||
| 582 | Ga0495674_0017780 | |||
| 583 | Ga0495676_0009043 | |||
| 584 | Ga0495680_0000696 | |||
| 585 | Ga0495675_0033892 | |||
| 586 | Ga0495684_0031197 | |||
| 587 | Ga0495684_0058540 | |||
| 588 | Ga0495593_0013378 | |||
| 589 | Ga0495602_0033651 | |||
| 590 | Ga0495602_0215372 | |||
| 591 | Ga0496101_0014878 | |||
| 592 | Ga0496102_0000013 | |||
| 593 | Ga0496102_0016141 | |||
| 594 | Ga0496102_0105923 | |||
| 595 | Ga0496102_0202474 | |||
| 596 | Ga0496103_0000231 | |||
| 597 | Ga0496103_0020669 | |||
| 598 | Ga0496103_0057203 | |||
| 599 | Ga0496103_0088251 | |||
| 600 | Ga0496104_0000353 | |||
| 601 | Ga0496104_0125259 | |||
| 602 | Ga0496105_0000894 | |||
| 603 | Ga0496106_0029895 | |||
| 604 | Ga0496107_0041041 | |||
| 605 | Ga0496107_0144770 | |||
| 606 | Ga0496108_0003370 | |||
| 607 | Ga0496108_0042988 | |||
| 608 | Ga0496108_0161728 | |||
| 609 | Ga0496109_0010124 | |||
| 610 | Ga0496109_0016558 | |||
| 611 | Ga0496110_0011267 | |||
| 612 | Ga0496110_0037223 | |||
| 613 | Ga0496111_0028703 | |||
| 614 | Ga0496112_0001080 | |||
| 615 | Ga0496112_0006118 | |||
| 616 | Ga0496112_0074585 | |||
| 617 | Ga0496112_0148837 | |||
| 618 | Ga0496112_0156787 | |||
| 619 | Ga0496113_0010158 | |||
| 620 | Ga0496113_0015066 | |||
| 621 | Ga0496114_0015265 | |||
| 622 | Ga0496115_0066216 | |||
| 623 | Ga0496119_0000276 | |||
| 624 | Ga0496120_0003864 | |||
| 625 | Ga0496126_0000075 | |||
| 626 | Ga0496126_0208588 | |||
| 627 | Ga0501031_0023861 | |||
| 628 | Ga0501032_0015084 | |||
| 629 | Ga0501032_0096958 | |||
| 630 | Ga0501033_0018579 | |||
| 631 | Ga0501033_0063527 | |||
| 632 | Ga0501033_0079861 | |||
| 633 | Ga0501033_0152163 | |||
| 634 | Ga0501034_0002162 | |||
| 635 | Ga0501034_0005694 | |||
| 636 | Ga0501034_0144879 | |||
| 637 | Ga0501036_0008872 | |||
| 638 | Ga0501036_0040311 | |||
| 639 | Ga0501038_0012135 | |||
| 640 | Ga0501038_0053230 | |||
| 641 | Ga0501039_0000885 | |||
| 642 | Ga0501043_0006787 | |||
| 643 | Ga0501047_0117840 | |||
| 644 | Ga0501048_0004231 | |||
| 645 | Ga0501068_0081056 | |||
| 646 | Ga0501070_0002002 | |||
| 647 | Ga0501070_0014360 | |||
| 648 | Ga0501074_0002670 | |||
| 649 | Ga0501081_0075710 | |||
| 650 | Ga0501035_0018514 | |||
| 651 | Ga0501035_0163763 | |||
| 652 | Ga0501044_0010050 | |||
| 653 | Ga0501044_0044114 | |||
| 654 | Ga0501044_0203099 | |||
| 655 | nmdc:mga08y16_182650_c1 | |||
| 656 | nmdc:mga0rr50_37385_c1 | |||
| 657 | nmdc:mga0a205_179155_c1 | |||
| 658 | Ga0495601_0069761 | |||
| 659 | Ga0495601_0135921 | |||
| 660 | Ga0495612_0059126 | |||
| 661 | Ga0466962_0001078 | |||
| 662 | Ga0466962_0001198 | |||
| 663 | Ga0466962_0001350 | |||
| 664 | Ga0466962_0015358 | |||
| 665 | 2804849138 | |||
| 666 | 2811843212 | |||
| 667 | 2867374905 | |||
| 668 | 2912764094 | |||
| 669 | 2954009662 | |||
| 670 | 2995470861 | |||
| 671 | 3006486732 | |||
| 672 | 8025535280 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wkh-assembly1.cif.gz_B | acetylornithine aminotransferase from thermus thermophilus hb8 | 0.9359 | 45 | 441 |
| 2eh6-assembly1.cif.gz_B | crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 | 0.9227 | 45 | 440 |
| 7nn4-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid. | 0.9183 | 45 | 444 |
| 2ord-assembly1.cif.gz_B | crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution | 0.9138 | 44 | 442 |
| 4ppm-assembly1.cif.gz_B | crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. fs14 | 0.9123 | 10 | 446 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P42588_355_453_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9419 | 331 | 444 | 3.90.1150.10 |
| af_P9WQ77_356_444_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9341 | 333 | 439 | 3.90.1150.10 |
| 2cinA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9338 | 332 | 440 | 3.90.1150.10 |
| 2eh6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9268 | 333 | 440 | 3.90.1150.10 |
| af_Q10174_149_357_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9244 | 121 | 322 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5K3V9-F1-model_v4 | Aspartate aminotransferase family protein | 0.9695 | 9 | 135 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-D8F3N8-F1-model_v4 | Putative Putrescine aminotransferase | 0.9618 | 10 | 461 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-A0A1Y2ZWP5-F1-model_v4 | Aminotransferase | 0.9612 | 9 | 462 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-A0A832E9I1-F1-model_v4 | Aspartate aminotransferase family protein | 0.9606 | 12 | 461 |
GO:0008483
GO:0030170 GO:0042802 |
| AF-A0A7S6S8H0-F1-model_v4 | Aspartate aminotransferase family protein | 0.9568 | 10 | 464 |
GO:0008483
GO:0030170 GO:0042802 |