F412836

General Info

Members Datasets Scaffolds Average Seq Length
336 226 672 461

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0065141|Ga0501037_0065141_683_2377
Length 528
Sequence MRYSVSTQDEFDLRDVLARRGPERYDLQASYLNPQLPRMLHAIGFDRIYTRAEGAYLYDDAGHDYLDMLSGFGVFALGRHHPVVRQAVHDALDLGLADLTQFDAPPLAGALAERLLAHVPHLDRVYFGNSGTEAVEAALKYARFATGRKRIIFCDHAFHGLTAGSLSVNGARDFRKGFGPLLPDTAIPFGDLGALERELKRGDVAAFLIEPVQGKGVAVAPPGFLRAAHELLREHKALLIADEVQCGLGRTGDFFAFQHDGVEPDLVATAKALSGGYVPVGATMGRDWIFNKVYSSMDRVLVHDSTFGSNAQAMAAGLATLHVMEAEGVVDNARKMGELLQQRLADLVDRYELLHEVRGRGLMIGIEFGRPDTWKRRAPWAALQLARKGLFAQTVVHALFHRHRILTQVSGDHVEVIKLIPPLTIGEAEVDRFVAAFIDVMDEAHRGTPLTNSITRDFGRMLVRQARGPELGIAVRRRRVGTHREPEHRGRRAAEPGRVRHRADQAHRPAPHRHHQHLVTGPSLAPAQ

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
135 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
220 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
221 2867369537 Streptomyces sp. Z26 Isolate Unclassified
222 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
223 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
224 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
225 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
226 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0.3
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 9.52
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0065141 3300049573 Bacteria 2655
2 JGI25153J46596_10040772 3300003215 Bacteria 1436
3 rootH2_10008205 3300003320 Bacteria 4044
4 rootH1_10289385 3300003323 Bacteria 3183
5 Ga0070683_100040034 3300005329 Bacteria 4306
6 Ga0068869_100007942 3300005334 Bacteria 6817
7 Ga0070666_10075154 3300005335 Bacteria 2304
8 Ga0070682_100005523 3300005337 Bacteria 7038
9 Ga0070660_100016167 3300005339 Bacteria 5410
10 Ga0070689_100064051 3300005340 Bacteria 2861
11 Ga0070691_10009595 3300005341 Bacteria 4417
12 Ga0070687_100010638 3300005343 Bacteria 3990
13 Ga0070668_100003489 3300005347 Bacteria 11592
14 Ga0070669_100031096 3300005353 Bacteria 3855
15 Ga0070674_100023308 3300005356 Bacteria 4004
16 Ga0070673_100019493 3300005364 Bacteria 4870
17 Ga0070659_100025152 3300005366 Bacteria 4570
18 Ga0070709_10004553 3300005434 Bacteria 7487
19 Ga0070714_100048886 3300005435 Bacteria 3599
20 Ga0070714_100187933 3300005435 Bacteria 1883
21 Ga0070713_100007081 3300005436 Bacteria 7840
22 Ga0070713_100180150 3300005436 Bacteria 1898
23 Ga0070710_10011258 3300005437 Bacteria 4418
24 Ga0070711_100007616 3300005439 Bacteria 6590
25 Ga0070711_100059605 3300005439 Bacteria 2651
26 Ga0070711_100081832 3300005439 Bacteria 2302
27 Ga0070705_100013089 3300005440 Bacteria 4234
28 Ga0070694_100015797 3300005444 Bacteria 4748
29 Ga0070708_100032408 3300005445 Bacteria 4533
30 Ga0070663_100009920 3300005455 Bacteria 5917
31 Ga0070662_100056363 3300005457 Bacteria 2853
32 Ga0070685_10057158 3300005466 Bacteria 2270
33 Ga0070698_100000958 3300005471 Bacteria 31586
34 Ga0070679_100001302 3300005530 Bacteria 22036
35 Ga0070679_100014459 3300005530 Bacteria 7580
36 Ga0070684_100058242 3300005535 Bacteria 3376
37 Ga0068853_100030865 3300005539 Bacteria 4528
38 Ga0070686_100042515 3300005544 Bacteria 2847
39 Ga0070695_100014353 3300005545 Bacteria 4774
40 Ga0070696_100018250 3300005546 Bacteria 4740
41 Ga0070693_100015943 3300005547 Bacteria 3880
42 Ga0070665_100123458 3300005548 Bacteria 2592
43 Ga0070704_100001417 3300005549 Bacteria 12795
44 Ga0068857_100212457 3300005577 Bacteria 1766
45 Ga0068854_100077828 3300005578 Bacteria 2441
46 Ga0068852_100003545 3300005616 Bacteria 10917
47 Ga0068852_100016511 3300005616 Bacteria 5761
48 Ga0068859_100000488 3300005617 Bacteria 39249
49 Ga0068864_100087851 3300005618 Bacteria 2737
50 Ga0068861_100015703 3300005719 Bacteria 5343
51 Ga0068863_100013541 3300005841 Bacteria 7868
52 Ga0068863_100025519 3300005841 Bacteria 5634
53 Ga0068858_100024327 3300005842 Bacteria 5643
54 Ga0068860_100006769 3300005843 Bacteria 11495
55 Ga0081540_1000961 3300005983 Bacteria 26017
56 Ga0070717_10003177 3300006028 Bacteria 11736
57 Ga0070717_10023500 3300006028 Bacteria 4886
58 Ga0070717_10064503 3300006028 Bacteria 3042
59 Ga0070715_10001540 3300006163 Bacteria 6747
60 Ga0070716_100002203 3300006173 Bacteria 8979
61 Ga0070712_100075095 3300006175 Bacteria 2430
62 Ga0097621_100029174 3300006237 Bacteria 4355
63 Ga0068871_100045097 3300006358 Bacteria 3547
64 Ga0075433_10113606 3300006852 Bacteria 2402
65 Ga0075434_100017609 3300006871 Bacteria 6886
66 Ga0075436_100009307 3300006914 Bacteria 6719
67 Ga0097620_100000488 3300006931 Bacteria 39249
68 Ga0075435_100007080 3300007076 Bacteria 7963
69 Ga0105245_10006294 3300009098 Bacteria 10451
70 Ga0105245_10009629 3300009098 Bacteria 8428
71 Ga0105247_10018292 3300009101 Bacteria 4204
72 Ga0105247_10020004 3300009101 Bacteria 4023
73 Ga0105243_10102010 3300009148 Bacteria 2383
74 Ga0105241_10066324 3300009174 Bacteria 2791
75 Ga0105241_10068986 3300009174 Bacteria 2741
76 Ga0105248_10006486 3300009177 Bacteria 12831
77 Ga0105237_10017374 3300009545 Bacteria 7458
78 Ga0105238_10028104 3300009551 Bacteria 5730
79 Ga0105238_10163728 3300009551 Bacteria 2200
80 Ga0105249_10001272 3300009553 Bacteria 22114
81 Ga0105239_10023503 3300010375 Bacteria 6789
82 Ga0105239_10040999 3300010375 Bacteria 5074
83 Ga0105239_10244146 3300010375 Bacteria 2016
84 Ga0105246_10006105 3300011119 Bacteria 7353
85 Ga0157371_10022927 3300013102 Bacteria 4566
86 Ga0157370_10010551 3300013104 Bacteria 9729
87 Ga0157369_10047289 3300013105 Bacteria 4673
88 Ga0157374_10029165 3300013296 Bacteria 4993
89 Ga0157374_10196903 3300013296 Bacteria 1972
90 Ga0157378_10124016 3300013297 Bacteria 2384
91 Ga0157372_10015213 3300013307 Bacteria 8240
92 Ga0157372_10191654 3300013307 Bacteria 2368
93 Ga0163163_10030552 3300014325 Bacteria 5192
94 Ga0157379_10020854 3300014968 Bacteria 5799
95 Ga0157376_10032459 3300014969 Bacteria 4193
96 Ga0163161_10004549 3300017792 Bacteria 9657
97 Ga0206353_11027924 3300020082 Bacteria 2917
98 Ga0207692_10002680 3300025898 Bacteria 6851
99 Ga0207680_10052107 3300025903 Bacteria 2450
100 Ga0207647_10084249 3300025904 Bacteria 1903
101 Ga0207685_10034812 3300025905 Bacteria 1833
102 Ga0207643_10034273 3300025908 Bacteria 2845
103 Ga0207684_10030852 3300025910 Bacteria 4562
104 Ga0207695_10113519 3300025913 Bacteria 2685
105 Ga0207671_10058141 3300025914 Bacteria 2866
106 Ga0207693_10001556 3300025915 Bacteria 20261
107 Ga0207660_10155362 3300025917 Bacteria 1761
108 Ga0207662_10044369 3300025918 Bacteria 2625
109 Ga0207657_10014682 3300025919 Bacteria 7631
110 Ga0207652_10133063 3300025921 Bacteria 2219
111 Ga0207652_10249246 3300025921 Bacteria 1601
112 Ga0207681_10064766 3300025923 Bacteria 2525
113 Ga0207687_10003238 3300025927 Bacteria 11033
114 Ga0207700_10117298 3300025928 Bacteria 2152
115 Ga0207664_10004283 3300025929 Bacteria 9658
116 Ga0207664_10018440 3300025929 Bacteria 5138
117 Ga0207664_10029061 3300025929 Bacteria 4208
118 Ga0207706_10078702 3300025933 Bacteria 2899
119 Ga0207686_10020683 3300025934 Bacteria 3763
120 Ga0207665_10000823 3300025939 Bacteria 21005
121 Ga0207665_10002701 3300025939 Bacteria 11894
122 Ga0207689_10032355 3300025942 Bacteria 4352
123 Ga0207661_10046892 3300025944 Bacteria 3428
124 Ga0207667_10052764 3300025949 Bacteria 4280
125 Ga0207651_10056543 3300025960 Bacteria 2701
126 Ga0207712_10013525 3300025961 Bacteria 5233
127 Ga0207639_10017098 3300026041 Bacteria 5139
128 Ga0207678_10001775 3300026067 Bacteria 19743
129 Ga0207708_10100018 3300026075 Bacteria 2243
130 Ga0207683_10001505 3300026121 Bacteria 21009
131 Ga0207698_10018555 3300026142 Bacteria 4743
132 Ga0268266_10037119 3300028379 Bacteria 4151
133 Ga0268266_10079337 3300028379 Bacteria 2858
134 Ga0268264_10206796 3300028381 Bacteria 1799
135 Ga0265336_10006781 3300028666 Bacteria 4102
136 Ga0307517_10080829 3300028786 Bacteria 2778
137 Ga0265338_10002561 3300028800 Bacteria 26893
138 Ga0265338_10020499 3300028800 Bacteria 6950
139 Ga0265340_10001192 3300031247 Bacteria 14844
140 Ga0265340_10031699 3300031247 Bacteria 2642
141 Ga0265339_10077100 3300031249 Bacteria 1767
142 Ga0265327_10000303 3300031251 Bacteria 95597
143 Ga0265327_10041511 3300031251 Bacteria 2479
144 Ga0307509_10021594 3300031507 Bacteria 7274
145 Ga0307514_10001295 3300031649 Bacteria 32437
146 Ga0307507_10000003 3300033179 Bacteria 371707
147 Ga0373929_0004042 3300035085 Bacteria 2629
148 Ga0373940_0003787 3300035088 Bacteria 3128
149 Ga0373941_0001471 3300035115 Bacteria 4974
150 Ga0373962_0003944 3300035242 Bacteria 3572
151 Ga0373931_0015264 3300035691 Bacteria 3766
152 Ga0373937_0079447 3300036401 Bacteria 3032
153 Ga0373937_0096555 3300036401 Bacteria 2741
154 Ga0373925_0002475 3300037068 Bacteria 14765
155 Ga0395900_0244161 3300037418 Bacteria 1800
156 Ga0395898_0151680 3300037466 Bacteria 2217
157 Ga0395901_0078894 3300038443 Bacteria 3438
158 Ga0436365_1371133 3300039437 Bacteria 5312
159 Ga0439449_0000455 3300042007 Bacteria 15259
160 Ga0450894_000041 3300042131 Bacteria 18796
161 Ga0450906_003083 3300042145 Bacteria 3611
162 Ga0466969_0000716 3300044656 Bacteria 17970
163 Ga0466969_0012044 3300044656 Bacteria 4570
164 Ga0466969_0022401 3300044656 Bacteria 3261
165 Ga0466972_0049661 3300044658 Bacteria 2026
166 Ga0466965_0001681 3300044683 Bacteria 9079
167 Ga0466965_0031613 3300044683 Bacteria 2582
168 Ga0466966_0004363 3300044684 Bacteria 9330
169 Ga0466966_0008524 3300044684 Bacteria 6789
170 Ga0466966_0023551 3300044684 Bacteria 4029
171 Ga0466961_0008184 3300044693 Bacteria 6660
172 Ga0466961_0015083 3300044693 Bacteria 4960
173 Ga0466961_0016970 3300044693 Bacteria 4677
174 Ga0466961_0022551 3300044693 Bacteria 4050
175 Ga0466961_0026012 3300044693 Bacteria 3762
176 Ga0466961_0026675 3300044693 Bacteria 3714
177 Ga0466963_0008612 3300044694 Bacteria 6123
178 Ga0466963_0008990 3300044694 Bacteria 5998
179 Ga0466963_0043640 3300044694 Bacteria 2949
180 Ga0466963_0108156 3300044694 Bacteria 1907
181 Ga0466963_0113174 3300044694 Bacteria 1864
182 Ga0466963_0150924 3300044694 Bacteria 1613
183 Ga0466964_0002200 3300044706 Bacteria 6900
184 Ga0466964_0029365 3300044706 Bacteria 2170
185 Ga0466971_0000279 3300044719 Bacteria 19515
186 Ga0466971_0002955 3300044719 Bacteria 7214
187 Ga0466971_0008419 3300044719 Bacteria 4499
188 Ga0466970_0003692 3300044765 Bacteria 7477
189 Ga0466970_0019312 3300044765 Bacteria 3533
190 Ga0466970_0057246 3300044765 Bacteria 2084
191 Ga0466957_0004145 3300044842 Bacteria 8031
192 Ga0466959_0000323 3300045049 Bacteria 28214
193 Ga0466959_0026304 3300045049 Bacteria 4313
194 Ga0466959_0038142 3300045049 Bacteria 3550
195 Ga0466959_0152300 3300045049 Bacteria 1629
196 Ga0466958_0019987 3300045836 Bacteria 3902
197 Ga0466958_0020219 3300045836 Bacteria 3881
198 Ga0466958_0030425 3300045836 Bacteria 3207
199 Ga0466958_0081057 3300045836 Bacteria 1997
200 Ga0466958_0106021 3300045836 Bacteria 1752
201 Ga0466967_0022529 3300045976 Bacteria 5142
202 Ga0466967_0033684 3300045976 Bacteria 4339
203 Ga0466967_0066933 3300045976 Bacteria 3202
204 Ga0466967_0072942 3300045976 Bacteria 3078
205 Ga0466967_0075528 3300045976 Bacteria 3029
206 Ga0466967_0086183 3300045976 Bacteria 2845
207 Ga0466967_0103772 3300045976 Bacteria 2602
208 Ga0466967_0287451 3300045976 Bacteria 1579
209 Ga0495592_0007465 3300046454 Bacteria 8192
210 Ga0495592_0011590 3300046454 Bacteria 6676
211 Ga0495592_0012501 3300046454 Bacteria 6451
212 Ga0495651_0001725 3300046462 Bacteria 16867
213 Ga0495651_0001849 3300046462 Bacteria 16376
214 Ga0495651_0037801 3300046462 Bacteria 3758
215 Ga0495653_0000616 3300046463 Bacteria 27212
216 Ga0495580_0029813 3300046472 Bacteria 3957
217 Ga0495662_0000604 3300046476 Bacteria 16590
218 Ga0495664_0037441 3300046477 Bacteria 2863
219 Ga0495664_0049771 3300046477 Bacteria 2487
220 Ga0495594_0020327 3300046499 Bacteria 3536
221 Ga0495594_0059262 3300046499 Bacteria 2117
222 Ga0495608_0005793 3300046511 Bacteria 8804
223 Ga0495628_0044055 3300046516 Bacteria 3551
224 Ga0495628_0103642 3300046516 Bacteria 2193
225 Ga0495666_0013498 3300046526 Bacteria 4073
226 Ga0495652_0003784 3300046529 Bacteria 14769
227 Ga0495652_0004405 3300046529 Bacteria 13463
228 Ga0495652_0024439 3300046529 Bacteria 5348
229 Ga0495665_0016770 3300046531 Bacteria 3943
230 Ga0495645_0055243 3300046543 Bacteria 2883
231 Ga0495667_0000339 3300046559 Bacteria 29607
232 Ga0495634_0068928 3300046642 Bacteria 2335
233 Ga0495635_0002753 3300046663 Bacteria 12054
234 Ga0495635_0006875 3300046663 Bacteria 7947
235 Ga0495657_0001909 3300046675 Bacteria 17732
236 Ga0495657_0016030 3300046675 Bacteria 5467
237 Ga0495599_0025639 3300046678 Bacteria 3691
238 Ga0495623_0015279 3300046679 Bacteria 4961
239 Ga0495646_0037871 3300046680 Bacteria 2981
240 Ga0495613_0018854 3300046689 Bacteria 5141
241 Ga0495600_0005662 3300046809 Bacteria 7547
242 Ga0495600_0018192 3300046809 Bacteria 4474
243 Ga0495604_0016179 3300047317 Bacteria 5960
244 Ga0495604_0017878 3300047317 Bacteria 5672
245 Ga0495674_0006389 3300047319 Bacteria 11298
246 Ga0495674_0017780 3300047319 Bacteria 6620
247 Ga0495676_0009043 3300047321 Bacteria 9088
248 Ga0495680_0000696 3300047322 Bacteria 37699
249 Ga0495675_0033892 3300047444 Bacteria 3259
250 Ga0495684_0031197 3300047471 Bacteria 4091
251 Ga0495684_0058540 3300047471 Bacteria 2935
252 Ga0495593_0013378 3300047673 Bacteria 4682
253 Ga0495602_0033651 3300048088 Bacteria 4804
254 Ga0495602_0215372 3300048088 Bacteria 1454
255 Ga0496101_0014878 3300048904 Bacteria 5236
256 Ga0496102_0000013 3300048905 Bacteria 311668
257 Ga0496102_0016141 3300048905 Bacteria 6523
258 Ga0496102_0105923 3300048905 Bacteria 2616
259 Ga0496102_0202474 3300048905 Bacteria 1871
260 Ga0496103_0000231 3300048906 Bacteria 54600
261 Ga0496103_0020669 3300048906 Bacteria 3956
262 Ga0496103_0057203 3300048906 Bacteria 2421
263 Ga0496103_0088251 3300048906 Bacteria 1955
264 Ga0496104_0000353 3300048907 Bacteria 41013
265 Ga0496104_0125259 3300048907 Bacteria 2467
266 Ga0496105_0000894 3300048908 Bacteria 20376
267 Ga0496106_0029895 3300048909 Bacteria 4061
268 Ga0496107_0041041 3300048910 Bacteria 3323
269 Ga0496107_0144770 3300048910 Bacteria 1757
270 Ga0496108_0003370 3300048911 Bacteria 12829
271 Ga0496108_0042988 3300048911 Bacteria 3773
272 Ga0496108_0161728 3300048911 Bacteria 1935
273 Ga0496109_0010124 3300048912 Bacteria 8044
274 Ga0496109_0016558 3300048912 Bacteria 6447
275 Ga0496110_0011267 3300048913 Bacteria 7309
276 Ga0496110_0037223 3300048913 Bacteria 4229
277 Ga0496111_0028703 3300048914 Bacteria 3943
278 Ga0496112_0001080 3300048915 Bacteria 20167
279 Ga0496112_0006118 3300048915 Bacteria 10519
280 Ga0496112_0074585 3300048915 Bacteria 3354
281 Ga0496112_0148837 3300048915 Bacteria 2309
282 Ga0496112_0156787 3300048915 Bacteria 2243
283 Ga0496113_0010158 3300048916 Bacteria 6213
284 Ga0496113_0015066 3300048916 Bacteria 5298
285 Ga0496114_0015265 3300048917 Bacteria 6174
286 Ga0496115_0066216 3300048918 Bacteria 2919
287 Ga0496119_0000276 3300048922 Bacteria 72490
288 Ga0496120_0003864 3300048923 Bacteria 13147
289 Ga0496126_0000075 3300048929 Bacteria 235121
290 Ga0496126_0208588 3300048929 Bacteria 1646
291 Ga0501031_0023861 3300049568 Bacteria 3988
292 Ga0501032_0015084 3300049569 Bacteria 5457
293 Ga0501032_0096958 3300049569 Bacteria 1954
294 Ga0501033_0018579 3300049570 Bacteria 5254
295 Ga0501033_0063527 3300049570 Bacteria 2717
296 Ga0501033_0079861 3300049570 Bacteria 2400
297 Ga0501033_0152163 3300049570 Bacteria 1669
298 Ga0501034_0002162 3300049571 Bacteria 24379
299 Ga0501034_0005694 3300049571 Bacteria 13545
300 Ga0501034_0144879 3300049571 Bacteria 2353
301 Ga0501036_0008872 3300049572 Bacteria 8256
302 Ga0501036_0040311 3300049572 Bacteria 3949
303 Ga0501038_0012135 3300049574 Bacteria 7868
304 Ga0501038_0053230 3300049574 Bacteria 3485
305 Ga0501039_0000885 3300049575 Bacteria 21756
306 Ga0501043_0006787 3300049579 Bacteria 9139
307 Ga0501047_0117840 3300049581 Bacteria 2537
308 Ga0501048_0004231 3300049582 Bacteria 10938
309 Ga0501068_0081056 3300049584 Bacteria 1992
310 Ga0501070_0002002 3300049586 Bacteria 17911
311 Ga0501070_0014360 3300049586 Bacteria 6665
312 Ga0501074_0002670 3300049590 Bacteria 12485
313 Ga0501081_0075710 3300049743 Bacteria 2350
314 Ga0501035_0018514 3300049822 Bacteria 6416
315 Ga0501035_0163763 3300049822 Bacteria 1924
316 Ga0501044_0010050 3300049823 Bacteria 10283
317 Ga0501044_0044114 3300049823 Bacteria 4630
318 Ga0501044_0203099 3300049823 Bacteria 1939
319 nmdc:mga08y16_182650_c1 3300050511 Bacteria 2177
320 nmdc:mga0rr50_37385_c1 3300050513 Bacteria 3504
321 nmdc:mga0a205_179155_c1 3300050515 Bacteria 2014
322 Ga0495601_0069761 3300053077 Bacteria 2242
323 Ga0495601_0135921 3300053077 Bacteria 1602
324 Ga0495612_0059126 3300053078 Bacteria 1584
325 Ga0466962_0001078 3300061719 Bacteria 12533
326 Ga0466962_0001198 3300061719 Bacteria 11914
327 Ga0466962_0001350 3300061719 Bacteria 11344
328 Ga0466962_0015358 3300061719 Bacteria 3691
329 2804849138 2802429296 Bacteria 7227771
330 2811843212 2808606982 Bacteria 7791042
331 2867374905 2867369537 Bacteria 6501581
332 2912764094 2912757875 Bacteria 7940295
333 2954009662 2954002825 Bacteria 9173742
334 2995470861 2995463766 Bacteria 8577691
335 3006486732 3006486233 Bacteria 8157040
336 8025535280 8025530807 Bacteria 8495698
337 Ga0501037_0065141
338 JGI25153J46596_10040772
339 rootH2_10008205
340 rootH1_10289385
341 Ga0070683_100040034
342 Ga0068869_100007942
343 Ga0070666_10075154
344 Ga0070682_100005523
345 Ga0070660_100016167
346 Ga0070689_100064051
347 Ga0070691_10009595
348 Ga0070687_100010638
349 Ga0070668_100003489
350 Ga0070669_100031096
351 Ga0070674_100023308
352 Ga0070673_100019493
353 Ga0070659_100025152
354 Ga0070709_10004553
355 Ga0070714_100048886
356 Ga0070714_100187933
357 Ga0070713_100007081
358 Ga0070713_100180150
359 Ga0070710_10011258
360 Ga0070711_100007616
361 Ga0070711_100059605
362 Ga0070711_100081832
363 Ga0070705_100013089
364 Ga0070694_100015797
365 Ga0070708_100032408
366 Ga0070663_100009920
367 Ga0070662_100056363
368 Ga0070685_10057158
369 Ga0070698_100000958
370 Ga0070679_100001302
371 Ga0070679_100014459
372 Ga0070684_100058242
373 Ga0068853_100030865
374 Ga0070686_100042515
375 Ga0070695_100014353
376 Ga0070696_100018250
377 Ga0070693_100015943
378 Ga0070665_100123458
379 Ga0070704_100001417
380 Ga0068857_100212457
381 Ga0068854_100077828
382 Ga0068852_100003545
383 Ga0068852_100016511
384 Ga0068859_100000488
385 Ga0068864_100087851
386 Ga0068861_100015703
387 Ga0068863_100013541
388 Ga0068863_100025519
389 Ga0068858_100024327
390 Ga0068860_100006769
391 Ga0081540_1000961
392 Ga0070717_10003177
393 Ga0070717_10023500
394 Ga0070717_10064503
395 Ga0070715_10001540
396 Ga0070716_100002203
397 Ga0070712_100075095
398 Ga0097621_100029174
399 Ga0068871_100045097
400 Ga0075433_10113606
401 Ga0075434_100017609
402 Ga0075436_100009307
403 Ga0097620_100000488
404 Ga0075435_100007080
405 Ga0105245_10006294
406 Ga0105245_10009629
407 Ga0105247_10018292
408 Ga0105247_10020004
409 Ga0105243_10102010
410 Ga0105241_10066324
411 Ga0105241_10068986
412 Ga0105248_10006486
413 Ga0105237_10017374
414 Ga0105238_10028104
415 Ga0105238_10163728
416 Ga0105249_10001272
417 Ga0105239_10023503
418 Ga0105239_10040999
419 Ga0105239_10244146
420 Ga0105246_10006105
421 Ga0157371_10022927
422 Ga0157370_10010551
423 Ga0157369_10047289
424 Ga0157374_10029165
425 Ga0157374_10196903
426 Ga0157378_10124016
427 Ga0157372_10015213
428 Ga0157372_10191654
429 Ga0163163_10030552
430 Ga0157379_10020854
431 Ga0157376_10032459
432 Ga0163161_10004549
433 Ga0206353_11027924
434 Ga0207692_10002680
435 Ga0207680_10052107
436 Ga0207647_10084249
437 Ga0207685_10034812
438 Ga0207643_10034273
439 Ga0207684_10030852
440 Ga0207695_10113519
441 Ga0207671_10058141
442 Ga0207693_10001556
443 Ga0207660_10155362
444 Ga0207662_10044369
445 Ga0207657_10014682
446 Ga0207652_10133063
447 Ga0207652_10249246
448 Ga0207681_10064766
449 Ga0207687_10003238
450 Ga0207700_10117298
451 Ga0207664_10004283
452 Ga0207664_10018440
453 Ga0207664_10029061
454 Ga0207706_10078702
455 Ga0207686_10020683
456 Ga0207665_10000823
457 Ga0207665_10002701
458 Ga0207689_10032355
459 Ga0207661_10046892
460 Ga0207667_10052764
461 Ga0207651_10056543
462 Ga0207712_10013525
463 Ga0207639_10017098
464 Ga0207678_10001775
465 Ga0207708_10100018
466 Ga0207683_10001505
467 Ga0207698_10018555
468 Ga0268266_10037119
469 Ga0268266_10079337
470 Ga0268264_10206796
471 Ga0265336_10006781
472 Ga0307517_10080829
473 Ga0265338_10002561
474 Ga0265338_10020499
475 Ga0265340_10001192
476 Ga0265340_10031699
477 Ga0265339_10077100
478 Ga0265327_10000303
479 Ga0265327_10041511
480 Ga0307509_10021594
481 Ga0307514_10001295
482 Ga0307507_10000003
483 Ga0373929_0004042
484 Ga0373940_0003787
485 Ga0373941_0001471
486 Ga0373962_0003944
487 Ga0373931_0015264
488 Ga0373937_0079447
489 Ga0373937_0096555
490 Ga0373925_0002475
491 Ga0395900_0244161
492 Ga0395898_0151680
493 Ga0395901_0078894
494 Ga0436365_1371133
495 Ga0439449_0000455
496 Ga0450894_000041
497 Ga0450906_003083
498 Ga0466969_0000716
499 Ga0466969_0012044
500 Ga0466969_0022401
501 Ga0466972_0049661
502 Ga0466965_0001681
503 Ga0466965_0031613
504 Ga0466966_0004363
505 Ga0466966_0008524
506 Ga0466966_0023551
507 Ga0466961_0008184
508 Ga0466961_0015083
509 Ga0466961_0016970
510 Ga0466961_0022551
511 Ga0466961_0026012
512 Ga0466961_0026675
513 Ga0466963_0008612
514 Ga0466963_0008990
515 Ga0466963_0043640
516 Ga0466963_0108156
517 Ga0466963_0113174
518 Ga0466963_0150924
519 Ga0466964_0002200
520 Ga0466964_0029365
521 Ga0466971_0000279
522 Ga0466971_0002955
523 Ga0466971_0008419
524 Ga0466970_0003692
525 Ga0466970_0019312
526 Ga0466970_0057246
527 Ga0466957_0004145
528 Ga0466959_0000323
529 Ga0466959_0026304
530 Ga0466959_0038142
531 Ga0466959_0152300
532 Ga0466958_0019987
533 Ga0466958_0020219
534 Ga0466958_0030425
535 Ga0466958_0081057
536 Ga0466958_0106021
537 Ga0466967_0022529
538 Ga0466967_0033684
539 Ga0466967_0066933
540 Ga0466967_0072942
541 Ga0466967_0075528
542 Ga0466967_0086183
543 Ga0466967_0103772
544 Ga0466967_0287451
545 Ga0495592_0007465
546 Ga0495592_0011590
547 Ga0495592_0012501
548 Ga0495651_0001725
549 Ga0495651_0001849
550 Ga0495651_0037801
551 Ga0495653_0000616
552 Ga0495580_0029813
553 Ga0495662_0000604
554 Ga0495664_0037441
555 Ga0495664_0049771
556 Ga0495594_0020327
557 Ga0495594_0059262
558 Ga0495608_0005793
559 Ga0495628_0044055
560 Ga0495628_0103642
561 Ga0495666_0013498
562 Ga0495652_0003784
563 Ga0495652_0004405
564 Ga0495652_0024439
565 Ga0495665_0016770
566 Ga0495645_0055243
567 Ga0495667_0000339
568 Ga0495634_0068928
569 Ga0495635_0002753
570 Ga0495635_0006875
571 Ga0495657_0001909
572 Ga0495657_0016030
573 Ga0495599_0025639
574 Ga0495623_0015279
575 Ga0495646_0037871
576 Ga0495613_0018854
577 Ga0495600_0005662
578 Ga0495600_0018192
579 Ga0495604_0016179
580 Ga0495604_0017878
581 Ga0495674_0006389
582 Ga0495674_0017780
583 Ga0495676_0009043
584 Ga0495680_0000696
585 Ga0495675_0033892
586 Ga0495684_0031197
587 Ga0495684_0058540
588 Ga0495593_0013378
589 Ga0495602_0033651
590 Ga0495602_0215372
591 Ga0496101_0014878
592 Ga0496102_0000013
593 Ga0496102_0016141
594 Ga0496102_0105923
595 Ga0496102_0202474
596 Ga0496103_0000231
597 Ga0496103_0020669
598 Ga0496103_0057203
599 Ga0496103_0088251
600 Ga0496104_0000353
601 Ga0496104_0125259
602 Ga0496105_0000894
603 Ga0496106_0029895
604 Ga0496107_0041041
605 Ga0496107_0144770
606 Ga0496108_0003370
607 Ga0496108_0042988
608 Ga0496108_0161728
609 Ga0496109_0010124
610 Ga0496109_0016558
611 Ga0496110_0011267
612 Ga0496110_0037223
613 Ga0496111_0028703
614 Ga0496112_0001080
615 Ga0496112_0006118
616 Ga0496112_0074585
617 Ga0496112_0148837
618 Ga0496112_0156787
619 Ga0496113_0010158
620 Ga0496113_0015066
621 Ga0496114_0015265
622 Ga0496115_0066216
623 Ga0496119_0000276
624 Ga0496120_0003864
625 Ga0496126_0000075
626 Ga0496126_0208588
627 Ga0501031_0023861
628 Ga0501032_0015084
629 Ga0501032_0096958
630 Ga0501033_0018579
631 Ga0501033_0063527
632 Ga0501033_0079861
633 Ga0501033_0152163
634 Ga0501034_0002162
635 Ga0501034_0005694
636 Ga0501034_0144879
637 Ga0501036_0008872
638 Ga0501036_0040311
639 Ga0501038_0012135
640 Ga0501038_0053230
641 Ga0501039_0000885
642 Ga0501043_0006787
643 Ga0501047_0117840
644 Ga0501048_0004231
645 Ga0501068_0081056
646 Ga0501070_0002002
647 Ga0501070_0014360
648 Ga0501074_0002670
649 Ga0501081_0075710
650 Ga0501035_0018514
651 Ga0501035_0163763
652 Ga0501044_0010050
653 Ga0501044_0044114
654 Ga0501044_0203099
655 nmdc:mga08y16_182650_c1
656 nmdc:mga0rr50_37385_c1
657 nmdc:mga0a205_179155_c1
658 Ga0495601_0069761
659 Ga0495601_0135921
660 Ga0495612_0059126
661 Ga0466962_0001078
662 Ga0466962_0001198
663 Ga0466962_0001350
664 Ga0466962_0015358
665 2804849138
666 2811843212
667 2867374905
668 2912764094
669 2954009662
670 2995470861
671 3006486732
672 8025535280

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

41

441

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wkh-assembly1.cif.gz_B acetylornithine aminotransferase from thermus thermophilus hb8 0.9359 45 441
2eh6-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5 0.9227 45 440
7nn4-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid. 0.9183 45 444
2ord-assembly1.cif.gz_B crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution 0.9138 44 442
4ppm-assembly1.cif.gz_B crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. fs14 0.9123 10 446
ID Description Score Start End Superfamily
af_P42588_355_453_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9419 331 444 3.90.1150.10
af_P9WQ77_356_444_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9341 333 439 3.90.1150.10
2cinA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9338 332 440 3.90.1150.10
2eh6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9268 333 440 3.90.1150.10
af_Q10174_149_357_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9244 121 322 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2V5K3V9-F1-model_v4 Aspartate aminotransferase family protein 0.9695 9 135 GO:0008483
GO:0030170
GO:0042802
AF-D8F3N8-F1-model_v4 Putative Putrescine aminotransferase 0.9618 10 461 GO:0008483
GO:0030170
GO:0042802
AF-A0A1Y2ZWP5-F1-model_v4 Aminotransferase 0.9612 9 462 GO:0008483
GO:0030170
GO:0042802
AF-A0A832E9I1-F1-model_v4 Aspartate aminotransferase family protein 0.9606 12 461 GO:0008483
GO:0030170
GO:0042802
AF-A0A7S6S8H0-F1-model_v4 Aspartate aminotransferase family protein 0.9568 10 464 GO:0008483
GO:0030170
GO:0042802

Map