F412751

General Info

Members Datasets Scaffolds Average Seq Length
336 219 672 244

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0009875|Ga0373925_0009875_5782_6579
Length 265
Sequence MTSPLLELDGVTKRFGQVVIAEDLSLAVGAGDTVGIVGPNGAGKTSLFGLISGDLAPGAGEVRFGGRPVTKLDAAGRSRLGIGRTYQVPRPFGDMTVFENLLVAAQQGGGLRRKASYVAAVGALERTGMSAHANAPAERLGLLHRKRLELARALATQPALLLLDEVAGGLTDPEVAQLVEIVRGVNAEGIAVIWIEHVVRALTPVVGRLICLAGGKFVGDGAPATVLADPAVREVFLGTEVTASLAGGTLEAPLPDGEHRAEEAP

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
209 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
210 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
213 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
216 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
219 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 1.19
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0.3
Rhizoplane 4.17
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0009875 3300037068 Bacteria 6935
2 Ga0070658_10038850 3300005327 Bacteria 3839
3 Ga0070658_10208263 3300005327 Bacteria 1651
4 Ga0070658_10209543 3300005327 Bacteria 1646
5 Ga0070683_100415093 3300005329 Bacteria 1284
6 Ga0070683_100614347 3300005329 Bacteria 1041
7 Ga0070680_100007345 3300005336 Bacteria 8406
8 Ga0070660_100044006 3300005339 Bacteria 3412
9 Ga0070660_100194327 3300005339 Bacteria 1644
10 Ga0070689_100151070 3300005340 Bacteria 1873
11 Ga0070687_100017069 3300005343 Bacteria 3330
12 Ga0070661_100004916 3300005344 Bacteria 9200
13 Ga0070668_100025455 3300005347 Bacteria 4485
14 Ga0070671_100492830 3300005355 Bacteria 1054
15 Ga0070688_100385538 3300005365 Bacteria 1034
16 Ga0070659_100312238 3300005366 Bacteria 1313
17 Ga0070667_100387989 3300005367 Bacteria 1269
18 Ga0070709_10135708 3300005434 Bacteria 1685
19 Ga0070709_10366425 3300005434 Bacteria 1068
20 Ga0070714_100318441 3300005435 Bacteria 1454
21 Ga0070713_100223566 3300005436 Bacteria 1708
22 Ga0070711_100305503 3300005439 Bacteria 1266
23 Ga0070700_100114412 3300005441 Bacteria 1799
24 Ga0070663_100118589 3300005455 Bacteria 1996
25 Ga0070681_10010042 3300005458 Bacteria 9331
26 Ga0070681_10522191 3300005458 Bacteria 1101
27 Ga0070679_100056594 3300005530 Bacteria 3907
28 Ga0070679_100091225 3300005530 Bacteria 3034
29 Ga0070679_100129605 3300005530 Bacteria 2504
30 Ga0070679_100146763 3300005530 Bacteria 2336
31 Ga0070684_100209376 3300005535 Bacteria 1777
32 Ga0070684_100278100 3300005535 Bacteria 1533
33 Ga0070684_100504326 3300005535 Bacteria 1121
34 Ga0070684_100505208 3300005535 Bacteria 1120
35 Ga0068853_100093080 3300005539 Bacteria 2653
36 Ga0068853_100230829 3300005539 Bacteria 1693
37 Ga0068853_100371883 3300005539 Bacteria 1333
38 Ga0070695_100124601 3300005545 Bacteria 1768
39 Ga0070665_100025493 3300005548 Bacteria 5956
40 Ga0070665_100225153 3300005548 Bacteria 1876
41 Ga0068855_100290316 3300005563 Bacteria 1813
42 Ga0070664_100079437 3300005564 Bacteria 2824
43 Ga0070664_100121821 3300005564 Bacteria 2284
44 Ga0068857_100052428 3300005577 Bacteria 3620
45 Ga0068857_100244459 3300005577 Bacteria 1644
46 Ga0068856_100270359 3300005614 Bacteria 1716
47 Ga0068856_100314563 3300005614 Bacteria 1583
48 Ga0068852_100178967 3300005616 Archaea 1993
49 Ga0068852_100422322 3300005616 Bacteria 1315
50 Ga0068852_100570171 3300005616 Bacteria 1134
51 Ga0068864_100105649 3300005618 Bacteria 2503
52 Ga0068864_100150779 3300005618 Bacteria 2106
53 Ga0068864_100364845 3300005618 Bacteria 1366
54 Ga0068863_100319632 3300005841 Bacteria 1508
55 Ga0068858_100015343 3300005842 Bacteria 7207
56 Ga0068858_100341969 3300005842 Bacteria 1432
57 Ga0068860_100050640 3300005843 Bacteria 3953
58 Ga0081540_1037275 3300005983 Bacteria 2580
59 Ga0070717_10111413 3300006028 Bacteria 2335
60 Ga0075363_100052064 3300006048 Bacteria 2185
61 Ga0070715_10002358 3300006163 Bacteria 5780
62 Ga0070715_10120853 3300006163 Bacteria 1248
63 Ga0070715_10269247 3300006163 Bacteria 898
64 Ga0070716_100150906 3300006173 Bacteria 1494
65 Ga0070712_100125765 3300006175 Bacteria 1936
66 Ga0070712_100189671 3300006175 Bacteria 1608
67 Ga0075430_100038924 3300006846 Bacteria 4026
68 Ga0075436_100216623 3300006914 Bacteria 1358
69 Ga0105240_10025242 3300009093 Bacteria 7814
70 Ga0105245_10072113 3300009098 Bacteria 3137
71 Ga0105245_10334228 3300009098 Bacteria 1496
72 Ga0105247_10584670 3300009101 Bacteria 826
73 Ga0105243_10609336 3300009148 Bacteria 1052
74 Ga0105241_10040025 3300009174 Bacteria 3537
75 Ga0105248_10126434 3300009177 Bacteria 2883
76 Ga0105237_10233044 3300009545 Bacteria 1842
77 Ga0105238_10038065 3300009551 Bacteria 4887
78 Ga0105238_10136143 3300009551 Bacteria 2434
79 Ga0105239_10177657 3300010375 Bacteria 2381
80 Ga0157373_10130956 3300013100 Bacteria 1764
81 Ga0157373_10388118 3300013100 Bacteria 999
82 Ga0157371_10200701 3300013102 Bacteria 1430
83 Ga0157371_10307237 3300013102 Bacteria 1149
84 Ga0157370_10096921 3300013104 Bacteria 2767
85 Ga0157370_10152671 3300013104 Bacteria 2149
86 Ga0157369_10003648 3300013105 Bacteria 18268
87 Ga0157369_10142963 3300013105 Bacteria 2531
88 Ga0157369_10529035 3300013105 Bacteria 1219
89 Ga0157374_10004383 3300013296 Bacteria 11877
90 Ga0157374_10667231 3300013296 Bacteria 1052
91 Ga0157374_10766087 3300013296 Bacteria 980
92 Ga0157372_10103129 3300013307 Bacteria 3259
93 Ga0157372_10389231 3300013307 Bacteria 1624
94 Ga0157372_10431327 3300013307 Bacteria 1536
95 Ga0157372_10435661 3300013307 Bacteria 1528
96 Ga0157372_11197397 3300013307 Bacteria 878
97 Ga0157375_10367526 3300013308 Bacteria 1605
98 Ga0157375_10825988 3300013308 Bacteria 1074
99 Ga0163163_10016973 3300014325 Bacteria 6779
100 Ga0163163_10073847 3300014325 Bacteria 3402
101 Ga0157379_10185437 3300014968 Bacteria 1880
102 Ga0157379_10371854 3300014968 Bacteria 1311
103 Ga0206356_11182983 3300020070 Bacteria 1953
104 Ga0206354_11135024 3300020081 Bacteria 973
105 Ga0206353_11714449 3300020082 Bacteria 3353
106 Ga0206353_11930625 3300020082 Bacteria 9682
107 Ga0213872_10002606 3300021361 Bacteria 10483
108 Ga0213872_10026009 3300021361 Bacteria 2689
109 Ga0213875_10000442 3300021388 Bacteria 36242
110 Ga0207699_10017430 3300025906 Bacteria 3779
111 Ga0207699_10127572 3300025906 Bacteria 1654
112 Ga0207699_10200902 3300025906 Bacteria 1351
113 Ga0207705_10037287 3300025909 Bacteria 3478
114 Ga0207707_10001202 3300025912 Bacteria 24360
115 Ga0207707_10102465 3300025912 Bacteria 2502
116 Ga0207695_10060408 3300025913 Bacteria 3924
117 Ga0207695_10128433 3300025913 Bacteria 2494
118 Ga0207695_10222648 3300025913 Bacteria 1794
119 Ga0207671_10142486 3300025914 Bacteria 1848
120 Ga0207693_10015011 3300025915 Bacteria 6218
121 Ga0207693_10031048 3300025915 Bacteria 4220
122 Ga0207693_10185170 3300025915 Bacteria 1639
123 Ga0207663_10101879 3300025916 Bacteria 1930
124 Ga0207660_10006683 3300025917 Bacteria 7476
125 Ga0207660_10146664 3300025917 Bacteria 1809
126 Ga0207662_10014770 3300025918 Bacteria 4384
127 Ga0207657_10001621 3300025919 Bacteria 24215
128 Ga0207657_10003088 3300025919 Bacteria 17820
129 Ga0207649_10506291 3300025920 Bacteria 919
130 Ga0207652_10004151 3300025921 Bacteria 11816
131 Ga0207652_10023029 3300025921 Bacteria 5159
132 Ga0207652_10108996 3300025921 Bacteria 2454
133 Ga0207652_10115571 3300025921 Bacteria 2383
134 Ga0207694_10052209 3300025924 Bacteria 3169
135 Ga0207694_10140838 3300025924 Bacteria 1939
136 Ga0207687_10412586 3300025927 Bacteria 1113
137 Ga0207664_10034210 3300025929 Bacteria 3912
138 Ga0207664_10123112 3300025929 Bacteria 2173
139 Ga0207664_10208763 3300025929 Bacteria 1689
140 Ga0207690_10139038 3300025932 Bacteria 1787
141 Ga0207665_10000635 3300025939 Bacteria 23623
142 Ga0207665_10215313 3300025939 Bacteria 1405
143 Ga0207711_10640989 3300025941 Bacteria 991
144 Ga0207661_10001370 3300025944 Bacteria 16351
145 Ga0207661_10408541 3300025944 Bacteria 1232
146 Ga0207679_10065052 3300025945 Bacteria 2728
147 Ga0207667_10369825 3300025949 Bacteria 1461
148 Ga0207658_10064003 3300025986 Bacteria 2757
149 Ga0207703_10266833 3300026035 Bacteria 1549
150 Ga0207703_10352006 3300026035 Bacteria 1356
151 Ga0207639_10056049 3300026041 Bacteria 3019
152 Ga0207639_10159665 3300026041 Bacteria 1898
153 Ga0207639_10209304 3300026041 Bacteria 1678
154 Ga0207678_10035238 3300026067 Bacteria 4357
155 Ga0207678_10112029 3300026067 Bacteria 2328
156 Ga0207708_10053365 3300026075 Bacteria 3080
157 Ga0207708_10281229 3300026075 Bacteria 1348
158 Ga0207641_10384328 3300026088 Bacteria 1345
159 Ga0207676_10091234 3300026095 Bacteria 2502
160 Ga0207676_10727303 3300026095 Bacteria 964
161 Ga0207674_10036306 3300026116 Bacteria 5137
162 Ga0207674_10245292 3300026116 Bacteria 1738
163 Ga0207698_10134482 3300026142 Bacteria 2119
164 Ga0268266_10053615 3300028379 Bacteria 3465
165 Ga0268264_10180031 3300028381 Bacteria 1919
166 Ga0265319_1001850 3300028563 Bacteria 12060
167 Ga0265318_10011811 3300028577 Bacteria 3742
168 Ga0307517_10072961 3300028786 Bacteria 3051
169 Ga0307517_10144068 3300028786 Bacteria 1660
170 Ga0307515_10005076 3300028794 Bacteria 26768
171 Ga0307515_10008672 3300028794 Bacteria 19783
172 Ga0307515_10010704 3300028794 Bacteria 17528
173 Ga0307515_10047120 3300028794 Bacteria 6565
174 Ga0265338_10042462 3300028800 Bacteria 4234
175 Ga0265338_10148392 3300028800 Bacteria 1826
176 Ga0265324_10003291 3300029957 Bacteria 7765
177 Ga0307512_10002346 3300030522 Bacteria 24274
178 Ga0307512_10007629 3300030522 Bacteria 10674
179 Ga0307512_10102009 3300030522 Bacteria 1938
180 Ga0265330_10072107 3300031235 Bacteria 1494
181 Ga0265320_10001741 3300031240 Bacteria 15447
182 Ga0265320_10015790 3300031240 Bacteria 4256
183 Ga0265325_10010818 3300031241 Bacteria 5263
184 Ga0265340_10004616 3300031247 Bacteria 7670
185 Ga0265339_10110649 3300031249 Bacteria 1421
186 Ga0265316_10300179 3300031344 Bacteria 1170
187 Ga0307513_10000738 3300031456 Bacteria 46966
188 Ga0307509_10033496 3300031507 Bacteria 5655
189 Ga0307508_10009789 3300031616 Bacteria 8785
190 Ga0307508_10019900 3300031616 Bacteria 6099
191 Ga0307508_10030824 3300031616 Bacteria 4846
192 Ga0307508_10101095 3300031616 Bacteria 2479
193 Ga0265314_10221697 3300031711 Bacteria 1103
194 Ga0307516_10017803 3300031730 Bacteria 7401
195 Ga0307507_10094214 3300033179 Bacteria 2547
196 Ga0307507_10233355 3300033179 Bacteria 1216
197 Ga0373950_0019900 3300034818 Bacteria 1176
198 Ga0373940_0001629 3300035088 Bacteria 4126
199 Ga0373949_0000256 3300035090 Bacteria 19945
200 Ga0373936_0000016 3300035113 Bacteria 198547
201 Ga0373939_0020393 3300035114 Bacteria 1800
202 Ga0373941_0002941 3300035115 Bacteria 3806
203 Ga0373955_0042365 3300035172 Bacteria 2444
204 Ga0373942_0000112 3300035207 Bacteria 18610
205 Ga0373962_0006664 3300035242 Bacteria 2801
206 Ga0316574_0038586 3300035398 Bacteria 2933
207 Ga0373931_0374615 3300035691 Bacteria 896
208 Ga0373935_0011469 3300035692 Bacteria 5320
209 Ga0373937_0453132 3300036401 Bacteria 1218
210 Ga0373925_0001904 3300037068 Bacteria 17313
211 Ga0373925_0149573 3300037068 Bacteria 1833
212 Ga0373925_0173284 3300037068 Bacteria 1704
213 Ga0395900_0068923 3300037418 Bacteria 3635
214 Ga0395898_0001897 3300037466 Bacteria 26654
215 Ga0436364_0029165 3300037853 Bacteria 38556
216 Ga0436361_0582671 3300039447 Bacteria 6944
217 Ga0436361_1196097 3300039447 Bacteria 7302
218 Ga0451793_0705448 3300041452 Bacteria 1359
219 Ga0451849_1373223 3300041505 Bacteria 1109
220 Ga0451853_3884817 3300041512 Bacteria 1308
221 Ga0466961_0043019 3300044693 Bacteria 2894
222 Ga0466963_0003560 3300044694 Bacteria 8949
223 Ga0466963_0004368 3300044694 Bacteria 8210
224 Ga0466963_0005343 3300044694 Bacteria 7512
225 Ga0466963_0013646 3300044694 Bacteria 4994
226 Ga0466963_0013936 3300044694 Bacteria 4951
227 Ga0466963_0015383 3300044694 Bacteria 4736
228 Ga0466963_0043915 3300044694 Bacteria 2940
229 Ga0466963_0202729 3300044694 Bacteria 1388
230 Ga0466963_0505248 3300044694 Bacteria 853
231 Ga0466959_0125265 3300045049 Bacteria 1824
232 Ga0466967_0003223 3300045976 Bacteria 10548
233 Ga0466967_0006090 3300045976 Bacteria 8483
234 Ga0466967_0025969 3300045976 Bacteria 4841
235 Ga0466967_0062729 3300045976 Bacteria 3300
236 Ga0466967_0103407 3300045976 Bacteria 2606
237 Ga0466967_0111821 3300045976 Bacteria 2510
238 Ga0466967_0195470 3300045976 Bacteria 1913
239 Ga0466967_0237397 3300045976 Bacteria 1738
240 Ga0466967_0348721 3300045976 Bacteria 1432
241 Ga0495592_0007029 3300046454 Bacteria 8415
242 Ga0495629_0176011 3300046459 Bacteria 1484
243 Ga0495629_0281564 3300046459 Bacteria 1141
244 Ga0495638_0153021 3300046460 Bacteria 1337
245 Ga0495651_0005131 3300046462 Bacteria 9989
246 Ga0495653_0031702 3300046463 Bacteria 4200
247 Ga0495580_0054656 3300046472 Bacteria 2815
248 Ga0495662_0001846 3300046476 Bacteria 10614
249 Ga0495664_0009368 3300046477 Bacteria 5477
250 Ga0495608_0013977 3300046511 Bacteria 5568
251 Ga0495628_0072529 3300046516 Bacteria 2683
252 Ga0495628_0086142 3300046516 Bacteria 2436
253 Ga0495630_0133382 3300046517 Bacteria 1886
254 Ga0495632_0026995 3300046519 Bacteria 3014
255 Ga0495666_0009337 3300046526 Bacteria 4906
256 Ga0495652_0094609 3300046529 Bacteria 2436
257 Ga0495665_0027304 3300046531 Bacteria 3064
258 Ga0495640_0004985 3300046533 Bacteria 10545
259 Ga0495587_0017986 3300046536 Bacteria 4382
260 Ga0495645_0016340 3300046543 Bacteria 5296
261 Ga0495645_0197403 3300046543 Bacteria 1367
262 Ga0495622_0059173 3300046557 Bacteria 1774
263 Ga0495667_0420972 3300046559 Bacteria 840
264 Ga0495634_0084713 3300046642 Bacteria 2066
265 Ga0495635_0066168 3300046663 Bacteria 2478
266 Ga0495657_0003698 3300046675 Bacteria 12391
267 Ga0495599_0041142 3300046678 Bacteria 2902
268 Ga0495623_0074610 3300046679 Bacteria 2107
269 Ga0495646_0003637 3300046680 Bacteria 9619
270 Ga0495613_0076215 3300046689 Bacteria 2440
271 Ga0495649_0198109 3300046694 Bacteria 1044
272 Ga0495600_0004683 3300046809 Bacteria 8202
273 Ga0495581_0050422 3300047315 Bacteria 2404
274 Ga0495581_0058087 3300047315 Bacteria 2233
275 Ga0495604_0000605 3300047317 Bacteria 30873
276 Ga0495604_0020293 3300047317 Bacteria 5311
277 Ga0495674_0056874 3300047319 Bacteria 3425
278 Ga0495674_0090921 3300047319 Bacteria 2607
279 Ga0495675_0062824 3300047444 Bacteria 2350
280 Ga0495684_0003648 3300047471 Bacteria 11990
281 Ga0495593_0051961 3300047673 Bacteria 2167
282 Ga0495602_0034184 3300048088 Bacteria 4759
283 Ga0496104_0005570 3300048907 Bacteria 11027
284 Ga0496105_0024933 3300048908 Bacteria 4862
285 Ga0496105_0065792 3300048908 Bacteria 2992
286 Ga0496108_0005677 3300048911 Bacteria 10102
287 Ga0496109_0006832 3300048912 Bacteria 9620
288 Ga0496109_0185791 3300048912 Bacteria 1953
289 Ga0496110_0040484 3300048913 Bacteria 4061
290 Ga0496110_0081058 3300048913 Bacteria 2893
291 Ga0496111_0604928 3300048914 Bacteria 802
292 Ga0496112_0022687 3300048915 Bacteria 5986
293 Ga0496113_0069355 3300048916 Bacteria 2677
294 Ga0496114_0100125 3300048917 Bacteria 2473
295 Ga0496114_0212716 3300048917 Bacteria 1696
296 Ga0501031_0023374 3300049568 Bacteria 4030
297 Ga0501033_0302532 3300049570 Bacteria 1126
298 Ga0501036_0296866 3300049572 Bacteria 1351
299 Ga0501037_0171177 3300049573 Bacteria 1543
300 Ga0501043_0105861 3300049579 Bacteria 2209
301 Ga0501047_0080868 3300049581 Bacteria 3124
302 Ga0501047_0360535 3300049581 Bacteria 1289
303 Ga0501069_0019923 3300049585 Bacteria 3630
304 Ga0501069_0186075 3300049585 Bacteria 1201
305 Ga0501070_0000619 3300049586 Bacteria 32593
306 Ga0501070_0034688 3300049586 Bacteria 4217
307 Ga0501070_0282630 3300049586 Bacteria 1354
308 Ga0501072_0333089 3300049588 Bacteria 1206
309 Ga0501035_0378160 3300049822 Bacteria 1181
310 Ga0501045_0326300 3300049824 Bacteria 1142
311 nmdc:mga03n38_16766_c1 3300050490 Bacteria 2857
312 nmdc:mga09592_45059_c1 3300050508 Bacteria 3715
313 nmdc:mga0qj67_88826_c1 3300050509 Bacteria 2482
314 nmdc:mga06r32_16555_c1 3300050510 Bacteria 6721
315 nmdc:mga0n895_304334_c1 3300050512 Bacteria 1616
316 nmdc:mga08x19_386145_c1 3300050514 Bacteria 981
317 Ga0495601_0162354 3300053077 Bacteria 1460
318 Ga0500635_0003108 3300053080 Bacteria 4152
319 Ga0500644_0008997 3300053088 Bacteria 2655
320 Ga0500646_0004509 3300053090 Bacteria 3527
321 Ga0500566_0032836 3300053094 Bacteria 3026
322 Ga0500566_0098028 3300053094 Bacteria 1611
323 Ga0500654_101019 3300053099 Bacteria 1231
324 Ga0500597_015483 3300053120 Bacteria 2886
325 Ga0500597_026514 3300053120 Bacteria 2346
326 Ga0500617_090887 3300053124 Bacteria 1306
327 Ga0500573_0125576 3300053140 Bacteria 1425
328 Ga0500579_142214 3300053143 Bacteria 1079
329 Ga0500588_0002691 3300053146 Bacteria 3653
330 Ga0500590_125572 3300053148 Bacteria 1195
331 Ga0500603_001011 3300053150 Bacteria 6615
332 Ga0500630_029488 3300053159 Bacteria 2700
333 Ga0500630_067639 3300053159 Bacteria 1696
334 Ga0500636_0173345 3300053177 Bacteria 1165
335 2513714569 2513237104 Bacteria 10034502
336 2753271205 2751185782 Bacteria 11227053
337 Ga0373925_0009875
338 Ga0070658_10038850
339 Ga0070658_10208263
340 Ga0070658_10209543
341 Ga0070683_100415093
342 Ga0070683_100614347
343 Ga0070680_100007345
344 Ga0070660_100044006
345 Ga0070660_100194327
346 Ga0070689_100151070
347 Ga0070687_100017069
348 Ga0070661_100004916
349 Ga0070668_100025455
350 Ga0070671_100492830
351 Ga0070688_100385538
352 Ga0070659_100312238
353 Ga0070667_100387989
354 Ga0070709_10135708
355 Ga0070709_10366425
356 Ga0070714_100318441
357 Ga0070713_100223566
358 Ga0070711_100305503
359 Ga0070700_100114412
360 Ga0070663_100118589
361 Ga0070681_10010042
362 Ga0070681_10522191
363 Ga0070679_100056594
364 Ga0070679_100091225
365 Ga0070679_100129605
366 Ga0070679_100146763
367 Ga0070684_100209376
368 Ga0070684_100278100
369 Ga0070684_100504326
370 Ga0070684_100505208
371 Ga0068853_100093080
372 Ga0068853_100230829
373 Ga0068853_100371883
374 Ga0070695_100124601
375 Ga0070665_100025493
376 Ga0070665_100225153
377 Ga0068855_100290316
378 Ga0070664_100079437
379 Ga0070664_100121821
380 Ga0068857_100052428
381 Ga0068857_100244459
382 Ga0068856_100270359
383 Ga0068856_100314563
384 Ga0068852_100178967
385 Ga0068852_100422322
386 Ga0068852_100570171
387 Ga0068864_100105649
388 Ga0068864_100150779
389 Ga0068864_100364845
390 Ga0068863_100319632
391 Ga0068858_100015343
392 Ga0068858_100341969
393 Ga0068860_100050640
394 Ga0081540_1037275
395 Ga0070717_10111413
396 Ga0075363_100052064
397 Ga0070715_10002358
398 Ga0070715_10120853
399 Ga0070715_10269247
400 Ga0070716_100150906
401 Ga0070712_100125765
402 Ga0070712_100189671
403 Ga0075430_100038924
404 Ga0075436_100216623
405 Ga0105240_10025242
406 Ga0105245_10072113
407 Ga0105245_10334228
408 Ga0105247_10584670
409 Ga0105243_10609336
410 Ga0105241_10040025
411 Ga0105248_10126434
412 Ga0105237_10233044
413 Ga0105238_10038065
414 Ga0105238_10136143
415 Ga0105239_10177657
416 Ga0157373_10130956
417 Ga0157373_10388118
418 Ga0157371_10200701
419 Ga0157371_10307237
420 Ga0157370_10096921
421 Ga0157370_10152671
422 Ga0157369_10003648
423 Ga0157369_10142963
424 Ga0157369_10529035
425 Ga0157374_10004383
426 Ga0157374_10667231
427 Ga0157374_10766087
428 Ga0157372_10103129
429 Ga0157372_10389231
430 Ga0157372_10431327
431 Ga0157372_10435661
432 Ga0157372_11197397
433 Ga0157375_10367526
434 Ga0157375_10825988
435 Ga0163163_10016973
436 Ga0163163_10073847
437 Ga0157379_10185437
438 Ga0157379_10371854
439 Ga0206356_11182983
440 Ga0206354_11135024
441 Ga0206353_11714449
442 Ga0206353_11930625
443 Ga0213872_10002606
444 Ga0213872_10026009
445 Ga0213875_10000442
446 Ga0207699_10017430
447 Ga0207699_10127572
448 Ga0207699_10200902
449 Ga0207705_10037287
450 Ga0207707_10001202
451 Ga0207707_10102465
452 Ga0207695_10060408
453 Ga0207695_10128433
454 Ga0207695_10222648
455 Ga0207671_10142486
456 Ga0207693_10015011
457 Ga0207693_10031048
458 Ga0207693_10185170
459 Ga0207663_10101879
460 Ga0207660_10006683
461 Ga0207660_10146664
462 Ga0207662_10014770
463 Ga0207657_10001621
464 Ga0207657_10003088
465 Ga0207649_10506291
466 Ga0207652_10004151
467 Ga0207652_10023029
468 Ga0207652_10108996
469 Ga0207652_10115571
470 Ga0207694_10052209
471 Ga0207694_10140838
472 Ga0207687_10412586
473 Ga0207664_10034210
474 Ga0207664_10123112
475 Ga0207664_10208763
476 Ga0207690_10139038
477 Ga0207665_10000635
478 Ga0207665_10215313
479 Ga0207711_10640989
480 Ga0207661_10001370
481 Ga0207661_10408541
482 Ga0207679_10065052
483 Ga0207667_10369825
484 Ga0207658_10064003
485 Ga0207703_10266833
486 Ga0207703_10352006
487 Ga0207639_10056049
488 Ga0207639_10159665
489 Ga0207639_10209304
490 Ga0207678_10035238
491 Ga0207678_10112029
492 Ga0207708_10053365
493 Ga0207708_10281229
494 Ga0207641_10384328
495 Ga0207676_10091234
496 Ga0207676_10727303
497 Ga0207674_10036306
498 Ga0207674_10245292
499 Ga0207698_10134482
500 Ga0268266_10053615
501 Ga0268264_10180031
502 Ga0265319_1001850
503 Ga0265318_10011811
504 Ga0307517_10072961
505 Ga0307517_10144068
506 Ga0307515_10005076
507 Ga0307515_10008672
508 Ga0307515_10010704
509 Ga0307515_10047120
510 Ga0265338_10042462
511 Ga0265338_10148392
512 Ga0265324_10003291
513 Ga0307512_10002346
514 Ga0307512_10007629
515 Ga0307512_10102009
516 Ga0265330_10072107
517 Ga0265320_10001741
518 Ga0265320_10015790
519 Ga0265325_10010818
520 Ga0265340_10004616
521 Ga0265339_10110649
522 Ga0265316_10300179
523 Ga0307513_10000738
524 Ga0307509_10033496
525 Ga0307508_10009789
526 Ga0307508_10019900
527 Ga0307508_10030824
528 Ga0307508_10101095
529 Ga0265314_10221697
530 Ga0307516_10017803
531 Ga0307507_10094214
532 Ga0307507_10233355
533 Ga0373950_0019900
534 Ga0373940_0001629
535 Ga0373949_0000256
536 Ga0373936_0000016
537 Ga0373939_0020393
538 Ga0373941_0002941
539 Ga0373955_0042365
540 Ga0373942_0000112
541 Ga0373962_0006664
542 Ga0316574_0038586
543 Ga0373931_0374615
544 Ga0373935_0011469
545 Ga0373937_0453132
546 Ga0373925_0001904
547 Ga0373925_0149573
548 Ga0373925_0173284
549 Ga0395900_0068923
550 Ga0395898_0001897
551 Ga0436364_0029165
552 Ga0436361_0582671
553 Ga0436361_1196097
554 Ga0451793_0705448
555 Ga0451849_1373223
556 Ga0451853_3884817
557 Ga0466961_0043019
558 Ga0466963_0003560
559 Ga0466963_0004368
560 Ga0466963_0005343
561 Ga0466963_0013646
562 Ga0466963_0013936
563 Ga0466963_0015383
564 Ga0466963_0043915
565 Ga0466963_0202729
566 Ga0466963_0505248
567 Ga0466959_0125265
568 Ga0466967_0003223
569 Ga0466967_0006090
570 Ga0466967_0025969
571 Ga0466967_0062729
572 Ga0466967_0103407
573 Ga0466967_0111821
574 Ga0466967_0195470
575 Ga0466967_0237397
576 Ga0466967_0348721
577 Ga0495592_0007029
578 Ga0495629_0176011
579 Ga0495629_0281564
580 Ga0495638_0153021
581 Ga0495651_0005131
582 Ga0495653_0031702
583 Ga0495580_0054656
584 Ga0495662_0001846
585 Ga0495664_0009368
586 Ga0495608_0013977
587 Ga0495628_0072529
588 Ga0495628_0086142
589 Ga0495630_0133382
590 Ga0495632_0026995
591 Ga0495666_0009337
592 Ga0495652_0094609
593 Ga0495665_0027304
594 Ga0495640_0004985
595 Ga0495587_0017986
596 Ga0495645_0016340
597 Ga0495645_0197403
598 Ga0495622_0059173
599 Ga0495667_0420972
600 Ga0495634_0084713
601 Ga0495635_0066168
602 Ga0495657_0003698
603 Ga0495599_0041142
604 Ga0495623_0074610
605 Ga0495646_0003637
606 Ga0495613_0076215
607 Ga0495649_0198109
608 Ga0495600_0004683
609 Ga0495581_0050422
610 Ga0495581_0058087
611 Ga0495604_0000605
612 Ga0495604_0020293
613 Ga0495674_0056874
614 Ga0495674_0090921
615 Ga0495675_0062824
616 Ga0495684_0003648
617 Ga0495593_0051961
618 Ga0495602_0034184
619 Ga0496104_0005570
620 Ga0496105_0024933
621 Ga0496105_0065792
622 Ga0496108_0005677
623 Ga0496109_0006832
624 Ga0496109_0185791
625 Ga0496110_0040484
626 Ga0496110_0081058
627 Ga0496111_0604928
628 Ga0496112_0022687
629 Ga0496113_0069355
630 Ga0496114_0100125
631 Ga0496114_0212716
632 Ga0501031_0023374
633 Ga0501033_0302532
634 Ga0501036_0296866
635 Ga0501037_0171177
636 Ga0501043_0105861
637 Ga0501047_0080868
638 Ga0501047_0360535
639 Ga0501069_0019923
640 Ga0501069_0186075
641 Ga0501070_0000619
642 Ga0501070_0034688
643 Ga0501070_0282630
644 Ga0501072_0333089
645 Ga0501035_0378160
646 Ga0501045_0326300
647 nmdc:mga03n38_16766_c1
648 nmdc:mga09592_45059_c1
649 nmdc:mga0qj67_88826_c1
650 nmdc:mga06r32_16555_c1
651 nmdc:mga0n895_304334_c1
652 nmdc:mga08x19_386145_c1
653 Ga0495601_0162354
654 Ga0500635_0003108
655 Ga0500644_0008997
656 Ga0500646_0004509
657 Ga0500566_0032836
658 Ga0500566_0098028
659 Ga0500654_101019
660 Ga0500597_015483
661 Ga0500597_026514
662 Ga0500617_090887
663 Ga0500573_0125576
664 Ga0500579_142214
665 Ga0500588_0002691
666 Ga0500590_125572
667 Ga0500603_001011
668 Ga0500630_029488
669 Ga0500630_067639
670 Ga0500636_0173345
671 2513714569
672 2753271205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

168

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.936 10 228
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9331 10 241
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9276 8 230
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9249 10 243
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9247 8 230
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9399 9 243 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9363 7 232 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9362 10 226 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9283 10 232 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9274 7 243 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A523AZA5-F1-model_v4 ABC transporter ATP-binding protein 0.9584 8 247 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A3B9FTI4-F1-model_v4 Export ABC transporter ATP-binding protein 0.9486 10 227 GO:0005524
GO:0016887
AF-J8LI27-F1-model_v4 deleted 0.9459 7 227
AF-C2Z676-F1-model_v4 deleted 0.9455 7 227
AF-A0A1I6ERF8-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 1, HAAT family 0.9445 7 243 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map