F412676

General Info

Members Datasets Scaffolds Average Seq Length
336 206 672 159

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10486052|Ga0157380_104860522
Length 172
Sequence MARPSPDCVVVTLEIRVGQGFDIHRTGDEPDRPMVLGGCRFPGVPGLVGHSDGDAVAHAVTEALLGAAGLGDIGQHFPDTDERYRGADSIDLLRRVVADVRDAGWAVGNADCSVICERPRLAPMRDEMQRRLADAVGAPVTVKGRRPEGLGALGRDEGIACFAVTVLVRGAA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
185 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2738543013 Variovorax sp. BT01 Isolate Unclassified
206 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 1.19
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0
Rhizoplane 5.36
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10486052 3300014326 Bacteria 1195
2 JGI25406J46586_10000024 3300003203 Bacteria 74651
3 Ga0055540_1005537 3300003792 Bacteria 5279
4 Ga0055531_10000584 3300003794 Bacteria 31840
5 Ga0055531_10001078 3300003794 Bacteria 21438
6 Ga0070658_10181748 3300005327 Bacteria 1770
7 Ga0070660_100055372 3300005339 Bacteria 3064
8 Ga0070660_100636721 3300005339 Unclassified 893
9 Ga0070689_100383265 3300005340 Bacteria 1185
10 Ga0070668_100138682 3300005347 Bacteria 1958
11 Ga0070675_100343847 3300005354 Bacteria 1322
12 Ga0070675_100916731 3300005354 Unclassified 803
13 Ga0070671_100180635 3300005355 Bacteria 1786
14 Ga0070674_100308511 3300005356 Bacteria 1264
15 Ga0070674_101162336 3300005356 Unclassified 684
16 Ga0070711_100326850 3300005439 Bacteria 1227
17 Ga0070711_101291569 3300005439 Bacteria 633
18 Ga0070700_100512119 3300005441 Bacteria 925
19 Ga0070708_100834518 3300005445 Bacteria 866
20 Ga0070681_10028508 3300005458 Bacteria 5614
21 Ga0070681_10117935 3300005458 Bacteria 2590
22 Ga0068867_100000092 3300005459 Bacteria 57643
23 Ga0070706_100035862 3300005467 Bacteria 4579
24 Ga0070707_100539889 3300005468 Bacteria 1128
25 Ga0070707_100643163 3300005468 Bacteria 1023
26 Ga0070707_101233717 3300005468 Bacteria 714
27 Ga0070679_100052886 3300005530 Bacteria 4043
28 Ga0070684_100506148 3300005535 Bacteria 1119
29 Ga0068853_100790991 3300005539 Bacteria 908
30 Ga0070686_100273353 3300005544 Bacteria 1243
31 Ga0070704_100209595 3300005549 Bacteria 1578
32 Ga0068855_100035682 3300005563 Bacteria 5922
33 Ga0068855_100199236 3300005563 Bacteria 2255
34 Ga0068864_100045830 3300005618 Bacteria 3751
35 Ga0068866_10133494 3300005718 Bacteria 1415
36 Ga0068860_100211543 3300005843 Bacteria 1881
37 Ga0068860_100761831 3300005843 Bacteria 980
38 Ga0068862_100022104 3300005844 Bacteria 5322
39 Ga0081455_10145821 3300005937 Bacteria 1831
40 Ga0081538_10000996 3300005981 Bacteria 30100
41 Ga0081538_10044111 3300005981 Bacteria 2786
42 Ga0081539_10000026 3300005985 Bacteria 330830
43 Ga0070717_10101443 3300006028 Bacteria 2444
44 Ga0075365_10781657 3300006038 Bacteria 674
45 Ga0070712_100395822 3300006175 Bacteria 1140
46 Ga0070712_101644034 3300006175 Bacteria 562
47 Ga0075428_100001045 3300006844 Bacteria 29392
48 Ga0075428_100214554 3300006844 Bacteria 2079
49 Ga0075428_101338813 3300006844 Bacteria 752
50 Ga0075430_100006186 3300006846 Bacteria 10090
51 Ga0075431_100007361 3300006847 Bacteria 10962
52 Ga0075434_100489845 3300006871 Bacteria 1250
53 Ga0075429_100004851 3300006880 Bacteria 11589
54 Ga0111539_10163049 3300009094 Bacteria 2607
55 Ga0105245_10489286 3300009098 Bacteria 1245
56 Ga0114129_10006741 3300009147 Bacteria 16307
57 Ga0114129_11219850 3300009147 Bacteria 936
58 Ga0105243_10009179 3300009148 Bacteria 7550
59 Ga0105243_11369819 3300009148 Bacteria 727
60 Ga0105241_10208430 3300009174 Bacteria 1636
61 Ga0105237_11515226 3300009545 Unclassified 677
62 Ga0105238_10504349 3300009551 Unclassified 1211
63 Ga0105249_10160141 3300009553 Bacteria 2174
64 Ga0105246_10561856 3300011119 Bacteria 980
65 Ga0157369_10007691 3300013105 Bacteria 12399
66 Ga0157369_11551708 3300013105 Bacteria 673
67 Ga0157374_10021059 3300013296 Bacteria 5795
68 Ga0157372_10191099 3300013307 Unclassified 2372
69 Ga0157380_10164386 3300014326 Bacteria 1932
70 Ga0157380_11154164 3300014326 Bacteria 816
71 Ga0157380_11460610 3300014326 Bacteria 736
72 Ga0157377_10000163 3300014745 Bacteria 39681
73 Ga0197907_10229335 3300020069 Bacteria 1481
74 Ga0206356_10113679 3300020070 Bacteria 1850
75 Ga0206353_11582835 3300020082 Unclassified 713
76 Ga0206353_11964322 3300020082 Bacteria 726
77 Ga0213873_10078574 3300021358 Bacteria 920
78 Ga0209673_1007130 3300025273 Bacteria 5232
79 Ga0209051_1000110 3300025303 Bacteria 153230
80 Ga0209257_1000012 3300025304 Bacteria 1111138
81 Ga0209257_1000045 3300025304 Bacteria 484429
82 Ga0207692_10685743 3300025898 Bacteria 664
83 Ga0207705_10054727 3300025909 Bacteria 2876
84 Ga0207684_10030518 3300025910 Bacteria 4588
85 Ga0207654_10097704 3300025911 Unclassified 1803
86 Ga0207707_10145083 3300025912 Bacteria 2075
87 Ga0207693_10381209 3300025915 Bacteria 1103
88 Ga0207693_10813991 3300025915 Bacteria 719
89 Ga0207657_10030602 3300025919 Bacteria 4884
90 Ga0207652_10918062 3300025921 Bacteria 773
91 Ga0207652_11017831 3300025921 Bacteria 727
92 Ga0207646_10462310 3300025922 Bacteria 1144
93 Ga0207646_10750688 3300025922 Bacteria 871
94 Ga0207659_10227382 3300025926 Bacteria 1503
95 Ga0207659_10604468 3300025926 Bacteria 935
96 Ga0207687_10464649 3300025927 Bacteria 1051
97 Ga0207664_10860462 3300025929 Bacteria 815
98 Ga0207644_10161353 3300025931 Bacteria 1743
99 Ga0207709_10003104 3300025935 Bacteria 10003
100 Ga0207709_10997916 3300025935 Bacteria 684
101 Ga0207689_10032935 3300025942 Bacteria 4307
102 Ga0207651_10368365 3300025960 Unclassified 1215
103 Ga0207651_10649816 3300025960 Bacteria 926
104 Ga0207668_10647501 3300025972 Unclassified 925
105 Ga0207668_11094982 3300025972 Bacteria 714
106 Ga0207641_10805907 3300026088 Bacteria 929
107 Ga0207648_10001523 3300026089 Bacteria 25527
108 Ga0207648_10474405 3300026089 Bacteria 1142
109 Ga0207675_101776691 3300026118 Bacteria 636
110 Ga0209970_1000327 3300027614 Bacteria 7923
111 Ga0268265_10016539 3300028380 Bacteria 5071
112 Ga0268264_10017436 3300028381 Bacteria 5880
113 Ga0265330_10034674 3300031235 Bacteria 2253
114 Ga0265332_10045021 3300031238 Bacteria 1902
115 Ga0265316_10147041 3300031344 Bacteria 1767
116 Ga0307509_10000075 3300031507 Bacteria 139230
117 Ga0307408_100517164 3300031548 Bacteria 1048
118 Ga0316575_10036464 3300031665 Bacteria 1934
119 Ga0265314_10012916 3300031711 Bacteria 6782
120 Ga0316576_10055384 3300031727 Bacteria 2894
121 Ga0316578_10095518 3300031728 Bacteria 1779
122 Ga0307406_10000704 3300031901 Bacteria 18898
123 Ga0307416_101160539 3300032002 Bacteria 878
124 Ga0307416_101700252 3300032002 Bacteria 736
125 Ga0373944_0002199 3300035089 Bacteria 4959
126 Ga0316574_0024646 3300035398 Bacteria 3603
127 Ga0373935_0010339 3300035692 Bacteria 5597
128 Ga0373937_0148414 3300036401 Bacteria 2196
129 Ga0395899_0004305 3300037312 Bacteria 11118
130 Ga0395899_0374291 3300037312 Bacteria 948
131 Ga0395899_0699966 3300037312 Unclassified 635
132 Ga0395900_0023620 3300037418 Bacteria 6290
133 Ga0395900_0877538 3300037418 Bacteria 821
134 Ga0395898_0006750 3300037466 Bacteria 12223
135 Ga0395898_0066775 3300037466 Bacteria 3483
136 Ga0395898_0070374 3300037466 Bacteria 3382
137 Ga0395898_0392754 3300037466 Bacteria 1323
138 Ga0395905_0000126 3300037471 Bacteria 126035
139 Ga0395905_0000959 3300037471 Bacteria 37058
140 Ga0395905_0007926 3300037471 Bacteria 10507
141 Ga0395905_0033636 3300037471 Bacteria 4814
142 Ga0395905_0033910 3300037471 Bacteria 4795
143 Ga0395905_0059914 3300037471 Bacteria 3559
144 Ga0395905_0148255 3300037471 Bacteria 2207
145 Ga0395905_0401044 3300037471 Bacteria 1266
146 Ga0395905_0647627 3300037471 Bacteria 958
147 Ga0395905_0669244 3300037471 Bacteria 940
148 Ga0395905_0945049 3300037471 Bacteria 765
149 Ga0436364_1451199 3300037853 Bacteria 829
150 Ga0395901_0009011 3300038443 Bacteria 10105
151 Ga0395901_0032171 3300038443 Bacteria 5413
152 Ga0395901_0089459 3300038443 Bacteria 3222
153 Ga0395901_0129441 3300038443 Bacteria 2652
154 Ga0395901_0565803 3300038443 Bacteria 1150
155 Ga0395901_0764515 3300038443 Bacteria 958
156 Ga0395901_0928460 3300038443 Bacteria 850
157 Ga0395901_1632028 3300038443 Unclassified 597
158 Ga0436363_0908637 3300039450 Bacteria 885
159 Ga0451853_0563824 3300041512 Bacteria 728
160 Ga0450912_012531 3300042116 Bacteria 750
161 Ga0451577_0000257 3300042876 Bacteria 104746
162 Ga0466969_0033631 3300044656 Bacteria 2603
163 Ga0466969_0047950 3300044656 Bacteria 2113
164 Ga0466969_0063403 3300044656 Bacteria 1792
165 Ga0466969_0219517 3300044656 Unclassified 865
166 Ga0466972_0475597 3300044658 Bacteria 587
167 Ga0466966_0010369 3300044684 Bacteria 6186
168 Ga0466966_0044455 3300044684 Bacteria 2843
169 Ga0466966_0119821 3300044684 Bacteria 1617
170 Ga0466961_0016185 3300044693 Bacteria 4788
171 Ga0466961_0066700 3300044693 Bacteria 2286
172 Ga0466961_0236325 3300044693 Bacteria 1124
173 Ga0466961_0398026 3300044693 Bacteria 836
174 Ga0466963_0056455 3300044694 Bacteria 2613
175 Ga0466963_0163759 3300044694 Bacteria 1549
176 Ga0466963_0271510 3300044694 Bacteria 1191
177 Ga0466964_0060330 3300044706 Bacteria 1577
178 Ga0453684_0001024 3300044712 Bacteria 89721
179 Ga0453684_0205934 3300044712 Bacteria 2290
180 Ga0453684_0259973 3300044712 Bacteria 1989
181 Ga0466968_0122057 3300044735 Bacteria 1179
182 Ga0466957_0156644 3300044842 Bacteria 1477
183 Ga0466957_0165237 3300044842 Bacteria 1439
184 Ga0466960_0219130 3300044901 Bacteria 1046
185 Ga0466959_0013627 3300045049 Bacteria 5897
186 Ga0466959_0039616 3300045049 Bacteria 3482
187 Ga0466959_0043600 3300045049 Bacteria 3306
188 Ga0466959_0129472 3300045049 Bacteria 1789
189 Ga0466959_0144631 3300045049 Bacteria 1678
190 Ga0451576_0125082 3300045051 Bacteria 2679
191 Ga0466958_0060908 3300045836 Bacteria 2298
192 Ga0466958_0111789 3300045836 Bacteria 1706
193 Ga0466958_0441660 3300045836 Unclassified 842
194 Ga0466958_1016641 3300045836 Bacteria 541
195 Ga0466967_0027101 3300045976 Bacteria 4761
196 Ga0466967_0067022 3300045976 Bacteria 3201
197 Ga0466967_0117143 3300045976 Bacteria 2455
198 Ga0466967_0244459 3300045976 Bacteria 1712
199 Ga0466967_0271163 3300045976 Bacteria 1626
200 Ga0466967_0365398 3300045976 Bacteria 1399
201 Ga0466967_0473841 3300045976 Bacteria 1226
202 Ga0466967_1030743 3300045976 Bacteria 819
203 Ga0495629_0122681 3300046459 Bacteria 1810
204 Ga0495641_0086235 3300046461 Bacteria 1405
205 Ga0495651_0212723 3300046462 Bacteria 1344
206 Ga0495653_0013664 3300046463 Bacteria 6618
207 Ga0495605_0095413 3300046474 Bacteria 1373
208 Ga0495664_0131896 3300046477 Bacteria 1513
209 Ga0495608_0037697 3300046511 Bacteria 3250
210 Ga0495618_0144870 3300046514 Bacteria 1519
211 Ga0495628_0081777 3300046516 Bacteria 2509
212 Ga0495652_0097106 3300046529 Bacteria 2397
213 Ga0495640_0118789 3300046533 Bacteria 1720
214 Ga0495586_0154278 3300046535 Unclassified 1293
215 Ga0495587_0145484 3300046536 Bacteria 1352
216 Ga0495645_0134272 3300046543 Bacteria 1732
217 Ga0495667_0014944 3300046559 Bacteria 5245
218 Ga0495634_0103775 3300046642 Bacteria 1834
219 Ga0495635_0024370 3300046663 Bacteria 4217
220 Ga0495635_0077465 3300046663 Bacteria 2277
221 Ga0495635_0225156 3300046663 Bacteria 1268
222 Ga0495646_0152743 3300046680 Bacteria 1283
223 Ga0495613_0007408 3300046689 Bacteria 8178
224 Ga0495600_0004114 3300046809 Bacteria 8657
225 Ga0495604_0793568 3300047317 Bacteria 597
226 Ga0495674_0014827 3300047319 Bacteria 7292
227 Ga0495676_0003328 3300047321 Bacteria 14536
228 Ga0495676_0511722 3300047321 Bacteria 787
229 Ga0495680_0025349 3300047322 Bacteria 4909
230 Ga0495684_0000898 3300047471 Bacteria 24090
231 Ga0495602_0283005 3300048088 Bacteria 1221
232 Ga0496100_0362343 3300048903 Bacteria 1097
233 Ga0496101_0028009 3300048904 Bacteria 3931
234 Ga0496104_0108466 3300048907 Bacteria 2661
235 Ga0496105_0100122 3300048908 Bacteria 2393
236 Ga0496105_0339335 3300048908 Bacteria 1202
237 Ga0496107_0424554 3300048910 Bacteria 988
238 Ga0496108_0320339 3300048911 Bacteria 1352
239 Ga0496110_0792107 3300048913 Bacteria 852
240 Ga0496111_0018158 3300048914 Bacteria 4870
241 Ga0496112_0013045 3300048915 Bacteria 7664
242 Ga0496112_0073283 3300048915 Bacteria 3385
243 Ga0496112_0114558 3300048915 Bacteria 2666
244 Ga0496113_0462637 3300048916 Bacteria 1019
245 Ga0496113_0896636 3300048916 Bacteria 701
246 Ga0496114_0062921 3300048917 Bacteria 3106
247 Ga0496114_0577801 3300048917 Bacteria 992
248 Ga0496115_0036462 3300048918 Bacteria 3894
249 Ga0496115_0045821 3300048918 Bacteria 3492
250 Ga0501031_0129157 3300049568 Bacteria 1650
251 Ga0501031_0405674 3300049568 Bacteria 881
252 Ga0501032_1009327 3300049569 Bacteria 523
253 Ga0501033_0210557 3300049570 Bacteria 1386
254 Ga0501033_0382190 3300049570 Bacteria 984
255 Ga0501033_0712921 3300049570 Bacteria 682
256 Ga0501034_0127079 3300049571 Bacteria 2534
257 Ga0501034_0970850 3300049571 Bacteria 735
258 Ga0501036_0084235 3300049572 Bacteria 2688
259 Ga0501036_0134778 3300049572 Bacteria 2084
260 Ga0501036_0178048 3300049572 Bacteria 1790
261 Ga0501038_0026017 3300049574 Bacteria 5213
262 Ga0501038_0104274 3300049574 Bacteria 2357
263 Ga0501039_0006580 3300049575 Bacteria 8823
264 Ga0501039_0067831 3300049575 Bacteria 2770
265 Ga0501040_0090217 3300049576 Bacteria 2130
266 Ga0501040_0244961 3300049576 Bacteria 1278
267 Ga0501041_0043181 3300049577 Bacteria 2741
268 Ga0501041_0077992 3300049577 Bacteria 2038
269 Ga0501042_0053188 3300049578 Bacteria 2889
270 Ga0501042_0449860 3300049578 Bacteria 934
271 Ga0501042_0528181 3300049578 Bacteria 857
272 Ga0501043_0069222 3300049579 Bacteria 2772
273 Ga0501043_0072060 3300049579 Bacteria 2714
274 Ga0501046_0026239 3300049580 Bacteria 4759
275 Ga0501046_0082529 3300049580 Bacteria 2482
276 Ga0501046_0177667 3300049580 Bacteria 1594
277 Ga0501047_0109308 3300049581 Bacteria 2647
278 Ga0501048_0065267 3300049582 Bacteria 2574
279 Ga0501048_0292628 3300049582 Bacteria 1158
280 Ga0501048_0351737 3300049582 Bacteria 1051
281 Ga0501067_0135782 3300049583 Bacteria 1370
282 Ga0501067_0275958 3300049583 Bacteria 936
283 Ga0501067_0524137 3300049583 Bacteria 663
284 Ga0501068_0035739 3300049584 Bacteria 2967
285 Ga0501068_0805673 3300049584 Bacteria 616
286 Ga0501069_0228109 3300049585 Bacteria 1084
287 Ga0501070_0064330 3300049586 Bacteria 3038
288 Ga0501070_0070528 3300049586 Bacteria 2893
289 Ga0501071_0197445 3300049587 Bacteria 1510
290 Ga0501072_0014365 3300049588 Bacteria 6070
291 Ga0501072_0140787 3300049588 Bacteria 1923
292 Ga0501072_0178280 3300049588 Bacteria 1695
293 Ga0501073_0194062 3300049589 Bacteria 1405
294 Ga0501074_0027703 3300049590 Bacteria 4108
295 Ga0501074_0236601 3300049590 Bacteria 1300
296 Ga0501074_0786184 3300049590 Bacteria 671
297 Ga0501075_0023294 3300049591 Bacteria 4532
298 Ga0501075_0116654 3300049591 Bacteria 2030
299 Ga0501075_0261492 3300049591 Bacteria 1319
300 Ga0501077_0025931 3300049593 Bacteria 3718
301 Ga0501077_0293513 3300049593 Bacteria 1035
302 Ga0501198_000004 3300049649 Bacteria 175146
303 Ga0501222_000011 3300049662 Bacteria 100553
304 Ga0501079_0025948 3300049741 Bacteria 4494
305 Ga0501079_0456076 3300049741 Bacteria 1004
306 Ga0501080_0004809 3300049742 Bacteria 12044
307 Ga0501080_0022019 3300049742 Bacteria 5904
308 Ga0501080_0313234 3300049742 Bacteria 1422
309 Ga0501081_0037703 3300049743 Bacteria 3299
310 Ga0501083_0121766 3300049744 Bacteria 1711
311 Ga0501035_0127856 3300049822 Bacteria 2217
312 Ga0501035_0385486 3300049822 Bacteria 1168
313 Ga0501044_0103860 3300049823 Bacteria 2856
314 Ga0501045_0002010 3300049824 Bacteria 13745
315 Ga0501045_0014231 3300049824 Bacteria 5637
316 Ga0501045_0841154 3300049824 Bacteria 675
317 nmdc:mga05p37_1554026_c1 3300050507 Bacteria 655
318 nmdc:mga05p37_21101_c1 3300050507 Bacteria 7885
319 nmdc:mga05p37_926416_c1 3300050507 Bacteria 936
320 nmdc:mga09592_1745_c1 3300050508 Bacteria 17483
321 nmdc:mga0qj67_5073_c1 3300050509 Bacteria 9583
322 nmdc:mga0n895_480973_c1 3300050512 Bacteria 1252
323 Ga0495601_0000121 3300053077 Bacteria 43462
324 Ga0495601_0093954 3300053077 Bacteria 1932
325 Ga0495601_0211260 3300053077 Bacteria 1268
326 Ga0495612_0031455 3300053078 Bacteria 2140
327 Ga0495655_0083665 3300053083 Bacteria 917
328 Ga0495595_0029987 3300053084 Bacteria 2437
329 Ga0495619_0010689 3300053085 Bacteria 5778
330 Ga0495619_0017850 3300053085 Bacteria 4497
331 Ga0501084_0004462 3300054114 Bacteria 11427
332 Ga0501082_0271132 3300060353 Bacteria 1477
333 Ga0501082_1098116 3300060353 Unclassified 695
334 Ga0530510_0038622 3300061734 Bacteria 3447
335 2739250848 2738543013 Bacteria 5618633
336 2919704700 2919704043 Bacteria 5560311
337 Ga0157380_10486052
338 JGI25406J46586_10000024
339 Ga0055540_1005537
340 Ga0055531_10000584
341 Ga0055531_10001078
342 Ga0070658_10181748
343 Ga0070660_100055372
344 Ga0070660_100636721
345 Ga0070689_100383265
346 Ga0070668_100138682
347 Ga0070675_100343847
348 Ga0070675_100916731
349 Ga0070671_100180635
350 Ga0070674_100308511
351 Ga0070674_101162336
352 Ga0070711_100326850
353 Ga0070711_101291569
354 Ga0070700_100512119
355 Ga0070708_100834518
356 Ga0070681_10028508
357 Ga0070681_10117935
358 Ga0068867_100000092
359 Ga0070706_100035862
360 Ga0070707_100539889
361 Ga0070707_100643163
362 Ga0070707_101233717
363 Ga0070679_100052886
364 Ga0070684_100506148
365 Ga0068853_100790991
366 Ga0070686_100273353
367 Ga0070704_100209595
368 Ga0068855_100035682
369 Ga0068855_100199236
370 Ga0068864_100045830
371 Ga0068866_10133494
372 Ga0068860_100211543
373 Ga0068860_100761831
374 Ga0068862_100022104
375 Ga0081455_10145821
376 Ga0081538_10000996
377 Ga0081538_10044111
378 Ga0081539_10000026
379 Ga0070717_10101443
380 Ga0075365_10781657
381 Ga0070712_100395822
382 Ga0070712_101644034
383 Ga0075428_100001045
384 Ga0075428_100214554
385 Ga0075428_101338813
386 Ga0075430_100006186
387 Ga0075431_100007361
388 Ga0075434_100489845
389 Ga0075429_100004851
390 Ga0111539_10163049
391 Ga0105245_10489286
392 Ga0114129_10006741
393 Ga0114129_11219850
394 Ga0105243_10009179
395 Ga0105243_11369819
396 Ga0105241_10208430
397 Ga0105237_11515226
398 Ga0105238_10504349
399 Ga0105249_10160141
400 Ga0105246_10561856
401 Ga0157369_10007691
402 Ga0157369_11551708
403 Ga0157374_10021059
404 Ga0157372_10191099
405 Ga0157380_10164386
406 Ga0157380_11154164
407 Ga0157380_11460610
408 Ga0157377_10000163
409 Ga0197907_10229335
410 Ga0206356_10113679
411 Ga0206353_11582835
412 Ga0206353_11964322
413 Ga0213873_10078574
414 Ga0209673_1007130
415 Ga0209051_1000110
416 Ga0209257_1000012
417 Ga0209257_1000045
418 Ga0207692_10685743
419 Ga0207705_10054727
420 Ga0207684_10030518
421 Ga0207654_10097704
422 Ga0207707_10145083
423 Ga0207693_10381209
424 Ga0207693_10813991
425 Ga0207657_10030602
426 Ga0207652_10918062
427 Ga0207652_11017831
428 Ga0207646_10462310
429 Ga0207646_10750688
430 Ga0207659_10227382
431 Ga0207659_10604468
432 Ga0207687_10464649
433 Ga0207664_10860462
434 Ga0207644_10161353
435 Ga0207709_10003104
436 Ga0207709_10997916
437 Ga0207689_10032935
438 Ga0207651_10368365
439 Ga0207651_10649816
440 Ga0207668_10647501
441 Ga0207668_11094982
442 Ga0207641_10805907
443 Ga0207648_10001523
444 Ga0207648_10474405
445 Ga0207675_101776691
446 Ga0209970_1000327
447 Ga0268265_10016539
448 Ga0268264_10017436
449 Ga0265330_10034674
450 Ga0265332_10045021
451 Ga0265316_10147041
452 Ga0307509_10000075
453 Ga0307408_100517164
454 Ga0316575_10036464
455 Ga0265314_10012916
456 Ga0316576_10055384
457 Ga0316578_10095518
458 Ga0307406_10000704
459 Ga0307416_101160539
460 Ga0307416_101700252
461 Ga0373944_0002199
462 Ga0316574_0024646
463 Ga0373935_0010339
464 Ga0373937_0148414
465 Ga0395899_0004305
466 Ga0395899_0374291
467 Ga0395899_0699966
468 Ga0395900_0023620
469 Ga0395900_0877538
470 Ga0395898_0006750
471 Ga0395898_0066775
472 Ga0395898_0070374
473 Ga0395898_0392754
474 Ga0395905_0000126
475 Ga0395905_0000959
476 Ga0395905_0007926
477 Ga0395905_0033636
478 Ga0395905_0033910
479 Ga0395905_0059914
480 Ga0395905_0148255
481 Ga0395905_0401044
482 Ga0395905_0647627
483 Ga0395905_0669244
484 Ga0395905_0945049
485 Ga0436364_1451199
486 Ga0395901_0009011
487 Ga0395901_0032171
488 Ga0395901_0089459
489 Ga0395901_0129441
490 Ga0395901_0565803
491 Ga0395901_0764515
492 Ga0395901_0928460
493 Ga0395901_1632028
494 Ga0436363_0908637
495 Ga0451853_0563824
496 Ga0450912_012531
497 Ga0451577_0000257
498 Ga0466969_0033631
499 Ga0466969_0047950
500 Ga0466969_0063403
501 Ga0466969_0219517
502 Ga0466972_0475597
503 Ga0466966_0010369
504 Ga0466966_0044455
505 Ga0466966_0119821
506 Ga0466961_0016185
507 Ga0466961_0066700
508 Ga0466961_0236325
509 Ga0466961_0398026
510 Ga0466963_0056455
511 Ga0466963_0163759
512 Ga0466963_0271510
513 Ga0466964_0060330
514 Ga0453684_0001024
515 Ga0453684_0205934
516 Ga0453684_0259973
517 Ga0466968_0122057
518 Ga0466957_0156644
519 Ga0466957_0165237
520 Ga0466960_0219130
521 Ga0466959_0013627
522 Ga0466959_0039616
523 Ga0466959_0043600
524 Ga0466959_0129472
525 Ga0466959_0144631
526 Ga0451576_0125082
527 Ga0466958_0060908
528 Ga0466958_0111789
529 Ga0466958_0441660
530 Ga0466958_1016641
531 Ga0466967_0027101
532 Ga0466967_0067022
533 Ga0466967_0117143
534 Ga0466967_0244459
535 Ga0466967_0271163
536 Ga0466967_0365398
537 Ga0466967_0473841
538 Ga0466967_1030743
539 Ga0495629_0122681
540 Ga0495641_0086235
541 Ga0495651_0212723
542 Ga0495653_0013664
543 Ga0495605_0095413
544 Ga0495664_0131896
545 Ga0495608_0037697
546 Ga0495618_0144870
547 Ga0495628_0081777
548 Ga0495652_0097106
549 Ga0495640_0118789
550 Ga0495586_0154278
551 Ga0495587_0145484
552 Ga0495645_0134272
553 Ga0495667_0014944
554 Ga0495634_0103775
555 Ga0495635_0024370
556 Ga0495635_0077465
557 Ga0495635_0225156
558 Ga0495646_0152743
559 Ga0495613_0007408
560 Ga0495600_0004114
561 Ga0495604_0793568
562 Ga0495674_0014827
563 Ga0495676_0003328
564 Ga0495676_0511722
565 Ga0495680_0025349
566 Ga0495684_0000898
567 Ga0495602_0283005
568 Ga0496100_0362343
569 Ga0496101_0028009
570 Ga0496104_0108466
571 Ga0496105_0100122
572 Ga0496105_0339335
573 Ga0496107_0424554
574 Ga0496108_0320339
575 Ga0496110_0792107
576 Ga0496111_0018158
577 Ga0496112_0013045
578 Ga0496112_0073283
579 Ga0496112_0114558
580 Ga0496113_0462637
581 Ga0496113_0896636
582 Ga0496114_0062921
583 Ga0496114_0577801
584 Ga0496115_0036462
585 Ga0496115_0045821
586 Ga0501031_0129157
587 Ga0501031_0405674
588 Ga0501032_1009327
589 Ga0501033_0210557
590 Ga0501033_0382190
591 Ga0501033_0712921
592 Ga0501034_0127079
593 Ga0501034_0970850
594 Ga0501036_0084235
595 Ga0501036_0134778
596 Ga0501036_0178048
597 Ga0501038_0026017
598 Ga0501038_0104274
599 Ga0501039_0006580
600 Ga0501039_0067831
601 Ga0501040_0090217
602 Ga0501040_0244961
603 Ga0501041_0043181
604 Ga0501041_0077992
605 Ga0501042_0053188
606 Ga0501042_0449860
607 Ga0501042_0528181
608 Ga0501043_0069222
609 Ga0501043_0072060
610 Ga0501046_0026239
611 Ga0501046_0082529
612 Ga0501046_0177667
613 Ga0501047_0109308
614 Ga0501048_0065267
615 Ga0501048_0292628
616 Ga0501048_0351737
617 Ga0501067_0135782
618 Ga0501067_0275958
619 Ga0501067_0524137
620 Ga0501068_0035739
621 Ga0501068_0805673
622 Ga0501069_0228109
623 Ga0501070_0064330
624 Ga0501070_0070528
625 Ga0501071_0197445
626 Ga0501072_0014365
627 Ga0501072_0140787
628 Ga0501072_0178280
629 Ga0501073_0194062
630 Ga0501074_0027703
631 Ga0501074_0236601
632 Ga0501074_0786184
633 Ga0501075_0023294
634 Ga0501075_0116654
635 Ga0501075_0261492
636 Ga0501077_0025931
637 Ga0501077_0293513
638 Ga0501198_000004
639 Ga0501222_000011
640 Ga0501079_0025948
641 Ga0501079_0456076
642 Ga0501080_0004809
643 Ga0501080_0022019
644 Ga0501080_0313234
645 Ga0501081_0037703
646 Ga0501083_0121766
647 Ga0501035_0127856
648 Ga0501035_0385486
649 Ga0501044_0103860
650 Ga0501045_0002010
651 Ga0501045_0014231
652 Ga0501045_0841154
653 nmdc:mga05p37_1554026_c1
654 nmdc:mga05p37_21101_c1
655 nmdc:mga05p37_926416_c1
656 nmdc:mga09592_1745_c1
657 nmdc:mga0qj67_5073_c1
658 nmdc:mga0n895_480973_c1
659 Ga0495601_0000121
660 Ga0495601_0093954
661 Ga0495601_0211260
662 Ga0495612_0031455
663 Ga0495655_0083665
664 Ga0495595_0029987
665 Ga0495619_0010689
666 Ga0495619_0017850
667 Ga0501084_0004462
668 Ga0501082_0271132
669 Ga0501082_1098116
670 Ga0530510_0038622
671 2739250848
672 2919704700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

15

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9767 3 149
4c8i-assembly1.cif.gz_B ispf (burkholderia cenocepacia) citrate complex 0.9725 1 149
5l12-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9697 1 146
3t80-assembly2.cif.gz_D crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from salmonella typhimurium bound to cytidine 0.9666 2 147
4c8i-assembly1.cif.gz_B ispf (burkholderia cenocepacia) citrate complex 0.9661 1 149
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.952 1 149 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9484 2 149 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9459 1 149 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9456 2 149 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9362 2 149 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A381TNJ8-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) 0.9835 3 148 GO:0008685
GO:0016114
GO:0019288
GO:0050518
AF-A0A7C7DIJ4-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.983 3 148 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0070567
AF-A0A2N2A1I3-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9829 3 147 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0070567
AF-A0A2V5W3Y4-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9828 2 149 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7C6QIL9-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9817 2 148 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518

Map