F412653

General Info

Members Datasets Scaffolds Average Seq Length
336 234 672 330

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10000366|Ga0099796_100003663
Length 358
Sequence MDIRGKKFVVIGGAGLIGSHAVDLLTRQDVGQIVIYDNFMRGTPENIADALTDPRVKVYDVGGDICQSDILNSALSGVDGVFHFAALWLLQCHEFPRAAFDVNIRGTFNVLEACVQQGVKRLVYSSSASVYGDAVEEPMTEDHPFNNKNFYGATKIAGEAMARAFHHRYGLNVVGLRYMNVYGPRQDYRGAYIAVIMKMLDAIDRGEGPTILGDGSEAFDFVAVKDCGRANLCAMRADVVDSFYNVGTGKRTSLKELAEMLLRLTGSNQPIQYAPRSQATLVRNRIGSPKRAAAEIGFVAEMPLEQGLRELIGWRKAHMTEVEQRRMRAAAEKRRPCAASREPSISPAAQRSRRSCSV

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
151 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
152 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
218 2643221651 Afipia sp. Root123D2 Isolate Unclassified
219 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
220 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
221 2904699407
222 2906610324
223 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
224 2922425934
225 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
226 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
227 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
228 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
229 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
230 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
231 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
232 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
233 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
234 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 2.68
Rhizoplane 3.87
Rhizosphere 83.63
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10000366 3300010159 Bacteria 7370
2 MBSR1b_contig_14297021 2162886012 Bacteria 2079
3 JGI25151J46595_10000015 3300003187 Bacteria 250420
4 JGI25153J46596_10000454 3300003215 Bacteria 26254
5 Ga0065165_1000381 3300005262 Bacteria 71865
6 Ga0065165_1000691 3300005262 Bacteria 48143
7 Ga0065704_10070140 3300005289 Bacteria 482257
8 Ga0070658_10000501 3300005327 Bacteria 33918
9 Ga0070658_10048208 3300005327 Bacteria 3448
10 Ga0070670_100038481 3300005331 Bacteria 4113
11 Ga0070670_100118912 3300005331 Bacteria 2279
12 Ga0070670_100168068 3300005331 Unclassified 1902
13 Ga0070677_10000042 3300005333 Bacteria 39651
14 Ga0070666_10231405 3300005335 Bacteria 1305
15 Ga0070680_100000334 3300005336 Bacteria 31520
16 Ga0070680_100000347 3300005336 Bacteria 31151
17 Ga0070680_100021666 3300005336 Bacteria 5110
18 Ga0070680_100042012 3300005336 Bacteria 3708
19 Ga0070680_100158903 3300005336 Bacteria 1899
20 Ga0070660_100000508 3300005339 Bacteria 26025
21 Ga0070691_10051267 3300005341 Bacteria 1970
22 Ga0070692_10004358 3300005345 Bacteria 5897
23 Ga0070675_100247155 3300005354 Bacteria 1560
24 Ga0070671_100108685 3300005355 Bacteria 2329
25 Ga0070674_100165386 3300005356 Bacteria 1682
26 Ga0070667_100012454 3300005367 Bacteria 7036
27 Ga0070710_10115284 3300005437 Bacteria 1619
28 Ga0070705_100189879 3300005440 Bacteria 1399
29 Ga0070700_100016419 3300005441 Bacteria 4218
30 Ga0070694_100001181 3300005444 Bacteria 15003
31 Ga0070663_100053396 3300005455 Bacteria 2885
32 Ga0070678_100001084 3300005456 Bacteria 14252
33 Ga0070662_100146221 3300005457 Bacteria 1836
34 Ga0070681_10000905 3300005458 Bacteria 25065
35 Ga0070681_10006841 3300005458 Bacteria 11100
36 Ga0070681_10106406 3300005458 Bacteria 2746
37 Ga0070681_10166582 3300005458 Bacteria 2126
38 Ga0068867_100127920 3300005459 Bacteria 1970
39 Ga0070706_100001707 3300005467 Bacteria 22853
40 Ga0070706_100003110 3300005467 Bacteria 16439
41 Ga0070707_100001580 3300005468 Bacteria 22059
42 Ga0070707_100026745 3300005468 Bacteria 5481
43 Ga0070698_100017049 3300005471 Bacteria 7659
44 Ga0070698_100152007 3300005471 Bacteria 2262
45 Ga0070699_100001297 3300005518 Bacteria 23078
46 Ga0070699_100024366 3300005518 Bacteria 5215
47 Ga0070699_100176581 3300005518 Bacteria 1894
48 Ga0070679_100000481 3300005530 Bacteria 34177
49 Ga0070679_100002778 3300005530 Bacteria 15914
50 Ga0070679_100020069 3300005530 Bacteria 6513
51 Ga0070679_100037002 3300005530 Bacteria 4845
52 Ga0070679_100525486 3300005530 Bacteria 1127
53 Ga0070684_100002123 3300005535 Bacteria 14623
54 Ga0070697_100334420 3300005536 Bacteria 1306
55 Ga0070696_100000055 3300005546 Bacteria 53389
56 Ga0070704_100002594 3300005549 Bacteria 10190
57 Ga0068855_100000083 3300005563 Bacteria 114159
58 Ga0068855_100082995 3300005563 Bacteria 3713
59 Ga0070664_100023566 3300005564 Bacteria 5085
60 Ga0068857_100071474 3300005577 Bacteria 3091
61 Ga0068856_100002629 3300005614 Bacteria 18448
62 Ga0070702_100271382 3300005615 Bacteria 1160
63 Ga0068852_100234903 3300005616 Bacteria 1749
64 Ga0068864_100022471 3300005618 Bacteria 5290
65 Ga0068864_100079400 3300005618 Bacteria 2873
66 Ga0068861_100239651 3300005719 Bacteria 1542
67 Ga0068863_100050895 3300005841 Bacteria 3926
68 Ga0068858_100243685 3300005842 Bacteria 1706
69 Ga0068860_100000714 3300005843 Bacteria 38006
70 Ga0068860_100002207 3300005843 Bacteria 20490
71 Ga0068862_100002650 3300005844 Bacteria 15746
72 Ga0081538_10000242 3300005981 Bacteria 61803
73 Ga0081540_1016944 3300005983 Bacteria 4534
74 Ga0075432_10018711 3300006058 Bacteria 2364
75 Ga0070712_100165944 3300006175 Bacteria 1709
76 Ga0075366_10008945 3300006195 Bacteria 5582
77 Ga0097621_100090750 3300006237 Bacteria 2557
78 Ga0068871_100002821 3300006358 Bacteria 11887
79 Ga0075428_100013702 3300006844 Bacteria 9028
80 Ga0075428_100107573 3300006844 Bacteria 3039
81 Ga0075428_100307759 3300006844 Bacteria 1703
82 Ga0075430_100009526 3300006846 Bacteria 8210
83 Ga0075431_100008136 3300006847 Bacteria 10476
84 Ga0075431_100187528 3300006847 Bacteria 2120
85 Ga0075433_10005258 3300006852 Bacteria 10150
86 Ga0075433_10057578 3300006852 Bacteria 3397
87 Ga0075434_100001793 3300006871 Bacteria 18550
88 Ga0075434_100460200 3300006871 Bacteria 1293
89 Ga0075429_100003469 3300006880 Bacteria 13451
90 Ga0075435_100093612 3300007076 Bacteria 2483
91 Ga0111539_10105617 3300009094 Bacteria 3304
92 Ga0111539_10172886 3300009094 Bacteria 2524
93 Ga0105247_10006959 3300009101 Bacteria 6965
94 Ga0114129_10002537 3300009147 Bacteria 25351
95 Ga0114129_10003991 3300009147 Bacteria 20841
96 Ga0114129_10104878 3300009147 Bacteria 3907
97 Ga0114129_10334941 3300009147 Bacteria 2008
98 Ga0114129_10452309 3300009147 Bacteria 1684
99 Ga0114129_10455207 3300009147 Bacteria 1678
100 Ga0105241_10045823 3300009174 Bacteria 3320
101 Ga0105242_10010609 3300009176 Bacteria 7073
102 Ga0105248_10050962 3300009177 Bacteria 4645
103 Ga0105248_10231625 3300009177 Bacteria 2079
104 Ga0105248_10689672 3300009177 Bacteria 1152
105 Ga0157371_10303433 3300013102 Bacteria 1156
106 Ga0157370_10028757 3300013104 Bacteria 5465
107 Ga0157370_10193811 3300013104 Unclassified 1886
108 Ga0157369_10009790 3300013105 Bacteria 10964
109 Ga0157369_10094878 3300013105 Bacteria 3184
110 Ga0157372_10007550 3300013307 Bacteria 11561
111 Ga0163163_10173038 3300014325 Bacteria 2206
112 Ga0157380_10001990 3300014326 Bacteria 13601
113 Ga0157380_10018946 3300014326 Bacteria 5122
114 Ga0157380_10523125 3300014326 Bacteria 1157
115 Ga0182008_10026184 3300014497 Bacteria 2958
116 Ga0157379_10002849 3300014968 Bacteria 14582
117 Ga0182006_1006626 3300015261 Bacteria 5363
118 Ga0209148_1000641 3300025254 Bacteria 30490
119 Ga0209233_1005678 3300025261 Bacteria 4116
120 Ga0209233_1006936 3300025261 Bacteria 3621
121 Ga0209455_1000973 3300025272 Bacteria 14484
122 Ga0209130_1000127 3300025284 Bacteria 123652
123 Ga0209676_1014326 3300025292 Bacteria 2987
124 Ga0209025_1000010 3300025294 Bacteria 986612
125 Ga0209025_1002305 3300025294 Bacteria 20696
126 Ga0209564_1000211 3300025295 Bacteria 133277
127 Ga0209758_1006601 3300025297 Bacteria 8227
128 Ga0207692_10095550 3300025898 Bacteria 1621
129 Ga0207710_10014642 3300025900 Bacteria 3310
130 Ga0207645_10083456 3300025907 Bacteria 2049
131 Ga0207705_10000092 3300025909 Bacteria 109488
132 Ga0207705_10174135 3300025909 Bacteria 1621
133 Ga0207684_10001929 3300025910 Bacteria 21502
134 Ga0207684_10017079 3300025910 Bacteria 6231
135 Ga0207654_10202759 3300025911 Bacteria 1307
136 Ga0207707_10009556 3300025912 Bacteria 8413
137 Ga0207707_10012428 3300025912 Bacteria 7401
138 Ga0207707_10016087 3300025912 Bacteria 6525
139 Ga0207707_10059617 3300025912 Bacteria 3320
140 Ga0207663_10222524 3300025916 Bacteria 1374
141 Ga0207660_10000195 3300025917 Bacteria 38741
142 Ga0207660_10000904 3300025917 Bacteria 19519
143 Ga0207660_10013872 3300025917 Bacteria 5287
144 Ga0207660_10022098 3300025917 Bacteria 4284
145 Ga0207660_10039224 3300025917 Bacteria 3310
146 Ga0207660_10161794 3300025917 Bacteria 1727
147 Ga0207657_10024280 3300025919 Bacteria 5620
148 Ga0207649_10014962 3300025920 Bacteria 4355
149 Ga0207652_10000782 3300025921 Bacteria 30446
150 Ga0207652_10002072 3300025921 Bacteria 17268
151 Ga0207652_10002688 3300025921 Bacteria 14911
152 Ga0207652_10018145 3300025921 Bacteria 5768
153 Ga0207652_10026784 3300025921 Bacteria 4805
154 Ga0207652_10314389 3300025921 Bacteria 1414
155 Ga0207646_10003465 3300025922 Bacteria 17815
156 Ga0207646_10025962 3300025922 Bacteria 5355
157 Ga0207646_10183916 3300025922 Bacteria 1888
158 Ga0207650_10038586 3300025925 Bacteria 3489
159 Ga0207686_10080158 3300025934 Bacteria 2127
160 Ga0207669_10174557 3300025937 Bacteria 1534
161 Ga0207665_10024757 3300025939 Bacteria 3959
162 Ga0207711_10108870 3300025941 Bacteria 2462
163 Ga0207711_10116907 3300025941 Bacteria 2378
164 Ga0207711_10133245 3300025941 Bacteria 2230
165 Ga0207661_10000354 3300025944 Bacteria 29533
166 Ga0207667_10000043 3300025949 Bacteria 261426
167 Ga0207658_10056161 3300025986 Bacteria 2920
168 Ga0207658_10476308 3300025986 Bacteria 1109
169 Ga0207678_10004202 3300026067 Bacteria 12924
170 Ga0207708_10021356 3300026075 Bacteria 4881
171 Ga0207702_10004207 3300026078 Bacteria 12861
172 Ga0207641_10038889 3300026088 Bacteria 3978
173 Ga0207648_10066674 3300026089 Bacteria 3139
174 Ga0207648_10664390 3300026089 Bacteria 964
175 Ga0207676_10042232 3300026095 Bacteria 3506
176 Ga0207676_10128389 3300026095 Bacteria 2151
177 Ga0207674_10033313 3300026116 Bacteria 5394
178 Ga0207675_100298030 3300026118 Bacteria 1570
179 Ga0207698_10006165 3300026142 Bacteria 7465
180 Ga0207698_10256047 3300026142 Bacteria 1605
181 Ga0207428_10036665 3300027907 Bacteria 3998
182 Ga0207428_10045170 3300027907 Bacteria 3550
183 Ga0207428_10126436 3300027907 Bacteria 1957
184 Ga0268266_10378994 3300028379 Bacteria 1334
185 Ga0268265_10046082 3300028380 Bacteria 3257
186 Ga0268264_10000096 3300028381 Bacteria 230188
187 Ga0268264_10035035 3300028381 Bacteria 4132
188 Ga0265338_10003115 3300028800 Bacteria 23743
189 Ga0265338_10007994 3300028800 Bacteria 12945
190 Ga0265324_10069246 3300029957 Bacteria 1203
191 Ga0265330_10021679 3300031235 Bacteria 2928
192 Ga0265332_10029967 3300031238 Bacteria 2377
193 Ga0265329_10009208 3300031242 Bacteria 3697
194 Ga0265340_10034795 3300031247 Bacteria 2505
195 Ga0265327_10001136 3300031251 Bacteria 36485
196 Ga0265327_10006876 3300031251 Bacteria 8948
197 Ga0265327_10007232 3300031251 Bacteria 8618
198 Ga0265316_10105187 3300031344 Bacteria 2141
199 Ga0307408_100001668 3300031548 Bacteria 16355
200 Ga0265313_10022930 3300031595 Bacteria 3375
201 Ga0265314_10000203 3300031711 Bacteria 87485
202 Ga0265342_10092411 3300031712 Bacteria 1733
203 Ga0307405_10111991 3300031731 Bacteria 1851
204 Ga0316577_10042670 3300031733 Unclassified 2538
205 Ga0307413_10066265 3300031824 Bacteria 2253
206 Ga0307406_10042943 3300031901 Bacteria 2825
207 Ga0307407_10045111 3300031903 Bacteria 2489
208 Ga0307412_10208707 3300031911 Bacteria 1489
209 Ga0307409_100003828 3300031995 Bacteria 8307
210 Ga0307416_100073578 3300032002 Bacteria 2850
211 Ga0307414_10055832 3300032004 Bacteria 2767
212 Ga0307411_10141055 3300032005 Bacteria 1777
213 Ga0307415_100434113 3300032126 Bacteria 1131
214 Ga0373924_0049319 3300035410 Bacteria 1742
215 Ga0373931_0020616 3300035691 Bacteria 3300
216 Ga0373935_0062838 3300035692 Bacteria 2379
217 Ga0373947_0054359 3300035725 Bacteria 2416
218 Ga0395900_0019469 3300037418 Bacteria 6920
219 Ga0395898_0095343 3300037466 Bacteria 2858
220 Ga0395905_0024859 3300037471 Bacteria 5653
221 Ga0400490_21251 3300038726 Bacteria 16448
222 Ga0451855_0326401 3300041511 Bacteria 919
223 Ga0439443_001275 3300042003 Bacteria 2717
224 Ga0451577_0050376 3300042876 Bacteria 3717
225 Ga0451577_0068802 3300042876 Bacteria 3157
226 Ga0451577_0234465 3300042876 Bacteria 1660
227 Ga0466972_0009523 3300044658 Bacteria 4880
228 Ga0466965_0038237 3300044683 Bacteria 2357
229 Ga0453684_0023433 3300044712 Bacteria 9093
230 Ga0453684_0031895 3300044712 Bacteria 7389
231 Ga0453684_0231270 3300044712 Bacteria 2134
232 Ga0466970_0042049 3300044765 Bacteria 2430
233 Ga0466959_0057360 3300045049 Bacteria 2839
234 Ga0466959_0145057 3300045049 Unclassified 1676
235 Ga0451576_0001672 3300045051 Bacteria 36794
236 Ga0495594_0019127 3300046499 Bacteria 3638
237 Ga0495618_0021395 3300046514 Bacteria 3988
238 Ga0495628_0196849 3300046516 Bacteria 1520
239 Ga0495643_0002872 3300046522 Bacteria 13088
240 Ga0495587_0033547 3300046536 Bacteria 3099
241 Ga0495674_0096727 3300047319 Bacteria 2516
242 Ga0496100_0038456 3300048903 Bacteria 3032
243 Ga0496101_0025031 3300048904 Bacteria 4137
244 Ga0496102_0009286 3300048905 Bacteria 8440
245 Ga0496104_0025564 3300048907 Bacteria 5444
246 Ga0496105_0011680 3300048908 Bacteria 6948
247 Ga0496106_0005610 3300048909 Bacteria 9289
248 Ga0496107_0000725 3300048910 Bacteria 18859
249 Ga0496109_0094718 3300048912 Bacteria 2764
250 Ga0496112_0120510 3300048915 Bacteria 2593
251 Ga0496112_0277359 3300048915 Bacteria 1624
252 Ga0496112_0433119 3300048915 Bacteria 1253
253 Ga0496113_0357186 3300048916 Bacteria 1172
254 Ga0496114_0011677 3300048917 Bacteria 7022
255 Ga0496120_0093239 3300048923 Bacteria 1605
256 Ga0496121_0000260 3300048924 Bacteria 110424
257 Ga0496121_0002779 3300048924 Bacteria 25970
258 Ga0496121_0177706 3300048924 Bacteria 1540
259 Ga0501032_0000870 3300049569 Bacteria 24539
260 Ga0501033_0096799 3300049570 Bacteria 2157
261 Ga0501034_0050201 3300049571 Bacteria 4208
262 Ga0501034_0079806 3300049571 Unclassified 3276
263 Ga0501034_0111273 3300049571 Bacteria 2729
264 Ga0501034_0121696 3300049571 Bacteria 2596
265 Ga0501041_0006930 3300049577 Bacteria 6650
266 Ga0501042_0075789 3300049578 Bacteria 2407
267 Ga0501046_0090270 3300049580 Bacteria 2358
268 Ga0501047_0159449 3300049581 Bacteria 2128
269 Ga0501067_0058320 3300049583 Bacteria 2138
270 Ga0501068_0000756 3300049584 Bacteria 16616
271 Ga0501069_0068424 3300049585 Bacteria 1987
272 Ga0501070_0164936 3300049586 Bacteria 1826
273 Ga0501073_0000023 3300049589 Bacteria 129568
274 Ga0501075_0010695 3300049591 Bacteria 6459
275 Ga0501076_0130453 3300049592 Bacteria 2038
276 Ga0501077_0000365 3300049593 Bacteria 26961
277 Ga0501077_0007598 3300049593 Bacteria 6690
278 Ga0501079_0050506 3300049741 Bacteria 3210
279 Ga0501079_0081533 3300049741 Bacteria 2502
280 Ga0501080_0006402 3300049742 Bacteria 10565
281 Ga0501080_0072548 3300049742 Bacteria 3203
282 Ga0501080_0192532 3300049742 Bacteria 1874
283 Ga0501081_0001478 3300049743 Bacteria 14406
284 Ga0501081_0225673 3300049743 Bacteria 1363
285 Ga0501083_0009953 3300049744 Bacteria 6712
286 Ga0501266_000042 3300049763 Bacteria 22821
287 Ga0501035_0107539 3300049822 Bacteria 2445
288 Ga0501044_0001648 3300049823 Bacteria 26221
289 Ga0501044_0012548 3300049823 Bacteria 9178
290 Ga0501044_0278404 3300049823 Bacteria 1607
291 Ga0501045_0028516 3300049824 Bacteria 4028
292 nmdc:mga0k408_11951_c1 3300050493 Bacteria 4737
293 nmdc:mga05p37_1678_c1 3300050507 Bacteria 25758
294 nmdc:mga05p37_241799_c1 3300050507 Bacteria 2170
295 nmdc:mga05p37_246541_c1 3300050507 Bacteria 2144
296 nmdc:mga05p37_82946_c1 3300050507 Bacteria 3950
297 nmdc:mga09592_444_c1 3300050508 Bacteria 30617
298 nmdc:mga0qj67_12805_c1 3300050509 Bacteria 6327
299 nmdc:mga06r32_15979_c1 3300050510 Bacteria 6830
300 nmdc:mga06r32_80732_c1 3300050510 Bacteria 3166
301 nmdc:mga08y16_37261_c1 3300050511 Bacteria 5108
302 nmdc:mga08y16_77720_c1 3300050511 Bacteria 3461
303 nmdc:mga0n895_11089_c1 3300050512 Bacteria 8019
304 nmdc:mga0n895_168588_c1 3300050512 Bacteria 2222
305 nmdc:mga0n895_28408_c1 3300050512 Bacteria 5319
306 nmdc:mga0rr50_68214_c1 3300050513 Bacteria 2704
307 nmdc:mga0a205_21661_c1 3300050515 Bacteria 6077
308 nmdc:mga0a205_51209_c1 3300050515 Bacteria 3986
309 Ga0495601_0003399 3300053077 Bacteria 9122
310 Ga0500572_000018 3300053111 Bacteria 50079
311 Ga0500568_0003844 3300053139 Bacteria 8194
312 Ga0501084_0185838 3300054114 Bacteria 1754
313 Ga0501084_0252057 3300054114 Bacteria 1490
314 Ga0501082_0008940 3300060353 Bacteria 8645
315 Ga0501082_0020507 3300060353 Bacteria 5698
316 Ga0530510_0016907 3300061734 Bacteria 5167
317 Ga0530510_0071940 3300061734 Bacteria 2510
318 Ga0530510_0145288 3300061734 Bacteria 1750
319 2643949102 2643221588 Bacteria 3692460
320 2644287615 2643221651 Bacteria 4798932
321 2885376810 2885374607 Bacteria 8927485
322 2903754224 2903748898 Bacteria 9972761
323 2904705374
324 2906611069
325 2908744583 2908739725 Bacteria 8628932
326 2922428245
327 2928134251 2928130867 Bacteria 5467269
328 2935635916 2935630451 Bacteria 8169952
329 2941512547 2941507105 Bacteria 8166816
330 2941520248 2941515067 Bacteria 8166720
331 2941528356 2941523033 Bacteria 8169134
332 3005478230 3005474847 Bacteria 9259049
333 646814771 646564506 Bacteria 3192235
334 8006942981 8006933436 Bacteria 10410654
335 8006982701 8006973647 Bacteria 10679141
336 8056969073 8056967851 Bacteria 9038162
337 Ga0099796_10000366
338 MBSR1b_contig_14297021
339 JGI25151J46595_10000015
340 JGI25153J46596_10000454
341 Ga0065165_1000381
342 Ga0065165_1000691
343 Ga0065704_10070140
344 Ga0070658_10000501
345 Ga0070658_10048208
346 Ga0070670_100038481
347 Ga0070670_100118912
348 Ga0070670_100168068
349 Ga0070677_10000042
350 Ga0070666_10231405
351 Ga0070680_100000334
352 Ga0070680_100000347
353 Ga0070680_100021666
354 Ga0070680_100042012
355 Ga0070680_100158903
356 Ga0070660_100000508
357 Ga0070691_10051267
358 Ga0070692_10004358
359 Ga0070675_100247155
360 Ga0070671_100108685
361 Ga0070674_100165386
362 Ga0070667_100012454
363 Ga0070710_10115284
364 Ga0070705_100189879
365 Ga0070700_100016419
366 Ga0070694_100001181
367 Ga0070663_100053396
368 Ga0070678_100001084
369 Ga0070662_100146221
370 Ga0070681_10000905
371 Ga0070681_10006841
372 Ga0070681_10106406
373 Ga0070681_10166582
374 Ga0068867_100127920
375 Ga0070706_100001707
376 Ga0070706_100003110
377 Ga0070707_100001580
378 Ga0070707_100026745
379 Ga0070698_100017049
380 Ga0070698_100152007
381 Ga0070699_100001297
382 Ga0070699_100024366
383 Ga0070699_100176581
384 Ga0070679_100000481
385 Ga0070679_100002778
386 Ga0070679_100020069
387 Ga0070679_100037002
388 Ga0070679_100525486
389 Ga0070684_100002123
390 Ga0070697_100334420
391 Ga0070696_100000055
392 Ga0070704_100002594
393 Ga0068855_100000083
394 Ga0068855_100082995
395 Ga0070664_100023566
396 Ga0068857_100071474
397 Ga0068856_100002629
398 Ga0070702_100271382
399 Ga0068852_100234903
400 Ga0068864_100022471
401 Ga0068864_100079400
402 Ga0068861_100239651
403 Ga0068863_100050895
404 Ga0068858_100243685
405 Ga0068860_100000714
406 Ga0068860_100002207
407 Ga0068862_100002650
408 Ga0081538_10000242
409 Ga0081540_1016944
410 Ga0075432_10018711
411 Ga0070712_100165944
412 Ga0075366_10008945
413 Ga0097621_100090750
414 Ga0068871_100002821
415 Ga0075428_100013702
416 Ga0075428_100107573
417 Ga0075428_100307759
418 Ga0075430_100009526
419 Ga0075431_100008136
420 Ga0075431_100187528
421 Ga0075433_10005258
422 Ga0075433_10057578
423 Ga0075434_100001793
424 Ga0075434_100460200
425 Ga0075429_100003469
426 Ga0075435_100093612
427 Ga0111539_10105617
428 Ga0111539_10172886
429 Ga0105247_10006959
430 Ga0114129_10002537
431 Ga0114129_10003991
432 Ga0114129_10104878
433 Ga0114129_10334941
434 Ga0114129_10452309
435 Ga0114129_10455207
436 Ga0105241_10045823
437 Ga0105242_10010609
438 Ga0105248_10050962
439 Ga0105248_10231625
440 Ga0105248_10689672
441 Ga0157371_10303433
442 Ga0157370_10028757
443 Ga0157370_10193811
444 Ga0157369_10009790
445 Ga0157369_10094878
446 Ga0157372_10007550
447 Ga0163163_10173038
448 Ga0157380_10001990
449 Ga0157380_10018946
450 Ga0157380_10523125
451 Ga0182008_10026184
452 Ga0157379_10002849
453 Ga0182006_1006626
454 Ga0209148_1000641
455 Ga0209233_1005678
456 Ga0209233_1006936
457 Ga0209455_1000973
458 Ga0209130_1000127
459 Ga0209676_1014326
460 Ga0209025_1000010
461 Ga0209025_1002305
462 Ga0209564_1000211
463 Ga0209758_1006601
464 Ga0207692_10095550
465 Ga0207710_10014642
466 Ga0207645_10083456
467 Ga0207705_10000092
468 Ga0207705_10174135
469 Ga0207684_10001929
470 Ga0207684_10017079
471 Ga0207654_10202759
472 Ga0207707_10009556
473 Ga0207707_10012428
474 Ga0207707_10016087
475 Ga0207707_10059617
476 Ga0207663_10222524
477 Ga0207660_10000195
478 Ga0207660_10000904
479 Ga0207660_10013872
480 Ga0207660_10022098
481 Ga0207660_10039224
482 Ga0207660_10161794
483 Ga0207657_10024280
484 Ga0207649_10014962
485 Ga0207652_10000782
486 Ga0207652_10002072
487 Ga0207652_10002688
488 Ga0207652_10018145
489 Ga0207652_10026784
490 Ga0207652_10314389
491 Ga0207646_10003465
492 Ga0207646_10025962
493 Ga0207646_10183916
494 Ga0207650_10038586
495 Ga0207686_10080158
496 Ga0207669_10174557
497 Ga0207665_10024757
498 Ga0207711_10108870
499 Ga0207711_10116907
500 Ga0207711_10133245
501 Ga0207661_10000354
502 Ga0207667_10000043
503 Ga0207658_10056161
504 Ga0207658_10476308
505 Ga0207678_10004202
506 Ga0207708_10021356
507 Ga0207702_10004207
508 Ga0207641_10038889
509 Ga0207648_10066674
510 Ga0207648_10664390
511 Ga0207676_10042232
512 Ga0207676_10128389
513 Ga0207674_10033313
514 Ga0207675_100298030
515 Ga0207698_10006165
516 Ga0207698_10256047
517 Ga0207428_10036665
518 Ga0207428_10045170
519 Ga0207428_10126436
520 Ga0268266_10378994
521 Ga0268265_10046082
522 Ga0268264_10000096
523 Ga0268264_10035035
524 Ga0265338_10003115
525 Ga0265338_10007994
526 Ga0265324_10069246
527 Ga0265330_10021679
528 Ga0265332_10029967
529 Ga0265329_10009208
530 Ga0265340_10034795
531 Ga0265327_10001136
532 Ga0265327_10006876
533 Ga0265327_10007232
534 Ga0265316_10105187
535 Ga0307408_100001668
536 Ga0265313_10022930
537 Ga0265314_10000203
538 Ga0265342_10092411
539 Ga0307405_10111991
540 Ga0316577_10042670
541 Ga0307413_10066265
542 Ga0307406_10042943
543 Ga0307407_10045111
544 Ga0307412_10208707
545 Ga0307409_100003828
546 Ga0307416_100073578
547 Ga0307414_10055832
548 Ga0307411_10141055
549 Ga0307415_100434113
550 Ga0373924_0049319
551 Ga0373931_0020616
552 Ga0373935_0062838
553 Ga0373947_0054359
554 Ga0395900_0019469
555 Ga0395898_0095343
556 Ga0395905_0024859
557 Ga0400490_21251
558 Ga0451855_0326401
559 Ga0439443_001275
560 Ga0451577_0050376
561 Ga0451577_0068802
562 Ga0451577_0234465
563 Ga0466972_0009523
564 Ga0466965_0038237
565 Ga0453684_0023433
566 Ga0453684_0031895
567 Ga0453684_0231270
568 Ga0466970_0042049
569 Ga0466959_0057360
570 Ga0466959_0145057
571 Ga0451576_0001672
572 Ga0495594_0019127
573 Ga0495618_0021395
574 Ga0495628_0196849
575 Ga0495643_0002872
576 Ga0495587_0033547
577 Ga0495674_0096727
578 Ga0496100_0038456
579 Ga0496101_0025031
580 Ga0496102_0009286
581 Ga0496104_0025564
582 Ga0496105_0011680
583 Ga0496106_0005610
584 Ga0496107_0000725
585 Ga0496109_0094718
586 Ga0496112_0120510
587 Ga0496112_0277359
588 Ga0496112_0433119
589 Ga0496113_0357186
590 Ga0496114_0011677
591 Ga0496120_0093239
592 Ga0496121_0000260
593 Ga0496121_0002779
594 Ga0496121_0177706
595 Ga0501032_0000870
596 Ga0501033_0096799
597 Ga0501034_0050201
598 Ga0501034_0079806
599 Ga0501034_0111273
600 Ga0501034_0121696
601 Ga0501041_0006930
602 Ga0501042_0075789
603 Ga0501046_0090270
604 Ga0501047_0159449
605 Ga0501067_0058320
606 Ga0501068_0000756
607 Ga0501069_0068424
608 Ga0501070_0164936
609 Ga0501073_0000023
610 Ga0501075_0010695
611 Ga0501076_0130453
612 Ga0501077_0000365
613 Ga0501077_0007598
614 Ga0501079_0050506
615 Ga0501079_0081533
616 Ga0501080_0006402
617 Ga0501080_0072548
618 Ga0501080_0192532
619 Ga0501081_0001478
620 Ga0501081_0225673
621 Ga0501083_0009953
622 Ga0501266_000042
623 Ga0501035_0107539
624 Ga0501044_0001648
625 Ga0501044_0012548
626 Ga0501044_0278404
627 Ga0501045_0028516
628 nmdc:mga0k408_11951_c1
629 nmdc:mga05p37_1678_c1
630 nmdc:mga05p37_241799_c1
631 nmdc:mga05p37_246541_c1
632 nmdc:mga05p37_82946_c1
633 nmdc:mga09592_444_c1
634 nmdc:mga0qj67_12805_c1
635 nmdc:mga06r32_15979_c1
636 nmdc:mga06r32_80732_c1
637 nmdc:mga08y16_37261_c1
638 nmdc:mga08y16_77720_c1
639 nmdc:mga0n895_11089_c1
640 nmdc:mga0n895_168588_c1
641 nmdc:mga0n895_28408_c1
642 nmdc:mga0rr50_68214_c1
643 nmdc:mga0a205_21661_c1
644 nmdc:mga0a205_51209_c1
645 Ga0495601_0003399
646 Ga0500572_000018
647 Ga0500568_0003844
648 Ga0501084_0185838
649 Ga0501084_0252057
650 Ga0501082_0008940
651 Ga0501082_0020507
652 Ga0530510_0016907
653 Ga0530510_0071940
654 Ga0530510_0145288
655 2643949102
656 2644287615
657 2885376810
658 2903754224
659 2904705374
660 2906611069
661 2908744583
662 2922428245
663 2928134251
664 2935635916
665 2941512547
666 2941520248
667 2941528356
668 3005478230
669 646814771
670 8006942981
671 8006982701
672 8056969073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

247

0.91

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

9

311

0.9

PF05368

NmrA

NmrA-like family

8

185

0.88

PF07993

NAD_binding_4

Male sterility protein

10

230

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

9

246

0.82

PF04321

RmlD_sub_bind

RmlD substrate binding domain

6

205

0.8

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

8

287

0.76

PF13460

NAD_binding_10

NAD(P)H-binding

12

189

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.9518 5 318
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.9429 5 318
7ys8-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (rv3634c) from mycobacterium tuberculosis 0.9332 8 314
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9306 8 318
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.9304 7 316
ID Description Score Start End Superfamily
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9448 5 248 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9358 5 248 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9285 8 315 3.40.50.720
af_K7VJC9_94_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9282 6 68 3.40.50.720
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9226 8 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A829I4J9-F1-model_v4 deleted 0.9747 150 318
AF-A0A662IPD0-F1-model_v4 Nucleoside-diphosphate sugar epimerase 0.9698 7 318 GO:0016491
AF-A0A1G1BWY2-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9686 1 315
AF-A0A849Y836-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9676 1 316
AF-A0A6F8Y7S4-F1-model_v4 NAD-dependent epimerase 0.9655 37 320

Map