F412581

General Info

Members Datasets Scaffolds Average Seq Length
336 216 672 182

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100031300|Ga0070693_1000313002
Length 208
Sequence MSVQSSHSASSRSIVRTKEAAMSQTVSTSITRRSVVAGLALAAAPATVLAAADNAHAQDKQTVPEKSLYERLGGVFAIAAVVDHFSDAVVKNPIVGQKSKNPQLREWHTKNLGRLPGLKFMRTLWVCNISGGPFQYTATRPGNTPLGLEEAHRSLRISPAEFDEVAAELGRTLDFAKVPKREKSEVLAAFAAHKDEVTAGYVAAAKPR

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
202 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
203 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
204 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
205 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
206 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
207 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
208 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
209 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
210 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
211 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
212 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
213 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
214 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
215 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
216 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0.6
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 2.68
Rhizoplane 2.38
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100031300 3300005547 Bacteria 2914
2 JGI25406J46586_10023576 3300003203 Bacteria 2430
3 rootH1_10162588 3300003316 Bacteria 1029
4 rootL2_10149422 3300003322 Bacteria 2282
5 rootL2_10189158 3300003322 Bacteria 1709
6 rootH1_10227132 3300003323 Bacteria 1579
7 Ga0058861_12058804 3300004800 Bacteria 710
8 Ga0065707_10252701 3300005295 Bacteria 1120
9 Ga0070676_10140235 3300005328 Bacteria 1538
10 Ga0070683_100069291 3300005329 Bacteria 3288
11 Ga0070670_100016301 3300005331 Bacteria 6381
12 Ga0068869_100569167 3300005334 Bacteria 954
13 Ga0070680_100587321 3300005336 Bacteria 956
14 Ga0070682_100015927 3300005337 Bacteria 4365
15 Ga0070689_100201693 3300005340 Bacteria 1625
16 Ga0070689_101277037 3300005340 Bacteria 661
17 Ga0070668_100020679 3300005347 Bacteria 4969
18 Ga0070668_100068061 3300005347 Bacteria 2767
19 Ga0070674_100118315 3300005356 Bacteria 1958
20 Ga0070688_100754318 3300005365 Bacteria 758
21 Ga0070659_100679436 3300005366 Bacteria 889
22 Ga0070709_10046275 3300005434 Bacteria 2704
23 Ga0070709_10175995 3300005434 Bacteria 1499
24 Ga0070714_100136337 3300005435 Bacteria 2198
25 Ga0070710_10179466 3300005437 Bacteria 1324
26 Ga0070711_100189244 3300005439 Bacteria 1580
27 Ga0070705_100141730 3300005440 Bacteria 1583
28 Ga0070694_100055268 3300005444 Bacteria 2692
29 Ga0070694_100922116 3300005444 Unclassified 722
30 Ga0070694_101238753 3300005444 Bacteria 626
31 Ga0070708_100764184 3300005445 Bacteria 909
32 Ga0070663_100001806 3300005455 Bacteria 11909
33 Ga0070663_100291390 3300005455 Bacteria 1304
34 Ga0070678_100104307 3300005456 Bacteria 2205
35 Ga0070662_101291290 3300005457 Bacteria 628
36 Ga0070681_10007603 3300005458 Bacteria 10593
37 Ga0070681_10025489 3300005458 Bacteria 5948
38 Ga0070681_10248267 3300005458 Bacteria 1692
39 Ga0068867_100992814 3300005459 Bacteria 761
40 Ga0068867_100997542 3300005459 Bacteria 759
41 Ga0070706_100007730 3300005467 Bacteria 10053
42 Ga0070679_100051450 3300005530 Bacteria 4102
43 Ga0070684_100118017 3300005535 Bacteria 2384
44 Ga0070684_100172545 3300005535 Bacteria 1964
45 Ga0068853_100944416 3300005539 Bacteria 829
46 Ga0070695_100419123 3300005545 Unclassified 1019
47 Ga0070696_100025190 3300005546 Bacteria 4043
48 Ga0070665_100005703 3300005548 Bacteria 12782
49 Ga0070704_100008623 3300005549 Bacteria 6125
50 Ga0068855_100330273 3300005563 Bacteria 1683
51 Ga0068857_100417141 3300005577 Bacteria 1251
52 Ga0068854_100975967 3300005578 Bacteria 749
53 Ga0068859_100050751 3300005617 Bacteria 4168
54 Ga0068859_100051509 3300005617 Bacteria 4138
55 Ga0068859_101400825 3300005617 Bacteria 771
56 Ga0068864_100065481 3300005618 Bacteria 3152
57 Ga0068864_100069431 3300005618 Bacteria 3064
58 Ga0068864_100290049 3300005618 Bacteria 1529
59 Ga0068861_100010444 3300005719 Bacteria 6444
60 Ga0068861_100096924 3300005719 Bacteria 2338
61 Ga0068861_100235569 3300005719 Bacteria 1555
62 Ga0068861_101223957 3300005719 Bacteria 727
63 Ga0068858_101525318 3300005842 Unclassified 659
64 Ga0068860_100411879 3300005843 Bacteria 1339
65 Ga0068860_100495920 3300005843 Bacteria 1219
66 Ga0068860_100780874 3300005843 Bacteria 968
67 Ga0068862_100158844 3300005844 Bacteria 2017
68 Ga0068862_101001256 3300005844 Bacteria 826
69 Ga0081455_10001514 3300005937 Bacteria 28648
70 Ga0081455_10003893 3300005937 Bacteria 17000
71 Ga0081455_10005127 3300005937 Bacteria 14436
72 Ga0081455_10009356 3300005937 Bacteria 10086
73 Ga0081455_10061951 3300005937 Bacteria 3146
74 Ga0081455_10074014 3300005937 Bacteria 2814
75 Ga0081455_10097326 3300005937 Bacteria 2371
76 Ga0081455_10102842 3300005937 Bacteria 2289
77 Ga0081540_1000635 3300005983 Bacteria 33393
78 Ga0081540_1002797 3300005983 Bacteria 14144
79 Ga0081540_1014968 3300005983 Bacteria 4932
80 Ga0081539_10001065 3300005985 Bacteria 50187
81 Ga0081539_10010736 3300005985 Bacteria 7381
82 Ga0070717_10399204 3300006028 Bacteria 1235
83 Ga0075365_10070068 3300006038 Bacteria 2358
84 Ga0075365_10136842 3300006038 Bacteria 1698
85 Ga0075368_10002760 3300006042 Bacteria 5794
86 Ga0075363_100576383 3300006048 Bacteria 673
87 Ga0070716_101237750 3300006173 Bacteria 601
88 Ga0070712_100038311 3300006175 Bacteria 3275
89 Ga0075367_10006933 3300006178 Bacteria 5769
90 Ga0075367_10090503 3300006178 Bacteria 1861
91 Ga0075427_10003422 3300006194 Bacteria 2185
92 Ga0097621_100117197 3300006237 Bacteria 2256
93 Ga0068871_100437004 3300006358 Bacteria 1171
94 Ga0075428_100144382 3300006844 Bacteria 2587
95 Ga0075428_100586013 3300006844 Bacteria 1191
96 Ga0075428_100619260 3300006844 Bacteria 1155
97 Ga0075428_101115615 3300006844 Bacteria 833
98 Ga0075428_101140450 3300006844 Bacteria 823
99 Ga0075430_100002831 3300006846 Bacteria 14516
100 Ga0075430_100115117 3300006846 Bacteria 2240
101 Ga0075431_100063758 3300006847 Bacteria 3803
102 Ga0075431_100349195 3300006847 Bacteria 1487
103 Ga0075433_10000903 3300006852 Bacteria 20892
104 Ga0075433_10347480 3300006852 Bacteria 1311
105 Ga0075429_100023730 3300006880 Bacteria 5323
106 Ga0075429_100049053 3300006880 Bacteria 3671
107 Ga0075429_100064428 3300006880 Bacteria 3192
108 Ga0075436_100088222 3300006914 Bacteria 2155
109 Ga0097620_100000033 3300006931 Bacteria 172869
110 Ga0097620_100050748 3300006931 Bacteria 4168
111 Ga0097620_100051509 3300006931 Bacteria 4138
112 Ga0097620_101400691 3300006931 Bacteria 771
113 Ga0075435_100107233 3300007076 Bacteria 2320
114 Ga0075435_100170015 3300007076 Bacteria 1838
115 Ga0075435_100462328 3300007076 Bacteria 1095
116 Ga0105240_10047603 3300009093 Bacteria 5425
117 Ga0111539_10004846 3300009094 Bacteria 17535
118 Ga0111539_10005347 3300009094 Bacteria 16612
119 Ga0111539_10033486 3300009094 Bacteria 6238
120 Ga0111539_10264273 3300009094 Bacteria 2003
121 Ga0105245_10211584 3300009098 Bacteria 1866
122 Ga0105245_10579346 3300009098 Bacteria 1146
123 Ga0105247_10379647 3300009101 Bacteria 1002
124 Ga0114129_10036822 3300009147 Bacteria 6909
125 Ga0114129_10048433 3300009147 Bacteria 5972
126 Ga0114129_10133940 3300009147 Bacteria 3402
127 Ga0114129_10244559 3300009147 Bacteria 2411
128 Ga0114129_10548680 3300009147 Bacteria 1503
129 Ga0114129_10920091 3300009147 Bacteria 1107
130 Ga0114129_11134164 3300009147 Bacteria 977
131 Ga0105243_10082796 3300009148 Bacteria 2623
132 Ga0105243_10524540 3300009148 Bacteria 1127
133 Ga0105241_10067072 3300009174 Bacteria 2777
134 Ga0105237_10682621 3300009545 Bacteria 1034
135 Ga0105249_10036402 3300009553 Bacteria 4464
136 Ga0105249_10221683 3300009553 Bacteria 1861
137 Ga0105249_10603891 3300009553 Bacteria 1152
138 Ga0105239_10080016 3300010375 Bacteria 3596
139 Ga0105239_10248337 3300010375 Bacteria 1998
140 Ga0105239_10804286 3300010375 Bacteria 1077
141 Ga0157373_10019457 3300013100 Bacteria 4940
142 Ga0157370_10027238 3300013104 Bacteria 5636
143 Ga0157370_10766635 3300013104 Bacteria 879
144 Ga0157374_10687220 3300013296 Bacteria 1036
145 Ga0163162_10043553 3300013306 Bacteria 4494
146 Ga0157372_10052883 3300013307 Bacteria 4524
147 Ga0157375_10331669 3300013308 Bacteria 1686
148 Ga0157375_11247053 3300013308 Bacteria 873
149 Ga0163163_10002574 3300014325 Bacteria 15359
150 Ga0163163_10048973 3300014325 Bacteria 4157
151 Ga0163163_10841459 3300014325 Bacteria 981
152 Ga0157380_10177411 3300014326 Bacteria 1868
153 Ga0157380_10270545 3300014326 Bacteria 1549
154 Ga0157380_11271000 3300014326 Bacteria 782
155 Ga0182008_10430564 3300014497 Bacteria 714
156 Ga0157379_10212876 3300014968 Bacteria 1750
157 Ga0157376_10007492 3300014969 Bacteria 7797
158 Ga0182007_10153772 3300015262 Bacteria 783
159 Ga0163161_10017079 3300017792 Bacteria 5076
160 Ga0197907_10625441 3300020069 Bacteria 1444
161 Ga0207692_10030088 3300025898 Bacteria 2586
162 Ga0207692_10315523 3300025898 Bacteria 955
163 Ga0207710_10053834 3300025900 Bacteria 1811
164 Ga0207710_10288952 3300025900 Bacteria 826
165 Ga0207688_10132299 3300025901 Bacteria 1463
166 Ga0207688_10385972 3300025901 Bacteria 867
167 Ga0207647_10019551 3300025904 Bacteria 4554
168 Ga0207645_10115569 3300025907 Bacteria 1739
169 Ga0207645_10121549 3300025907 Bacteria 1695
170 Ga0207684_10001200 3300025910 Bacteria 28861
171 Ga0207707_10062769 3300025912 Bacteria 3233
172 Ga0207707_10251189 3300025912 Bacteria 1536
173 Ga0207695_10194413 3300025913 Bacteria 1945
174 Ga0207693_10021491 3300025915 Bacteria 5127
175 Ga0207660_10545205 3300025917 Bacteria 943
176 Ga0207660_10568753 3300025917 Bacteria 922
177 Ga0207662_10277889 3300025918 Bacteria 1107
178 Ga0207652_10092823 3300025921 Bacteria 2656
179 Ga0207652_10427418 3300025921 Bacteria 1194
180 Ga0207687_10263205 3300025927 Bacteria 1376
181 Ga0207690_11129474 3300025932 Bacteria 653
182 Ga0207706_10165263 3300025933 Bacteria 1945
183 Ga0207706_11261537 3300025933 Bacteria 612
184 Ga0207670_10255200 3300025936 Bacteria 1357
185 Ga0207711_10650384 3300025941 Bacteria 983
186 Ga0207689_10228827 3300025942 Bacteria 1537
187 Ga0207689_10503809 3300025942 Bacteria 1014
188 Ga0207712_10040527 3300025961 Bacteria 3197
189 Ga0207712_10491986 3300025961 Unclassified 1047
190 Ga0207712_10626608 3300025961 Bacteria 933
191 Ga0207668_10026210 3300025972 Bacteria 3782
192 Ga0207668_10421907 3300025972 Bacteria 1132
193 Ga0207640_10640514 3300025981 Bacteria 904
194 Ga0207703_11566168 3300026035 Unclassified 634
195 Ga0207639_10616114 3300026041 Bacteria 1002
196 Ga0207639_10743857 3300026041 Bacteria 911
197 Ga0207678_10001681 3300026067 Bacteria 20312
198 Ga0207678_10815340 3300026067 Bacteria 824
199 Ga0207702_10609202 3300026078 Bacteria 1072
200 Ga0207641_10397910 3300026088 Bacteria 1322
201 Ga0207648_10880034 3300026089 Bacteria 836
202 Ga0207648_11033741 3300026089 Bacteria 770
203 Ga0207676_10014644 3300026095 Bacteria 5647
204 Ga0207676_10173402 3300026095 Bacteria 1881
205 Ga0207674_10415955 3300026116 Bacteria 1299
206 Ga0207674_10521769 3300026116 Bacteria 1147
207 Ga0207675_100001005 3300026118 Bacteria 27910
208 Ga0207675_100025928 3300026118 Bacteria 5455
209 Ga0207675_100043428 3300026118 Bacteria 4197
210 Ga0207675_100435739 3300026118 Bacteria 1297
211 Ga0207675_100807189 3300026118 Bacteria 952
212 Ga0207683_10445156 3300026121 Bacteria 1194
213 Ga0209973_1010659 3300027252 Bacteria 1091
214 Ga0209966_1008827 3300027695 Bacteria 1793
215 Ga0209813_10136071 3300027866 Bacteria 868
216 Ga0207428_10000114 3300027907 Bacteria 109533
217 Ga0207428_10198519 3300027907 Bacteria 1510
218 Ga0268266_10008391 3300028379 Bacteria 9185
219 Ga0268265_10205967 3300028380 Bacteria 1710
220 Ga0268265_10228616 3300028380 Bacteria 1633
221 Ga0268265_10335233 3300028380 Bacteria 1375
222 Ga0268265_10426021 3300028380 Bacteria 1233
223 Ga0268264_10471936 3300028381 Bacteria 1219
224 Ga0268264_10621116 3300028381 Bacteria 1067
225 Ga0307513_10222526 3300031456 Bacteria 1707
226 Ga0307407_10086944 3300031903 Bacteria 1906
227 Ga0307407_10664826 3300031903 Bacteria 782
228 Ga0307412_10269315 3300031911 Bacteria 1332
229 Ga0307409_100015628 3300031995 Bacteria 4989
230 Ga0307411_10036789 3300032005 Bacteria 3071
231 Ga0307415_100069762 3300032126 Bacteria 2466
232 Ga0373944_0153034 3300035089 Bacteria 814
233 Ga0373955_0437502 3300035172 Bacteria 796
234 Ga0373961_0188053 3300035241 Bacteria 723
235 Ga0373935_0194907 3300035692 Bacteria 1397
236 Ga0373935_0696340 3300035692 Bacteria 747
237 Ga0373947_0229916 3300035725 Bacteria 1221
238 Ga0373937_0815630 3300036401 Bacteria 881
239 Ga0373925_0673756 3300037068 Bacteria 852
240 Ga0373925_0994034 3300037068 Bacteria 691
241 Ga0395900_0438083 3300037418 Bacteria 1265
242 Ga0395901_0610638 3300038443 Bacteria 1099
243 Ga0495603_0034493 3300046455 Bacteria 3042
244 Ga0495603_0197664 3300046455 Bacteria 1162
245 Ga0495582_0051587 3300046473 Bacteria 2268
246 Ga0495605_0177491 3300046474 Bacteria 938
247 Ga0495639_0035935 3300046475 Bacteria 2218
248 Ga0495584_0048775 3300046491 Bacteria 2134
249 Ga0495585_0011043 3300046492 Bacteria 5362
250 Ga0495594_0028078 3300046499 Bacteria 3035
251 Ga0495594_0079136 3300046499 Bacteria 1835
252 Ga0495610_0057881 3300046512 Bacteria 1857
253 Ga0495616_0039253 3300046513 Bacteria 2426
254 Ga0495620_0074469 3300046515 Bacteria 1383
255 Ga0495630_0142776 3300046517 Bacteria 1821
256 Ga0495631_0082926 3300046518 Bacteria 1382
257 Ga0495632_0063407 3300046519 Bacteria 1789
258 Ga0495648_0056094 3300046524 Bacteria 2372
259 Ga0495666_0207742 3300046526 Bacteria 899
260 Ga0495642_0203384 3300046528 Bacteria 863
261 Ga0495640_0634766 3300046533 Bacteria 643
262 Ga0495609_0170529 3300046538 Bacteria 919
263 Ga0495597_0012504 3300046542 Bacteria 4095
264 Ga0495633_0080652 3300046558 Bacteria 1514
265 Ga0495667_0444113 3300046559 Bacteria 815
266 Ga0495668_0012439 3300046616 Bacteria 5045
267 Ga0495611_0096424 3300046648 Bacteria 1369
268 Ga0495625_0030324 3300046660 Bacteria 4037
269 Ga0495625_0171359 3300046660 Bacteria 1449
270 Ga0495588_0044932 3300046674 Bacteria 2263
271 Ga0495669_0149147 3300046684 Bacteria 1106
272 Ga0495624_0591076 3300046690 Bacteria 662
273 Ga0495671_0084695 3300046692 Bacteria 1553
274 Ga0495589_0139645 3300046794 Bacteria 1161
275 Ga0495581_0288293 3300047315 Bacteria 960
276 Ga0495636_0062057 3300047318 Bacteria 1582
277 Ga0495676_0149260 3300047321 Bacteria 1666
278 Ga0495673_0199446 3300047469 Bacteria 749
279 Ga0495686_0169008 3300047472 Bacteria 1273
280 Ga0496102_0022669 3300048905 Bacteria 5565
281 Ga0496102_0500875 3300048905 Bacteria 1137
282 Ga0496104_0000728 3300048907 Bacteria 28341
283 Ga0496104_0594903 3300048907 Bacteria 1016
284 Ga0496107_0119836 3300048910 Bacteria 1938
285 Ga0496112_0000059 3300048915 Bacteria 74946
286 Ga0496112_0233822 3300048915 Bacteria 1792
287 Ga0496115_0199409 3300048918 Bacteria 1653
288 nmdc:mga03n38_918_c1 3300050490 Bacteria 7936
289 nmdc:mga00v17_37840_c1 3300050491 Bacteria 2883
290 nmdc:mga0yw44_15099_c1 3300050492 Bacteria 4125
291 nmdc:mga0yw44_168802_c1 3300050492 Bacteria 1436
292 nmdc:mga0yw44_35216_c1 3300050492 Bacteria 2940
293 nmdc:mga0k408_153267_c1 3300050493 Bacteria 1372
294 nmdc:mga06z11_189389_c1 3300050494 Bacteria 1190
295 nmdc:mga06z11_265_c1 3300050494 Bacteria 20369
296 nmdc:mga04h51_4298_c1 3300050495 Bacteria 3532
297 nmdc:mga05p37_1269412_c1 3300050507 Bacteria 754
298 nmdc:mga05p37_375651_c1 3300050507 Bacteria 1667
299 nmdc:mga05p37_497580_c1 3300050507 Bacteria 1400
300 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
301 nmdc:mga05p37_577797_c1 3300050507 Bacteria 1273
302 nmdc:mga09592_1062433_c1 3300050508 Bacteria 674
303 nmdc:mga09592_35446_c1 3300050508 Bacteria 4177
304 nmdc:mga09592_86400_c1 3300050508 Bacteria 2677
305 nmdc:mga0qj67_1031122_c1 3300050509 Bacteria 645
306 nmdc:mga0qj67_112237_c1 3300050509 Bacteria 2201
307 nmdc:mga0qj67_144788_c1 3300050509 Bacteria 1927
308 nmdc:mga0qj67_197541_c1 3300050509 Bacteria 1634
309 nmdc:mga06r32_1034560_c1 3300050510 Bacteria 773
310 nmdc:mga06r32_111805_c1 3300050510 Bacteria 2688
311 nmdc:mga06r32_1454304_c1 3300050510 Bacteria 626
312 nmdc:mga06r32_174065_c1 3300050510 Bacteria 2137
313 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
314 nmdc:mga08y16_8146_c1 3300050511 Bacteria 10965
315 nmdc:mga0n895_22062_c1 3300050512 Bacteria 5966
316 nmdc:mga0rr50_157149_c1 3300050513 Bacteria 1843
317 nmdc:mga0rr50_385477_c1 3300050513 Bacteria 1182
318 nmdc:mga08x19_307848_c1 3300050514 Bacteria 1101
319 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
320 Ga0495601_0238972 3300053077 Bacteria 1186
321 2513875610 2513237139 Bacteria 8737671
322 2514010998 2513237161 Bacteria 8871253
323 2805919286 2802429603 Bacteria 8777136
324 2824679457 2824671348 Bacteria 8369588
325 2824682004 2824679649 Bacteria 8248951
326 2824696070 2824687955 Bacteria 8360029
327 2824702469 2824696289 Bacteria 8335049
328 2838129133 2838122688 Bacteria 8803140
329 2841944240 2841941048 Bacteria 8688029
330 2841954586 2841949485 Bacteria 8680857
331 2841969021 2841966195 Bacteria 8673214
332 2841979796 2841974524 Bacteria 8931498
333 2841989609 2841983080 Bacteria 8395090
334 2847941535 2847939898 Bacteria 8606328
335 2881366526 2881364244 Bacteria 7710352
336 3005487750 3005483717 Bacteria 7877331
337 Ga0070693_100031300
338 JGI25406J46586_10023576
339 rootH1_10162588
340 rootL2_10149422
341 rootL2_10189158
342 rootH1_10227132
343 Ga0058861_12058804
344 Ga0065707_10252701
345 Ga0070676_10140235
346 Ga0070683_100069291
347 Ga0070670_100016301
348 Ga0068869_100569167
349 Ga0070680_100587321
350 Ga0070682_100015927
351 Ga0070689_100201693
352 Ga0070689_101277037
353 Ga0070668_100020679
354 Ga0070668_100068061
355 Ga0070674_100118315
356 Ga0070688_100754318
357 Ga0070659_100679436
358 Ga0070709_10046275
359 Ga0070709_10175995
360 Ga0070714_100136337
361 Ga0070710_10179466
362 Ga0070711_100189244
363 Ga0070705_100141730
364 Ga0070694_100055268
365 Ga0070694_100922116
366 Ga0070694_101238753
367 Ga0070708_100764184
368 Ga0070663_100001806
369 Ga0070663_100291390
370 Ga0070678_100104307
371 Ga0070662_101291290
372 Ga0070681_10007603
373 Ga0070681_10025489
374 Ga0070681_10248267
375 Ga0068867_100992814
376 Ga0068867_100997542
377 Ga0070706_100007730
378 Ga0070679_100051450
379 Ga0070684_100118017
380 Ga0070684_100172545
381 Ga0068853_100944416
382 Ga0070695_100419123
383 Ga0070696_100025190
384 Ga0070665_100005703
385 Ga0070704_100008623
386 Ga0068855_100330273
387 Ga0068857_100417141
388 Ga0068854_100975967
389 Ga0068859_100050751
390 Ga0068859_100051509
391 Ga0068859_101400825
392 Ga0068864_100065481
393 Ga0068864_100069431
394 Ga0068864_100290049
395 Ga0068861_100010444
396 Ga0068861_100096924
397 Ga0068861_100235569
398 Ga0068861_101223957
399 Ga0068858_101525318
400 Ga0068860_100411879
401 Ga0068860_100495920
402 Ga0068860_100780874
403 Ga0068862_100158844
404 Ga0068862_101001256
405 Ga0081455_10001514
406 Ga0081455_10003893
407 Ga0081455_10005127
408 Ga0081455_10009356
409 Ga0081455_10061951
410 Ga0081455_10074014
411 Ga0081455_10097326
412 Ga0081455_10102842
413 Ga0081540_1000635
414 Ga0081540_1002797
415 Ga0081540_1014968
416 Ga0081539_10001065
417 Ga0081539_10010736
418 Ga0070717_10399204
419 Ga0075365_10070068
420 Ga0075365_10136842
421 Ga0075368_10002760
422 Ga0075363_100576383
423 Ga0070716_101237750
424 Ga0070712_100038311
425 Ga0075367_10006933
426 Ga0075367_10090503
427 Ga0075427_10003422
428 Ga0097621_100117197
429 Ga0068871_100437004
430 Ga0075428_100144382
431 Ga0075428_100586013
432 Ga0075428_100619260
433 Ga0075428_101115615
434 Ga0075428_101140450
435 Ga0075430_100002831
436 Ga0075430_100115117
437 Ga0075431_100063758
438 Ga0075431_100349195
439 Ga0075433_10000903
440 Ga0075433_10347480
441 Ga0075429_100023730
442 Ga0075429_100049053
443 Ga0075429_100064428
444 Ga0075436_100088222
445 Ga0097620_100000033
446 Ga0097620_100050748
447 Ga0097620_100051509
448 Ga0097620_101400691
449 Ga0075435_100107233
450 Ga0075435_100170015
451 Ga0075435_100462328
452 Ga0105240_10047603
453 Ga0111539_10004846
454 Ga0111539_10005347
455 Ga0111539_10033486
456 Ga0111539_10264273
457 Ga0105245_10211584
458 Ga0105245_10579346
459 Ga0105247_10379647
460 Ga0114129_10036822
461 Ga0114129_10048433
462 Ga0114129_10133940
463 Ga0114129_10244559
464 Ga0114129_10548680
465 Ga0114129_10920091
466 Ga0114129_11134164
467 Ga0105243_10082796
468 Ga0105243_10524540
469 Ga0105241_10067072
470 Ga0105237_10682621
471 Ga0105249_10036402
472 Ga0105249_10221683
473 Ga0105249_10603891
474 Ga0105239_10080016
475 Ga0105239_10248337
476 Ga0105239_10804286
477 Ga0157373_10019457
478 Ga0157370_10027238
479 Ga0157370_10766635
480 Ga0157374_10687220
481 Ga0163162_10043553
482 Ga0157372_10052883
483 Ga0157375_10331669
484 Ga0157375_11247053
485 Ga0163163_10002574
486 Ga0163163_10048973
487 Ga0163163_10841459
488 Ga0157380_10177411
489 Ga0157380_10270545
490 Ga0157380_11271000
491 Ga0182008_10430564
492 Ga0157379_10212876
493 Ga0157376_10007492
494 Ga0182007_10153772
495 Ga0163161_10017079
496 Ga0197907_10625441
497 Ga0207692_10030088
498 Ga0207692_10315523
499 Ga0207710_10053834
500 Ga0207710_10288952
501 Ga0207688_10132299
502 Ga0207688_10385972
503 Ga0207647_10019551
504 Ga0207645_10115569
505 Ga0207645_10121549
506 Ga0207684_10001200
507 Ga0207707_10062769
508 Ga0207707_10251189
509 Ga0207695_10194413
510 Ga0207693_10021491
511 Ga0207660_10545205
512 Ga0207660_10568753
513 Ga0207662_10277889
514 Ga0207652_10092823
515 Ga0207652_10427418
516 Ga0207687_10263205
517 Ga0207690_11129474
518 Ga0207706_10165263
519 Ga0207706_11261537
520 Ga0207670_10255200
521 Ga0207711_10650384
522 Ga0207689_10228827
523 Ga0207689_10503809
524 Ga0207712_10040527
525 Ga0207712_10491986
526 Ga0207712_10626608
527 Ga0207668_10026210
528 Ga0207668_10421907
529 Ga0207640_10640514
530 Ga0207703_11566168
531 Ga0207639_10616114
532 Ga0207639_10743857
533 Ga0207678_10001681
534 Ga0207678_10815340
535 Ga0207702_10609202
536 Ga0207641_10397910
537 Ga0207648_10880034
538 Ga0207648_11033741
539 Ga0207676_10014644
540 Ga0207676_10173402
541 Ga0207674_10415955
542 Ga0207674_10521769
543 Ga0207675_100001005
544 Ga0207675_100025928
545 Ga0207675_100043428
546 Ga0207675_100435739
547 Ga0207675_100807189
548 Ga0207683_10445156
549 Ga0209973_1010659
550 Ga0209966_1008827
551 Ga0209813_10136071
552 Ga0207428_10000114
553 Ga0207428_10198519
554 Ga0268266_10008391
555 Ga0268265_10205967
556 Ga0268265_10228616
557 Ga0268265_10335233
558 Ga0268265_10426021
559 Ga0268264_10471936
560 Ga0268264_10621116
561 Ga0307513_10222526
562 Ga0307407_10086944
563 Ga0307407_10664826
564 Ga0307412_10269315
565 Ga0307409_100015628
566 Ga0307411_10036789
567 Ga0307415_100069762
568 Ga0373944_0153034
569 Ga0373955_0437502
570 Ga0373961_0188053
571 Ga0373935_0194907
572 Ga0373935_0696340
573 Ga0373947_0229916
574 Ga0373937_0815630
575 Ga0373925_0673756
576 Ga0373925_0994034
577 Ga0395900_0438083
578 Ga0395901_0610638
579 Ga0495603_0034493
580 Ga0495603_0197664
581 Ga0495582_0051587
582 Ga0495605_0177491
583 Ga0495639_0035935
584 Ga0495584_0048775
585 Ga0495585_0011043
586 Ga0495594_0028078
587 Ga0495594_0079136
588 Ga0495610_0057881
589 Ga0495616_0039253
590 Ga0495620_0074469
591 Ga0495630_0142776
592 Ga0495631_0082926
593 Ga0495632_0063407
594 Ga0495648_0056094
595 Ga0495666_0207742
596 Ga0495642_0203384
597 Ga0495640_0634766
598 Ga0495609_0170529
599 Ga0495597_0012504
600 Ga0495633_0080652
601 Ga0495667_0444113
602 Ga0495668_0012439
603 Ga0495611_0096424
604 Ga0495625_0030324
605 Ga0495625_0171359
606 Ga0495588_0044932
607 Ga0495669_0149147
608 Ga0495624_0591076
609 Ga0495671_0084695
610 Ga0495589_0139645
611 Ga0495581_0288293
612 Ga0495636_0062057
613 Ga0495676_0149260
614 Ga0495673_0199446
615 Ga0495686_0169008
616 Ga0496102_0022669
617 Ga0496102_0500875
618 Ga0496104_0000728
619 Ga0496104_0594903
620 Ga0496107_0119836
621 Ga0496112_0000059
622 Ga0496112_0233822
623 Ga0496115_0199409
624 nmdc:mga03n38_918_c1
625 nmdc:mga00v17_37840_c1
626 nmdc:mga0yw44_15099_c1
627 nmdc:mga0yw44_168802_c1
628 nmdc:mga0yw44_35216_c1
629 nmdc:mga0k408_153267_c1
630 nmdc:mga06z11_189389_c1
631 nmdc:mga06z11_265_c1
632 nmdc:mga04h51_4298_c1
633 nmdc:mga05p37_1269412_c1
634 nmdc:mga05p37_375651_c1
635 nmdc:mga05p37_497580_c1
636 nmdc:mga05p37_56_c3
637 nmdc:mga05p37_577797_c1
638 nmdc:mga09592_1062433_c1
639 nmdc:mga09592_35446_c1
640 nmdc:mga09592_86400_c1
641 nmdc:mga0qj67_1031122_c1
642 nmdc:mga0qj67_112237_c1
643 nmdc:mga0qj67_144788_c1
644 nmdc:mga0qj67_197541_c1
645 nmdc:mga06r32_1034560_c1
646 nmdc:mga06r32_111805_c1
647 nmdc:mga06r32_1454304_c1
648 nmdc:mga06r32_174065_c1
649 nmdc:mga08y16_206_c1
650 nmdc:mga08y16_8146_c1
651 nmdc:mga0n895_22062_c1
652 nmdc:mga0rr50_157149_c1
653 nmdc:mga0rr50_385477_c1
654 nmdc:mga08x19_307848_c1
655 nmdc:mga0a205_80_c1
656 Ga0495601_0238972
657 2513875610
658 2514010998
659 2805919286
660 2824679457
661 2824682004
662 2824696070
663 2824702469
664 2838129133
665 2841944240
666 2841954586
667 2841969021
668 2841979796
669 2841989609
670 2847941535
671 2881366526
672 3005487750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

67

199

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tt9-assembly1.cif.gz_D crystal structure of shewanella benthica group 1 truncated hemoglobin c51s c71s y34f variant 0.8574 44 174
1idr-assembly1.cif.gz_A crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis 0.844 44 175
7tt9-assembly1.cif.gz_D crystal structure of shewanella benthica group 1 truncated hemoglobin c51s c71s y34f variant 0.8302 44 174
3aq7-assembly1.cif.gz_A crystal structure of truncated hemoglobin from tetrahymena pyriformis, y25f mutant, fe(iii) form 0.82 43 174
2gln-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis trhbn, glne11ala mutant 0.8184 44 175
ID Description Score Start End Superfamily
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8177 43 174 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8085 44 174 1.10.490.10
4nk1B01 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8038 45 174 1.10.490.10
2bkmA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7984 43 174 1.10.490.10
1ux8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.7949 43 174 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A832W3M6-F1-model_v4 Group 1 truncated hemoglobin 0.8983 42 181 GO:0019825
GO:0020037
AF-A0A1V6INZ7-F1-model_v4 Group 1 truncated hemoglobin GlbN 0.8932 42 177 GO:0019825
GO:0020037
GO:0046872
AF-A0A538KHG2-F1-model_v4 Group 1 truncated hemoglobin 0.8694 41 177 GO:0019825
GO:0020037
AF-M5ET57-F1-model_v4 Cytosine-specific methyltransferase (EC 2.1.1.37) 0.8614 55 182 GO:0009307
GO:0019825
GO:0020037
GO:0032259
GO:0051719
GO:0051720
AF-A0A521Y2Q1-F1-model_v4 Group 1 truncated hemoglobin 0.8592 35 181 GO:0019825
GO:0020037

Map