F412558

General Info

Members Datasets Scaffolds Average Seq Length
336 188 673 353

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100002305|Ga0070713_1000023058
Length 399
Sequence MLSNPKSVRDPGRYNQRANFGRKQRIARAIVPEHTAGMSSMSQHQSAQPHQDPARWNAVLGRDSSADGRFVYAVTSTGVYCRPSCPSRRPRRDRVEFFENASDAVRAGYRACRRCRPDIQPAADPWIDKVRRACVYLANVDGHLPLTRLAARVGVSPYHFQRRFKQIVGVSPREYADACRLQRLKRGLRSGSRVTAAMVDAGYGSSSRFYERAAAKLAMPPAVYRRGGHGRQIAYAIVDSPLGRLLVAATDRGVCAVYMSSADGELVRALKDEYPGAAAIRQNTRALSRWARQIVGHLEGRRPRLDLPLDVQATAFQWQVWTALRAIPYGETRTYKEVAVSIGRPSAVRAVAHACATNPVSLVVPCHRVVRSTGNLAGYRWGLGRKQVLLAAEHRMKDR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.95
Rhizosphere 91.96
Stem 0
Stem Tuber 0
Unclassified 11.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100002305 3300005436 Bacteria 12419
2 rootH1_10092629 3300003316 Bacteria 1196
3 rootH1_10092629 3300003323 Bacteria 4461
4 Ga0065712_10001508 3300005290 Bacteria 7311
5 Ga0065712_10022766 3300005290 Bacteria 1913
6 Ga0065715_10000829 3300005293 Bacteria 9837
7 Ga0070683_100053145 3300005329 Unclassified 3754
8 Ga0070690_100067444 3300005330 Bacteria 2318
9 Ga0070670_100001831 3300005331 Bacteria 17312
10 Ga0070670_100003897 3300005331 Bacteria 12445
11 Ga0068869_100010302 3300005334 Bacteria 6094
12 Ga0068869_100033915 3300005334 Bacteria 3607
13 Ga0070680_100037086 3300005336 Bacteria 3939
14 Ga0068868_100059069 3300005338 Bacteria 3033
15 Ga0068868_100062695 3300005338 Bacteria 2947
16 Ga0070668_100000003 3300005347 Bacteria 195738
17 Ga0070669_100008981 3300005353 Bacteria 7133
18 Ga0070669_100110741 3300005353 Bacteria 2083
19 Ga0070669_100160291 3300005353 Bacteria 1747
20 Ga0070675_100041885 3300005354 Bacteria 3741
21 Ga0070671_100014472 3300005355 Bacteria 6376
22 Ga0070671_100019931 3300005355 Bacteria 5463
23 Ga0070671_100124787 3300005355 Bacteria 2167
24 Ga0070667_100000035 3300005367 Bacteria 173461
25 Ga0070714_100006288 3300005435 Archaea 9155
26 Ga0070714_100012026 3300005435 Bacteria 6887
27 Ga0070714_100145863 3300005435 Bacteria 2129
28 Ga0070714_100261580 3300005435 Unclassified 1602
29 Ga0070714_100464165 3300005435 Bacteria 1204
30 Ga0070713_100042749 3300005436 Unclassified 3700
31 Ga0070713_100051547 3300005436 Unclassified 3403
32 Ga0070713_100052228 3300005436 Unclassified 3384
33 Ga0070713_100097402 3300005436 Bacteria 2542
34 Ga0070711_100008648 3300005439 Bacteria 6246
35 Ga0070711_100127937 3300005439 Bacteria 1888
36 Ga0070711_100140650 3300005439 Bacteria 1809
37 Ga0070708_100044639 3300005445 Unclassified 3899
38 Ga0070681_10425544 3300005458 Bacteria 1240
39 Ga0068867_100109013 3300005459 Bacteria 2125
40 Ga0068867_100127704 3300005459 Bacteria 1972
41 Ga0070685_10013375 3300005466 Bacteria 4326
42 Ga0070707_100393622 3300005468 Unclassified 1345
43 Ga0070698_100131127 3300005471 Bacteria 2462
44 Ga0070699_100418207 3300005518 Bacteria 1213
45 Ga0070699_100463658 3300005518 Bacteria 1149
46 Ga0070684_100211620 3300005535 Unclassified 1767
47 Ga0068853_100052959 3300005539 Bacteria 3495
48 Ga0070672_100010023 3300005543 Bacteria 6557
49 Ga0070672_100148152 3300005543 Bacteria 1940
50 Ga0070686_100050089 3300005544 Bacteria 2653
51 Ga0070686_100068584 3300005544 Bacteria 2313
52 Ga0070665_100011877 3300005548 Bacteria 8796
53 Ga0070665_100025135 3300005548 Bacteria 6001
54 Ga0070665_100031218 3300005548 Bacteria 5363
55 Ga0070704_100109588 3300005549 Unclassified 2098
56 Ga0068855_100050678 3300005563 Bacteria 4891
57 Ga0070664_100131421 3300005564 Bacteria 2199
58 Ga0068857_100002872 3300005577 Bacteria 14170
59 Ga0068859_100029072 3300005617 Bacteria 5545
60 Ga0068859_100043806 3300005617 Bacteria 4498
61 Ga0068859_100197891 3300005617 Bacteria 2094
62 Ga0068864_100021438 3300005618 Bacteria 5414
63 Ga0068864_100031188 3300005618 Bacteria 4522
64 Ga0068864_100272975 3300005618 Bacteria 1576
65 Ga0068866_10019337 3300005718 Bacteria 3099
66 Ga0068870_10058172 3300005840 Bacteria 2069
67 Ga0068863_100000196 3300005841 Bacteria 64527
68 Ga0068863_100020209 3300005841 Bacteria 6371
69 Ga0068863_100190567 3300005841 Bacteria 1970
70 Ga0068858_100002521 3300005842 Bacteria 18453
71 Ga0068858_100010137 3300005842 Bacteria 8945
72 Ga0068858_100021275 3300005842 Bacteria 6059
73 Ga0068858_100167442 3300005842 Bacteria 2071
74 Ga0068860_100000008 3300005843 Bacteria 427367
75 Ga0068860_100000106 3300005843 Bacteria 133556
76 Ga0068860_100062127 3300005843 Bacteria 3550
77 Ga0068860_100228615 3300005843 Bacteria 1808
78 Ga0068862_100002001 3300005844 Bacteria 18481
79 Ga0068862_100003456 3300005844 Bacteria 13585
80 Ga0068862_100036632 3300005844 Bacteria 4159
81 Ga0068862_100047274 3300005844 Bacteria 3672
82 Ga0081455_10012545 3300005937 Bacteria 8455
83 Ga0070717_10026546 3300006028 Unclassified 4620
84 Ga0070717_10049782 3300006028 Unclassified 3441
85 Ga0070717_10054635 3300006028 Unclassified 3294
86 Ga0070717_10201393 3300006028 Unclassified 1744
87 Ga0070712_100000235 3300006175 Bacteria 30960
88 Ga0097621_100061699 3300006237 Bacteria 3075
89 Ga0097621_100100192 3300006237 Bacteria 2437
90 Ga0097621_100130556 3300006237 Bacteria 2139
91 Ga0068871_100031606 3300006358 Unclassified 4176
92 Ga0068871_100045624 3300006358 Unclassified 3528
93 Ga0075433_10057865 3300006852 Bacteria 3389
94 Ga0075434_100019102 3300006871 Bacteria 6624
95 Ga0075429_100157939 3300006880 Unclassified 1986
96 Ga0068865_100016824 3300006881 Bacteria 4688
97 Ga0068865_100062614 3300006881 Bacteria 2612
98 Ga0075436_100097344 3300006914 Bacteria 2047
99 Ga0075436_100126452 3300006914 Bacteria 1791
100 Ga0097620_100029072 3300006931 Bacteria 5545
101 Ga0097620_100043806 3300006931 Bacteria 4498
102 Ga0097620_100197867 3300006931 Bacteria 2094
103 Ga0075435_100002647 3300007076 Bacteria 11935
104 Ga0075435_100007860 3300007076 Bacteria 7629
105 Ga0075435_100031478 3300007076 Bacteria 4179
106 Ga0099794_10000024 3300007265 Bacteria 62816
107 Ga0111539_10020479 3300009094 Bacteria 8145
108 Ga0105245_10074184 3300009098 Bacteria 3095
109 Ga0105245_10189300 3300009098 Bacteria 1970
110 Ga0114129_10004368 3300009147 Bacteria 19946
111 Ga0114129_10012506 3300009147 Bacteria 12085
112 Ga0114129_10046896 3300009147 Bacteria 6073
113 Ga0114129_10086516 3300009147 Bacteria 4347
114 Ga0105241_10031773 3300009174 Bacteria 3954
115 Ga0105242_10021427 3300009176 Bacteria 5075
116 Ga0105248_10008518 3300009177 Bacteria 11260
117 Ga0105248_10030499 3300009177 Bacteria 6021
118 Ga0105248_10031528 3300009177 Bacteria 5924
119 Ga0105248_10035178 3300009177 Bacteria 5604
120 Ga0105248_10290880 3300009177 Bacteria 1839
121 Ga0105237_10033790 3300009545 Bacteria 5181
122 Ga0105237_10074608 3300009545 Bacteria 3384
123 Ga0105249_10007923 3300009553 Bacteria 9258
124 Ga0157370_10001119 3300013104 Bacteria 33509
125 Ga0157370_10179807 3300013104 Bacteria 1966
126 Ga0157369_10033265 3300013105 Bacteria 5666
127 Ga0157374_10057700 3300013296 Bacteria 3626
128 Ga0157378_10011463 3300013297 Bacteria 7758
129 Ga0157378_10034537 3300013297 Bacteria 4472
130 Ga0163162_10005784 3300013306 Bacteria 11968
131 Ga0163162_10017116 3300013306 Bacteria 7092
132 Ga0163162_10286151 3300013306 Bacteria 1780
133 Ga0157372_10003103 3300013307 Bacteria 17900
134 Ga0157372_10005417 3300013307 Bacteria 13561
135 Ga0157372_10006261 3300013307 Bacteria 12659
136 Ga0157372_10048430 3300013307 Bacteria 4725
137 Ga0157372_10136143 3300013307 Bacteria 2828
138 Ga0157375_10347056 3300013308 Unclassified 1650
139 Ga0163163_10039908 3300014325 Bacteria 4583
140 Ga0163163_10103302 3300014325 Bacteria 2874
141 Ga0163163_10126334 3300014325 Bacteria 2595
142 Ga0163163_10273478 3300014325 Bacteria 1740
143 Ga0157380_10092845 3300014326 Unclassified 2495
144 Ga0157379_10128598 3300014968 Bacteria 2279
145 Ga0157379_10151766 3300014968 Bacteria 2090
146 Ga0157376_10027038 3300014969 Bacteria 4542
147 Ga0163161_10231319 3300017792 Bacteria 1435
148 Ga0213876_10134416 3300021384 Bacteria 1315
149 Ga0207692_10034437 3300025898 Unclassified 2452
150 Ga0207642_10025220 3300025899 Bacteria 2401
151 Ga0207680_10003470 3300025903 Bacteria 7431
152 Ga0207680_10118604 3300025903 Bacteria 1727
153 Ga0207647_10010535 3300025904 Bacteria 6525
154 Ga0207699_10104933 3300025906 Bacteria 1801
155 Ga0207699_10146696 3300025906 Bacteria 1556
156 Ga0207643_10085100 3300025908 Bacteria 1836
157 Ga0207684_10226923 3300025910 Bacteria 1612
158 Ga0207654_10056453 3300025911 Bacteria 2278
159 Ga0207707_10211878 3300025912 Bacteria 1687
160 Ga0207695_10002410 3300025913 Bacteria 27685
161 Ga0207695_10006096 3300025913 Bacteria 15731
162 Ga0207671_10092538 3300025914 Bacteria 2280
163 Ga0207693_10000034 3300025915 Bacteria 113763
164 Ga0207693_10025416 3300025915 Bacteria 4696
165 Ga0207663_10044744 3300025916 Bacteria 2719
166 Ga0207663_10117413 3300025916 Bacteria 1815
167 Ga0207663_10303655 3300025916 Bacteria 1193
168 Ga0207660_10039095 3300025917 Bacteria 3315
169 Ga0207652_10007534 3300025921 Bacteria 8765
170 Ga0207681_10020286 3300025923 Unclassified 4208
171 Ga0207681_10096093 3300025923 Bacteria 2127
172 Ga0207650_10003001 3300025925 Bacteria 11628
173 Ga0207650_10021574 3300025925 Bacteria 4550
174 Ga0207687_10008571 3300025927 Bacteria 6686
175 Ga0207700_10007043 3300025928 Bacteria 6840
176 Ga0207700_10102439 3300025928 Unclassified 2286
177 Ga0207664_10100851 3300025929 Bacteria 2384
178 Ga0207644_10000247 3300025931 Bacteria 36756
179 Ga0207644_10110785 3300025931 Bacteria 2075
180 Ga0207690_10112732 3300025932 Bacteria 1961
181 Ga0207706_10047551 3300025933 Bacteria 3795
182 Ga0207686_10019293 3300025934 Bacteria 3875
183 Ga0207691_10036861 3300025940 Bacteria 4530
184 Ga0207691_10041686 3300025940 Bacteria 4237
185 Ga0207691_10111063 3300025940 Unclassified 2438
186 Ga0207711_10015523 3300025941 Bacteria 6322
187 Ga0207711_10018801 3300025941 Bacteria 5745
188 Ga0207689_10000590 3300025942 Bacteria 34632
189 Ga0207661_10144826 3300025944 Bacteria 2048
190 Ga0207679_10216122 3300025945 Bacteria 1611
191 Ga0207679_10232752 3300025945 Bacteria 1557
192 Ga0207668_10000006 3300025972 Bacteria 191468
193 Ga0207668_10111924 3300025972 Bacteria 2050
194 Ga0207658_10000136 3300025986 Bacteria 77275
195 Ga0207658_10007814 3300025986 Bacteria 7284
196 Ga0207677_10060382 3300026023 Bacteria 2620
197 Ga0207677_10076177 3300026023 Bacteria 2387
198 Ga0207703_10001192 3300026035 Bacteria 24458
199 Ga0207703_10022477 3300026035 Unclassified 4947
200 Ga0207703_10034099 3300026035 Bacteria 4038
201 Ga0207703_10050177 3300026035 Bacteria 3376
202 Ga0207703_10113548 3300026035 Bacteria 2315
203 Ga0207639_10052624 3300026041 Bacteria 3103
204 Ga0207702_10012489 3300026078 Bacteria 7065
205 Ga0207641_10000198 3300026088 Bacteria 81646
206 Ga0207641_10000624 3300026088 Bacteria 38628
207 Ga0207641_10006412 3300026088 Bacteria 9916
208 Ga0207641_10010060 3300026088 Bacteria 7777
209 Ga0207648_10047288 3300026089 Bacteria 3772
210 Ga0207648_10097161 3300026089 Bacteria 2578
211 Ga0207676_10003019 3300026095 Bacteria 12004
212 Ga0207676_10008192 3300026095 Bacteria 7437
213 Ga0207676_10055195 3300026095 Bacteria 3117
214 Ga0207676_10056460 3300026095 Bacteria 3087
215 Ga0207676_10218723 3300026095 Bacteria 1695
216 Ga0207674_10000216 3300026116 Bacteria 71622
217 Ga0207675_100050651 3300026118 Bacteria 3875
218 Ga0207675_100490001 3300026118 Bacteria 1223
219 Ga0207698_10074593 3300026142 Bacteria 2707
220 Ga0209588_1000007 3300027671 Bacteria 183924
221 Ga0207428_10049798 3300027907 Unclassified 3355
222 Ga0268266_10039749 3300028379 Bacteria 4007
223 Ga0268266_10068159 3300028379 Bacteria 3080
224 Ga0268265_10001012 3300028380 Bacteria 25391
225 Ga0268265_10003991 3300028380 Bacteria 10389
226 Ga0268265_10036261 3300028380 Bacteria 3611
227 Ga0268265_10060082 3300028380 Bacteria 2912
228 Ga0268264_10000018 3300028381 Bacteria 495324
229 Ga0268264_10000076 3300028381 Bacteria 255518
230 Ga0268264_10017337 3300028381 Bacteria 5901
231 Ga0268264_10058831 3300028381 Bacteria 3219
232 Ga0265338_10039253 3300028800 Bacteria 4471
233 Ga0265327_10005170 3300031251 Bacteria 11058
234 Ga0307405_10074410 3300031731 Bacteria 2197
235 Ga0373926_0011672 3300035083 Bacteria 2961
236 Ga0373936_0056899 3300035113 Unclassified 1590
237 Ga0373945_0033487 3300035116 Bacteria 1826
238 Ga0373943_0004498 3300035170 Bacteria 6308
239 Ga0373943_0032559 3300035170 Bacteria 2479
240 Ga0373946_0108782 3300035171 Bacteria 1252
241 Ga0373955_0040661 3300035172 Unclassified 2488
242 Ga0373931_0111124 3300035691 Bacteria 1555
243 Ga0373927_0005316 3300035695 Bacteria 8898
244 Ga0373927_0031981 3300035695 Bacteria 3427
245 Ga0373927_0049776 3300035695 Unclassified 2709
246 Ga0373947_0021816 3300035725 Bacteria 3710
247 Ga0373947_0036182 3300035725 Bacteria 2927
248 Ga0373937_0030154 3300036401 Bacteria 4913
249 Ga0373937_0198739 3300036401 Unclassified 1884
250 Ga0373925_0003217 3300037068 Bacteria 12758
251 Ga0373925_0009433 3300037068 Bacteria 7106
252 Ga0373925_0023043 3300037068 Bacteria 4544
253 Ga0373925_0360636 3300037068 Bacteria 1181
254 Ga0395905_0000150 3300037471 Bacteria 115552
255 Ga0436364_0509144 3300037853 Unclassified 2508
256 Ga0436364_0655390 3300037853 Unclassified 2004
257 Ga0242420_011134 3300038996 Bacteria 1504
258 Ga0436365_0125447 3300039437 Bacteria 2124
259 Ga0436365_0467103 3300039437 Bacteria 5599
260 Ga0436361_1015391 3300039447 Bacteria 3672
261 Ga0450920_002071 3300042122 Bacteria 3387
262 Ga0450896_000954 3300042133 Bacteria 3350
263 Ga0466963_0163972 3300044694 Bacteria 1548
264 Ga0466957_0024687 3300044842 Bacteria 3559
265 Ga0466957_0170801 3300044842 Unclassified 1416
266 Ga0466959_0172765 3300045049 Unclassified 1515
267 Ga0466967_0032432 3300045976 Bacteria 4411
268 Ga0466967_0094582 3300045976 Bacteria 2721
269 Ga0495580_0001034 3300046472 Bacteria 24401
270 Ga0495580_0004201 3300046472 Bacteria 12112
271 Ga0495582_0001697 3300046473 Bacteria 12420
272 Ga0495582_0019155 3300046473 Bacteria 3745
273 Ga0495639_0050074 3300046475 Bacteria 1897
274 Ga0495594_0014829 3300046499 Bacteria 4089
275 Ga0495630_0048859 3300046517 Bacteria 3166
276 Ga0495630_0105670 3300046517 Unclassified 2132
277 Ga0495666_0050936 3300046526 Unclassified 1990
278 Ga0495652_0083312 3300046529 Bacteria 2633
279 Ga0495665_0002240 3300046531 Bacteria 10470
280 Ga0495586_0015941 3300046535 Bacteria 3998
281 Ga0495586_0039632 3300046535 Bacteria 2533
282 Ga0495587_0073358 3300046536 Unclassified 1988
283 Ga0495645_0006791 3300046543 Bacteria 7952
284 Ga0495588_0043874 3300046674 Bacteria 2289
285 Ga0495599_0007222 3300046678 Bacteria 6731
286 Ga0495623_0003657 3300046679 Bacteria 10159
287 Ga0495669_0014588 3300046684 Bacteria 3359
288 Ga0495669_0044266 3300046684 Bacteria 1983
289 Ga0495624_0091382 3300046690 Unclassified 1878
290 Ga0495675_0024498 3300047444 Bacteria 3847
291 Ga0496101_0100212 3300048904 Bacteria 2167
292 Ga0496101_0369269 3300048904 Bacteria 1128
293 Ga0496102_0520325 3300048905 Bacteria 1112
294 Ga0496104_0025563 3300048907 Bacteria 5445
295 Ga0496104_0103174 3300048907 Bacteria 2732
296 Ga0496104_0279920 3300048907 Bacteria 1581
297 Ga0496106_0043309 3300048909 Bacteria 3377
298 Ga0496106_0243201 3300048909 Bacteria 1438
299 Ga0496108_0035875 3300048911 Bacteria 4124
300 Ga0496108_0380498 3300048911 Bacteria 1232
301 Ga0496109_0002453 3300048912 Bacteria 15541
302 Ga0496109_0018324 3300048912 Bacteria 6150
303 Ga0496110_0003636 3300048913 Bacteria 11859
304 Ga0496110_0100744 3300048913 Bacteria 2589
305 Ga0496111_0201485 3300048914 Bacteria 1479
306 Ga0496111_0239043 3300048914 Unclassified 1349
307 Ga0496112_0000339 3300048915 Bacteria 30407
308 Ga0496112_0003798 3300048915 Bacteria 12621
309 Ga0496112_0010317 3300048915 Bacteria 8471
310 Ga0496112_0015804 3300048915 Bacteria 7051
311 Ga0501034_0016705 3300049571 Bacteria 7525
312 Ga0501034_0050775 3300049571 Bacteria 4183
313 Ga0501034_0178681 3300049571 Unclassified 2088
314 Ga0501038_0284898 3300049574 Bacteria 1300
315 Ga0501040_0137654 3300049576 Bacteria 1719
316 Ga0501047_0006349 3300049581 Bacteria 11115
317 Ga0501047_0199456 3300049581 Bacteria 1862
318 Ga0501067_0023258 3300049583 Bacteria 3434
319 Ga0501076_0317792 3300049592 Bacteria 1277
320 Ga0501044_0027040 3300049823 Bacteria 6069
321 Ga0501044_0298598 3300049823 Bacteria 1540
322 nmdc:mga05p37_16672_c1 3300050507 Bacteria 8852
323 nmdc:mga05p37_36458_c1 3300050507 Bacteria 6033
324 nmdc:mga05p37_70825_c1 3300050507 Bacteria 4289
325 nmdc:mga05p37_9580_c1 3300050507 Bacteria 11471
326 nmdc:mga09592_63918_c1 3300050508 Unclassified 3115
327 nmdc:mga08y16_41501_c1 3300050511 Unclassified 4820
328 nmdc:mga0n895_224359_c1 3300050512 Bacteria 1907
329 nmdc:mga0n895_35563_c1 3300050512 Bacteria 4803
330 nmdc:mga0n895_69461_c1 3300050512 Bacteria 3490
331 nmdc:mga0rr50_24269_c1 3300050513 Bacteria 4198
332 nmdc:mga0rr50_27647_c1 3300050513 Bacteria 3975
333 nmdc:mga08x19_7570_c1 3300050514 Bacteria 6453
334 nmdc:mga0a205_161326_c1 3300050515 Bacteria 2139
335 nmdc:mga0a205_3905_c1 3300050515 Bacteria 13339
336 Ga0495595_0017222 3300053084 Bacteria 3108
337 Ga0500595_006055 3300053119 Bacteria 5191
338 Ga0070713_100002305
339 rootH1_10092629
340 Ga0065712_10001508
341 Ga0065712_10022766
342 Ga0065715_10000829
343 Ga0070683_100053145
344 Ga0070690_100067444
345 Ga0070670_100001831
346 Ga0070670_100003897
347 Ga0068869_100010302
348 Ga0068869_100033915
349 Ga0070680_100037086
350 Ga0068868_100059069
351 Ga0068868_100062695
352 Ga0070668_100000003
353 Ga0070669_100008981
354 Ga0070669_100110741
355 Ga0070669_100160291
356 Ga0070675_100041885
357 Ga0070671_100014472
358 Ga0070671_100019931
359 Ga0070671_100124787
360 Ga0070667_100000035
361 Ga0070714_100006288
362 Ga0070714_100012026
363 Ga0070714_100145863
364 Ga0070714_100261580
365 Ga0070714_100464165
366 Ga0070713_100042749
367 Ga0070713_100051547
368 Ga0070713_100052228
369 Ga0070713_100097402
370 Ga0070711_100008648
371 Ga0070711_100127937
372 Ga0070711_100140650
373 Ga0070708_100044639
374 Ga0070681_10425544
375 Ga0068867_100109013
376 Ga0068867_100127704
377 Ga0070685_10013375
378 Ga0070707_100393622
379 Ga0070698_100131127
380 Ga0070699_100418207
381 Ga0070699_100463658
382 Ga0070684_100211620
383 Ga0068853_100052959
384 Ga0070672_100010023
385 Ga0070672_100148152
386 Ga0070686_100050089
387 Ga0070686_100068584
388 Ga0070665_100011877
389 Ga0070665_100025135
390 Ga0070665_100031218
391 Ga0070704_100109588
392 Ga0068855_100050678
393 Ga0070664_100131421
394 Ga0068857_100002872
395 Ga0068859_100029072
396 Ga0068859_100043806
397 Ga0068859_100197891
398 Ga0068864_100021438
399 Ga0068864_100031188
400 Ga0068864_100272975
401 Ga0068866_10019337
402 Ga0068870_10058172
403 Ga0068863_100000196
404 Ga0068863_100020209
405 Ga0068863_100190567
406 Ga0068858_100002521
407 Ga0068858_100010137
408 Ga0068858_100021275
409 Ga0068858_100167442
410 Ga0068860_100000008
411 Ga0068860_100000106
412 Ga0068860_100062127
413 Ga0068860_100228615
414 Ga0068862_100002001
415 Ga0068862_100003456
416 Ga0068862_100036632
417 Ga0068862_100047274
418 Ga0081455_10012545
419 Ga0070717_10026546
420 Ga0070717_10049782
421 Ga0070717_10054635
422 Ga0070717_10201393
423 Ga0070712_100000235
424 Ga0097621_100061699
425 Ga0097621_100100192
426 Ga0097621_100130556
427 Ga0068871_100031606
428 Ga0068871_100045624
429 Ga0075433_10057865
430 Ga0075434_100019102
431 Ga0075429_100157939
432 Ga0068865_100016824
433 Ga0068865_100062614
434 Ga0075436_100097344
435 Ga0075436_100126452
436 Ga0097620_100029072
437 Ga0097620_100043806
438 Ga0097620_100197867
439 Ga0075435_100002647
440 Ga0075435_100007860
441 Ga0075435_100031478
442 Ga0099794_10000024
443 Ga0111539_10020479
444 Ga0105245_10074184
445 Ga0105245_10189300
446 Ga0114129_10004368
447 Ga0114129_10012506
448 Ga0114129_10046896
449 Ga0114129_10086516
450 Ga0105241_10031773
451 Ga0105242_10021427
452 Ga0105248_10008518
453 Ga0105248_10030499
454 Ga0105248_10031528
455 Ga0105248_10035178
456 Ga0105248_10290880
457 Ga0105237_10033790
458 Ga0105237_10074608
459 Ga0105249_10007923
460 Ga0157370_10001119
461 Ga0157370_10179807
462 Ga0157369_10033265
463 Ga0157374_10057700
464 Ga0157378_10011463
465 Ga0157378_10034537
466 Ga0163162_10005784
467 Ga0163162_10017116
468 Ga0163162_10286151
469 Ga0157372_10003103
470 Ga0157372_10005417
471 Ga0157372_10006261
472 Ga0157372_10048430
473 Ga0157372_10136143
474 Ga0157375_10347056
475 Ga0163163_10039908
476 Ga0163163_10103302
477 Ga0163163_10126334
478 Ga0163163_10273478
479 Ga0157380_10092845
480 Ga0157379_10128598
481 Ga0157379_10151766
482 Ga0157376_10027038
483 Ga0163161_10231319
484 Ga0213876_10134416
485 Ga0207692_10034437
486 Ga0207642_10025220
487 Ga0207680_10003470
488 Ga0207680_10118604
489 Ga0207647_10010535
490 Ga0207699_10104933
491 Ga0207699_10146696
492 Ga0207643_10085100
493 Ga0207684_10226923
494 Ga0207654_10056453
495 Ga0207707_10211878
496 Ga0207695_10002410
497 Ga0207695_10006096
498 Ga0207671_10092538
499 Ga0207693_10000034
500 Ga0207693_10025416
501 Ga0207663_10044744
502 Ga0207663_10117413
503 Ga0207663_10303655
504 Ga0207660_10039095
505 Ga0207652_10007534
506 Ga0207681_10020286
507 Ga0207681_10096093
508 Ga0207650_10003001
509 Ga0207650_10021574
510 Ga0207687_10008571
511 Ga0207700_10007043
512 Ga0207700_10102439
513 Ga0207664_10100851
514 Ga0207644_10000247
515 Ga0207644_10110785
516 Ga0207690_10112732
517 Ga0207706_10047551
518 Ga0207686_10019293
519 Ga0207691_10036861
520 Ga0207691_10041686
521 Ga0207691_10111063
522 Ga0207711_10015523
523 Ga0207711_10018801
524 Ga0207689_10000590
525 Ga0207661_10144826
526 Ga0207679_10216122
527 Ga0207679_10232752
528 Ga0207668_10000006
529 Ga0207668_10111924
530 Ga0207658_10000136
531 Ga0207658_10007814
532 Ga0207677_10060382
533 Ga0207677_10076177
534 Ga0207703_10001192
535 Ga0207703_10022477
536 Ga0207703_10034099
537 Ga0207703_10050177
538 Ga0207703_10113548
539 Ga0207639_10052624
540 Ga0207702_10012489
541 Ga0207641_10000198
542 Ga0207641_10000624
543 Ga0207641_10006412
544 Ga0207641_10010060
545 Ga0207648_10047288
546 Ga0207648_10097161
547 Ga0207676_10003019
548 Ga0207676_10008192
549 Ga0207676_10055195
550 Ga0207676_10056460
551 Ga0207676_10218723
552 Ga0207674_10000216
553 Ga0207675_100050651
554 Ga0207675_100490001
555 Ga0207698_10074593
556 Ga0209588_1000007
557 Ga0207428_10049798
558 Ga0268266_10039749
559 Ga0268266_10068159
560 Ga0268265_10001012
561 Ga0268265_10003991
562 Ga0268265_10036261
563 Ga0268265_10060082
564 Ga0268264_10000018
565 Ga0268264_10000076
566 Ga0268264_10017337
567 Ga0268264_10058831
568 Ga0265338_10039253
569 Ga0265327_10005170
570 Ga0307405_10074410
571 Ga0373926_0011672
572 Ga0373936_0056899
573 Ga0373945_0033487
574 Ga0373943_0004498
575 Ga0373943_0032559
576 Ga0373946_0108782
577 Ga0373955_0040661
578 Ga0373931_0111124
579 Ga0373927_0005316
580 Ga0373927_0031981
581 Ga0373927_0049776
582 Ga0373947_0021816
583 Ga0373947_0036182
584 Ga0373937_0030154
585 Ga0373937_0198739
586 Ga0373925_0003217
587 Ga0373925_0009433
588 Ga0373925_0023043
589 Ga0373925_0360636
590 Ga0395905_0000150
591 Ga0436364_0509144
592 Ga0436364_0655390
593 Ga0242420_011134
594 Ga0436365_0125447
595 Ga0436365_0467103
596 Ga0436361_1015391
597 Ga0450920_002071
598 Ga0450896_000954
599 Ga0466963_0163972
600 Ga0466957_0024687
601 Ga0466957_0170801
602 Ga0466959_0172765
603 Ga0466967_0032432
604 Ga0466967_0094582
605 Ga0495580_0001034
606 Ga0495580_0004201
607 Ga0495582_0001697
608 Ga0495582_0019155
609 Ga0495639_0050074
610 Ga0495594_0014829
611 Ga0495630_0048859
612 Ga0495630_0105670
613 Ga0495666_0050936
614 Ga0495652_0083312
615 Ga0495665_0002240
616 Ga0495586_0015941
617 Ga0495586_0039632
618 Ga0495587_0073358
619 Ga0495645_0006791
620 Ga0495588_0043874
621 Ga0495599_0007222
622 Ga0495623_0003657
623 Ga0495669_0014588
624 Ga0495669_0044266
625 Ga0495624_0091382
626 Ga0495675_0024498
627 Ga0496101_0100212
628 Ga0496101_0369269
629 Ga0496102_0520325
630 Ga0496104_0025563
631 Ga0496104_0103174
632 Ga0496104_0279920
633 Ga0496106_0043309
634 Ga0496106_0243201
635 Ga0496108_0035875
636 Ga0496108_0380498
637 Ga0496109_0002453
638 Ga0496109_0018324
639 Ga0496110_0003636
640 Ga0496110_0100744
641 Ga0496111_0201485
642 Ga0496111_0239043
643 Ga0496112_0000339
644 Ga0496112_0003798
645 Ga0496112_0010317
646 Ga0496112_0015804
647 Ga0501034_0016705
648 Ga0501034_0050775
649 Ga0501034_0178681
650 Ga0501038_0284898
651 Ga0501040_0137654
652 Ga0501047_0006349
653 Ga0501047_0199456
654 Ga0501067_0023258
655 Ga0501076_0317792
656 Ga0501044_0027040
657 Ga0501044_0298598
658 nmdc:mga05p37_16672_c1
659 nmdc:mga05p37_36458_c1
660 nmdc:mga05p37_70825_c1
661 nmdc:mga05p37_9580_c1
662 nmdc:mga09592_63918_c1
663 nmdc:mga08y16_41501_c1
664 nmdc:mga0n895_224359_c1
665 nmdc:mga0n895_35563_c1
666 nmdc:mga0n895_69461_c1
667 nmdc:mga0rr50_24269_c1
668 nmdc:mga0rr50_27647_c1
669 nmdc:mga08x19_7570_c1
670 nmdc:mga0a205_161326_c1
671 nmdc:mga0a205_3905_c1
672 Ga0495595_0017222
673 Ga0500595_006055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

315

395

0.98

PF02805

Ada_Zn_binding

Metal binding domain of Ada

54

118

0.98

PF12833

HTH_18

Helix-turn-helix domain

149

227

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

139

176

0.95

PF02870

Methyltransf_1N

6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

233

311

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.9405 185 347
1sfe-assembly1.cif.gz_A ada o6-methylguanine-dna methyltransferase from escherichia coli 0.9242 185 347
3gx4-assembly1.cif.gz_X crystal structure analysis of s. pombe atl in complex with dna 0.9096 268 346
4enn-assembly1.cif.gz_A crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine 0.9006 268 346
4zyd-assembly2.cif.gz_A-3 crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna 0.8652 187 347
ID Description Score Start End Superfamily
1u8bA01 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.9985 10 75 3.40.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.992 265 346 1.10.10.10
af_P9WJW3_2_72_3.40.10.10 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.9866 11 76 3.40.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 265 347 1.10.10.10
af_O76339_109_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 265 345 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R6AC40-F1-model_v4 deleted 0.9981 11 75
AF-A0A2W5MMP6-F1-model_v4 deleted 0.996 268 347
AF-A0A2E2F1Y1-F1-model_v4 deleted 0.9952 272 345
AF-A0A7V3PX24-F1-model_v4 MGMT family protein 0.9905 267 346 GO:0003908
GO:0006281
GO:0032259
AF-A0A1V1X0W6-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase DNA binding domain-containing protein 0.9894 266 347 GO:0003908
GO:0006281
GO:0032259

Map