F412545

General Info

Members Datasets Scaffolds Average Seq Length
336 179 672 310

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100194002|Ga0070668_1001940022
Length 369
Sequence LFHLALDRTENPEVHEVVDEIALQGESCHGVVTAHRSAEAMKPVPFASHAAEDPGRKALKEPHLILGIGELLWDLLPEGPRLGGAPANFTVMAGRLGSHAAILSRIGRDDLGRGAVDQLDPLPADTSFLQIDPVHETGRVTVSFNHGQPEYTIHQPAAWDSMELSGEWVQLAERADAVCFGSLAQRSLESRQTIQTLAAQTSARCIRIFDVNLRPPFYSSEVVQESLELSTVVKMNDAEVPMVLALLGLPADEDPTPVALRLGAERLLAEFPTLQMVAVTRGGHGSLLVKREEWHEHPGYPVEVVDTIGAGDAFTAAMAHYLLRGADLLTLNEAGNRWGGWLASQTGAMPPLPERIKAEMEAAIQLAML

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 2.98
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100194002 3300005347 Bacteria 1665
2 rootH2_10118283 3300003320 Bacteria 5063
3 Ga0065715_10003293 3300005293 Bacteria 4981
4 Ga0070658_10029314 3300005327 Unclassified 4420
5 Ga0070658_10086950 3300005327 Bacteria 2572
6 Ga0070683_100001452 3300005329 Bacteria 18237
7 Ga0070683_100040001 3300005329 Bacteria 4308
8 Ga0070683_100381693 3300005329 Bacteria 1343
9 Ga0070670_100080048 3300005331 Unclassified 2808
10 Ga0068869_100009075 3300005334 Bacteria 6444
11 Ga0070666_10009394 3300005335 Bacteria 6094
12 Ga0070680_100007222 3300005336 Bacteria 8465
13 Ga0070680_100056851 3300005336 Bacteria 3198
14 Ga0068868_100171059 3300005338 Bacteria 1798
15 Ga0070660_100017999 3300005339 Bacteria 5156
16 Ga0070661_100028119 3300005344 Bacteria 4055
17 Ga0070675_100083634 3300005354 Bacteria 2664
18 Ga0070671_100024533 3300005355 Unclassified 4938
19 Ga0070673_100044285 3300005364 Bacteria 3445
20 Ga0070667_100000148 3300005367 Bacteria 87700
21 Ga0070667_100304068 3300005367 Unclassified 1436
22 Ga0070709_10028967 3300005434 Bacteria 3307
23 Ga0070714_100101064 3300005435 Bacteria 2540
24 Ga0070714_100298531 3300005435 Bacteria 1501
25 Ga0070713_100014278 3300005436 Bacteria 5892
26 Ga0070713_100406902 3300005436 Unclassified 1272
27 Ga0070694_100033599 3300005444 Bacteria 3377
28 Ga0070678_100243218 3300005456 Bacteria 1505
29 Ga0070662_100144521 3300005457 Unclassified 1847
30 Ga0070681_10009748 3300005458 Bacteria 9452
31 Ga0070681_10023554 3300005458 Bacteria 6192
32 Ga0070681_10040766 3300005458 Bacteria 4652
33 Ga0068867_100122565 3300005459 Bacteria 2011
34 Ga0070679_100027501 3300005530 Bacteria 5599
35 Ga0070679_100094219 3300005530 Bacteria 2981
36 Ga0070684_100005700 3300005535 Bacteria 9565
37 Ga0070684_100523790 3300005535 Unclassified 1099
38 Ga0070697_100382438 3300005536 Bacteria 1219
39 Ga0068853_100004717 3300005539 Bacteria 10580
40 Ga0068853_100153862 3300005539 Unclassified 2071
41 Ga0068853_100247409 3300005539 Bacteria 1635
42 Ga0070672_100031929 3300005543 Bacteria 3969
43 Ga0070695_100011771 3300005545 Bacteria 5238
44 Ga0070696_100107570 3300005546 Bacteria 2006
45 Ga0070693_100015007 3300005547 Unclassified 3982
46 Ga0070704_100062482 3300005549 Bacteria 2670
47 Ga0068855_100002486 3300005563 Bacteria 22705
48 Ga0068855_100003652 3300005563 Bacteria 18823
49 Ga0068855_100007674 3300005563 Bacteria 13035
50 Ga0068855_100062939 3300005563 Bacteria 4330
51 Ga0068855_100278245 3300005563 Bacteria 1859
52 Ga0070664_100329273 3300005564 Unclassified 1385
53 Ga0068857_100000578 3300005577 Bacteria 26753
54 Ga0068857_100025127 3300005577 Bacteria 5246
55 Ga0068857_100034701 3300005577 Unclassified 4462
56 Ga0068854_100013025 3300005578 Bacteria 5451
57 Ga0068856_100001009 3300005614 Bacteria 29932
58 Ga0068856_100010669 3300005614 Bacteria 8927
59 Ga0068856_100017140 3300005614 Bacteria 7021
60 Ga0070702_100075092 3300005615 Bacteria 2008
61 Ga0068852_100000167 3300005616 Bacteria 43924
62 Ga0068852_100000187 3300005616 Bacteria 41869
63 Ga0068852_100080447 3300005616 Unclassified 2889
64 Ga0068852_100297863 3300005616 Bacteria 1560
65 Ga0068852_100301123 3300005616 Bacteria 1552
66 Ga0068859_100173126 3300005617 Bacteria 2240
67 Ga0068864_100045183 3300005618 Bacteria 3778
68 Ga0068851_10009850 3300005834 Bacteria 4452
69 Ga0068851_10021009 3300005834 Bacteria 3166
70 Ga0068863_100032321 3300005841 Plasmid 4988
71 Ga0068858_100067455 3300005842 Bacteria 3314
72 Ga0068858_100151589 3300005842 Unclassified 2180
73 Ga0068860_100009553 3300005843 Bacteria 9634
74 Ga0068860_100468935 3300005843 Bacteria 1254
75 Ga0081540_1024698 3300005983 Bacteria 3480
76 Ga0075365_10231671 3300006038 Bacteria 1297
77 Ga0070716_100069184 3300006173 Bacteria 2068
78 Ga0070712_100294642 3300006175 Bacteria 1311
79 Ga0097621_100015197 3300006237 Bacteria 5785
80 Ga0097621_100138223 3300006237 Unclassified 2080
81 Ga0068871_100111511 3300006358 Unclassified 2301
82 Ga0068871_100484770 3300006358 Unclassified 1113
83 Ga0075433_10002651 3300006852 Bacteria 13655
84 Ga0075429_100160010 3300006880 Bacteria 1972
85 Ga0097620_100173131 3300006931 Bacteria 2240
86 Ga0075435_100000086 3300007076 Bacteria 49112
87 Ga0105240_10004090 3300009093 Bacteria 22417
88 Ga0105240_10004686 3300009093 Bacteria 20679
89 Ga0105240_10013472 3300009093 Bacteria 11231
90 Ga0105240_10054700 3300009093 Bacteria 5001
91 Ga0105240_10063258 3300009093 Bacteria 4603
92 Ga0105240_10076348 3300009093 Unclassified 4131
93 Ga0105240_10208744 3300009093 Bacteria 2284
94 Ga0105240_10226207 3300009093 Unclassified 2177
95 Ga0105240_10492749 3300009093 Bacteria 1364
96 Ga0105240_10581804 3300009093 Bacteria 1235
97 Ga0105245_10016829 3300009098 Bacteria 6384
98 Ga0105245_10067012 3300009098 Bacteria 3251
99 Ga0105245_10142300 3300009098 Unclassified 2260
100 Ga0105245_10368765 3300009098 Unclassified 1427
101 Ga0105247_10095121 3300009101 Bacteria 1897
102 Ga0105247_10121067 3300009101 Bacteria 1695
103 Ga0114129_10113490 3300009147 Bacteria 3736
104 Ga0105241_10000024 3300009174 Bacteria 140808
105 Ga0105241_10003746 3300009174 Bacteria 11276
106 Ga0105241_10273108 3300009174 Unclassified 1441
107 Ga0105242_10140056 3300009176 Bacteria 2098
108 Ga0105248_10001736 3300009177 Bacteria 24224
109 Ga0105248_10019891 3300009177 Bacteria 7434
110 Ga0105237_10007438 3300009545 Bacteria 11984
111 Ga0105237_10079759 3300009545 Bacteria 3264
112 Ga0105237_10106723 3300009545 Bacteria 2793
113 Ga0105237_10324096 3300009545 Bacteria 1544
114 Ga0105238_10004489 3300009551 Bacteria 13826
115 Ga0105238_10009754 3300009551 Bacteria 9616
116 Ga0105238_10027244 3300009551 Bacteria 5822
117 Ga0105238_10154255 3300009551 Bacteria 2271
118 Ga0105238_10178229 3300009551 Unclassified 2102
119 Ga0105249_10032303 3300009553 Plasmid 4735
120 Ga0105239_10006366 3300010375 Bacteria 13718
121 Ga0105239_10012404 3300010375 Bacteria 9488
122 Ga0105239_10263312 3300010375 Bacteria 1938
123 Ga0105239_10725710 3300010375 Bacteria 1137
124 Ga0105246_10086893 3300011119 Unclassified 2243
125 Ga0157373_10097860 3300013100 Unclassified 2065
126 Ga0157370_10000001 3300013104 Bacteria 529517
127 Ga0157370_10001021 3300013104 Bacteria 35253
128 Ga0157370_10191638 3300013104 Unclassified 1897
129 Ga0157369_10000017 3300013105 Bacteria 246520
130 Ga0157369_10003301 3300013105 Bacteria 19186
131 Ga0157369_10018414 3300013105 Bacteria 7830
132 Ga0157369_10147260 3300013105 Bacteria 2489
133 Ga0157369_10198285 3300013105 Bacteria 2107
134 Ga0157369_10206329 3300013105 Unclassified 2061
135 Ga0157369_10365847 3300013105 Bacteria 1497
136 Ga0157374_10061097 3300013296 Bacteria 3528
137 Ga0157374_10152953 3300013296 Unclassified 2244
138 Ga0157378_10024388 3300013297 Bacteria 5321
139 Ga0157378_10034491 3300013297 Bacteria 4475
140 Ga0157378_10037003 3300013297 Bacteria 4321
141 Ga0157378_10120444 3300013297 Bacteria 2418
142 Ga0157372_10000842 3300013307 Bacteria 33267
143 Ga0157372_10001568 3300013307 Bacteria 24894
144 Ga0157372_10013598 3300013307 Bacteria 8699
145 Ga0157372_10038295 3300013307 Bacteria 5291
146 Ga0157372_10039552 3300013307 Bacteria 5205
147 Ga0157372_10046486 3300013307 Bacteria 4819
148 Ga0157372_10059087 3300013307 Bacteria 4288
149 Ga0157372_10087822 3300013307 Bacteria 3529
150 Ga0157372_10204011 3300013307 Unclassified 2291
151 Ga0157372_10227485 3300013307 Bacteria 2162
152 Ga0157375_10064503 3300013308 Bacteria 3647
153 Ga0157375_10134718 3300013308 Bacteria 2593
154 Ga0163163_10028448 3300014325 Bacteria 5367
155 Ga0163163_10053711 3300014325 Bacteria 3978
156 Ga0163163_10194969 3300014325 Bacteria 2074
157 Ga0157379_10120004 3300014968 Bacteria 2365
158 Ga0157376_10025867 3300014969 Plasmid 4628
159 Ga0157376_10053802 3300014969 Bacteria 3353
160 Ga0157376_10058596 3300014969 Unclassified 3226
161 Ga0163161_10352036 3300017792 Bacteria 1171
162 Ga0209050_1001808 3300025298 Bacteria 20919
163 Ga0207656_10080978 3300025321 Bacteria 1459
164 Ga0207656_10101452 3300025321 Unclassified 1320
165 Ga0207642_10041596 3300025899 Bacteria 2014
166 Ga0207710_10004830 3300025900 Bacteria 5848
167 Ga0207710_10062552 3300025900 Bacteria 1692
168 Ga0207680_10050134 3300025903 Bacteria 2489
169 Ga0207647_10075326 3300025904 Bacteria 2031
170 Ga0207699_10038988 3300025906 Bacteria 2726
171 Ga0207705_10063142 3300025909 Bacteria 2676
172 Ga0207705_10232931 3300025909 Bacteria 1401
173 Ga0207705_10259588 3300025909 Unclassified 1326
174 Ga0207654_10000330 3300025911 Bacteria 28452
175 Ga0207654_10001301 3300025911 Bacteria 13303
176 Ga0207654_10055400 3300025911 Bacteria 2295
177 Ga0207707_10029612 3300025912 Bacteria 4787
178 Ga0207707_10064742 3300025912 Bacteria 3183
179 Ga0207695_10000026 3300025913 Bacteria 624558
180 Ga0207695_10000911 3300025913 Bacteria 53168
181 Ga0207695_10001433 3300025913 Bacteria 40092
182 Ga0207695_10013471 3300025913 Bacteria 9750
183 Ga0207695_10021084 3300025913 Bacteria 7442
184 Ga0207695_10046757 3300025913 Bacteria 4585
185 Ga0207695_10047427 3300025913 Bacteria 4547
186 Ga0207695_10156797 3300025913 Bacteria 2211
187 Ga0207695_10160919 3300025913 Unclassified 2176
188 Ga0207671_10000662 3300025914 Bacteria 44965
189 Ga0207671_10001640 3300025914 Bacteria 25465
190 Ga0207671_10024106 3300025914 Bacteria 4579
191 Ga0207671_10167628 3300025914 Bacteria 1703
192 Ga0207663_10057863 3300025916 Bacteria 2444
193 Ga0207660_10032576 3300025917 Bacteria 3598
194 Ga0207657_10003822 3300025919 Bacteria 15993
195 Ga0207657_10191102 3300025919 Unclassified 1652
196 Ga0207649_10004765 3300025920 Bacteria 7335
197 Ga0207649_10111908 3300025920 Bacteria 1826
198 Ga0207649_10235969 3300025920 Unclassified 1310
199 Ga0207652_10165257 3300025921 Unclassified 1984
200 Ga0207694_10000159 3300025924 Bacteria 68923
201 Ga0207694_10000208 3300025924 Bacteria 57698
202 Ga0207694_10214690 3300025924 Bacteria 1568
203 Ga0207694_10364153 3300025924 Bacteria 1198
204 Ga0207650_10053008 3300025925 Bacteria 3006
205 Ga0207687_10034488 3300025927 Bacteria 3436
206 Ga0207687_10100231 3300025927 Unclassified 2130
207 Ga0207687_10369956 3300025927 Unclassified 1172
208 Ga0207700_10006613 3300025928 Bacteria 7022
209 Ga0207700_10081731 3300025928 Bacteria 2524
210 Ga0207700_10110346 3300025928 Bacteria 2212
211 Ga0207664_10191412 3300025929 Bacteria 1761
212 Ga0207664_10375607 3300025929 Bacteria 1261
213 Ga0207644_10098923 3300025931 Bacteria 2188
214 Ga0207706_10005519 3300025933 Bacteria 11794
215 Ga0207669_10110521 3300025937 Bacteria 1841
216 Ga0207704_10069170 3300025938 Bacteria 2229
217 Ga0207691_10022532 3300025940 Bacteria 5939
218 Ga0207711_10039848 3300025941 Bacteria 3997
219 Ga0207689_10015636 3300025942 Bacteria 6427
220 Ga0207661_10007509 3300025944 Bacteria 7752
221 Ga0207661_10035949 3300025944 Bacteria 3864
222 Ga0207661_10070271 3300025944 Bacteria 2858
223 Ga0207661_10119217 3300025944 Bacteria 2244
224 Ga0207661_10122994 3300025944 Unclassified 2212
225 Ga0207679_10151708 3300025945 Bacteria 1887
226 Ga0207667_10004849 3300025949 Bacteria 16447
227 Ga0207667_10008940 3300025949 Bacteria 11847
228 Ga0207667_10011591 3300025949 Bacteria 10236
229 Ga0207667_10029517 3300025949 Bacteria 5947
230 Ga0207667_10237844 3300025949 Bacteria 1864
231 Ga0207712_10202062 3300025961 Unclassified 1576
232 Ga0207668_10044133 3300025972 Bacteria 3031
233 Ga0207640_10046855 3300025981 Bacteria 2785
234 Ga0207658_10003463 3300025986 Bacteria 11158
235 Ga0207658_10225604 3300025986 Unclassified 1578
236 Ga0207677_10033712 3300026023 Bacteria 3307
237 Ga0207639_10000187 3300026041 Bacteria 48392
238 Ga0207639_10029003 3300026041 Unclassified 4047
239 Ga0207639_10359246 3300026041 Unclassified 1303
240 Ga0207678_10127836 3300026067 Unclassified 2167
241 Ga0207708_10033938 3300026075 Bacteria 3880
242 Ga0207702_10002797 3300026078 Bacteria 16348
243 Ga0207702_10012642 3300026078 Bacteria 7028
244 Ga0207702_10023595 3300026078 Bacteria 5103
245 Ga0207702_10152357 3300026078 Bacteria 2104
246 Ga0207702_10220775 3300026078 Unclassified 1766
247 Ga0207702_10349061 3300026078 Unclassified 1415
248 Ga0207641_10041376 3300026088 Bacteria 3861
249 Ga0207641_10059401 3300026088 Bacteria 3256
250 Ga0207648_10121944 3300026089 Bacteria 2292
251 Ga0207676_10035623 3300026095 Bacteria 3779
252 Ga0207674_10000232 3300026116 Bacteria 69316
253 Ga0207674_10012515 3300026116 Bacteria 9478
254 Ga0207674_10116438 3300026116 Bacteria 2644
255 Ga0207683_10001989 3300026121 Bacteria 18097
256 Ga0207698_10000018 3300026142 Bacteria 176540
257 Ga0207698_10000126 3300026142 Bacteria 47895
258 Ga0207698_10087751 3300026142 Unclassified 2535
259 Ga0207698_10281336 3300026142 Bacteria 1539
260 Ga0209968_1021171 3300027526 Bacteria 1054
261 Ga0268266_10153114 3300028379 Bacteria 2080
262 Ga0268266_10258348 3300028379 Bacteria 1613
263 Ga0268264_10021900 3300028381 Bacteria 5217
264 Ga0265336_10041026 3300028666 Bacteria 1415
265 Ga0265338_10009983 3300028800 Bacteria 11226
266 Ga0265338_10051503 3300028800 Bacteria 3705
267 Ga0265338_10230737 3300028800 Bacteria 1377
268 Ga0265330_10007777 3300031235 Bacteria 5203
269 Ga0265332_10013312 3300031238 Bacteria 3647
270 Ga0265332_10029037 3300031238 Bacteria 2419
271 Ga0265328_10061266 3300031239 Bacteria 1381
272 Ga0265320_10022120 3300031240 Bacteria 3408
273 Ga0265325_10006129 3300031241 Bacteria 7342
274 Ga0265325_10009923 3300031241 Bacteria 5539
275 Ga0265325_10064123 3300031241 Unclassified 1858
276 Ga0265329_10044381 3300031242 Bacteria 1421
277 Ga0265340_10017246 3300031247 Bacteria 3734
278 Ga0265339_10000073 3300031249 Bacteria 87912
279 Ga0265339_10003616 3300031249 Bacteria 10790
280 Ga0265316_10073874 3300031344 Unclassified 2625
281 Ga0265316_10128076 3300031344 Bacteria 1913
282 Ga0265313_10072178 3300031595 Bacteria 1587
283 Ga0265314_10001592 3300031711 Bacteria 24947
284 Ga0265314_10007326 3300031711 Bacteria 9580
285 Ga0265342_10004592 3300031712 Bacteria 10774
286 Ga0265342_10056473 3300031712 Bacteria 2326
287 Ga0316593_10071979 3300032168 Unclassified 1197
288 Ga0373954_0081532 3300035118 Bacteria 1546
289 Ga0373943_0065873 3300035170 Bacteria 1823
290 Ga0373943_0105522 3300035170 Bacteria 1479
291 Ga0373946_0134341 3300035171 Unclassified 1141
292 Ga0373947_0019365 3300035725 Bacteria 3924
293 Ga0373947_0101151 3300035725 Bacteria 1812
294 Ga0373937_0031760 3300036401 Bacteria 4786
295 Ga0373925_0014365 3300037068 Bacteria 5728
296 Ga0373925_0293366 3300037068 Unclassified 1312
297 Ga0436365_0576220 3300039437 Bacteria 6140
298 Ga0466966_0158644 3300044684 Bacteria 1378
299 Ga0453684_0044022 3300044712 Bacteria 5985
300 Ga0466957_0064187 3300044842 Bacteria 2259
301 Ga0466959_0052668 3300045049 Bacteria 2980
302 Ga0466958_0068333 3300045836 Bacteria 2172
303 Ga0466958_0115967 3300045836 Bacteria 1674
304 Ga0495580_0315577 3300046472 Bacteria 1063
305 Ga0495628_0154857 3300046516 Unclassified 1744
306 Ga0495587_0065049 3300046536 Unclassified 2130
307 Ga0495645_0015170 3300046543 Bacteria 5478
308 Ga0495645_0028611 3300046543 Bacteria 4051
309 Ga0495602_0109057 3300048088 Unclassified 2253
310 Ga0495602_0318173 3300048088 Unclassified 1133
311 Ga0496104_0019011 3300048907 Bacteria 6277
312 Ga0496105_0018952 3300048908 Bacteria 5544
313 Ga0496105_0066651 3300048908 Bacteria 2973
314 Ga0496105_0226085 3300048908 Bacteria 1522
315 Ga0496106_0141054 3300048909 Unclassified 1895
316 Ga0496107_0057892 3300048910 Unclassified 2802
317 Ga0496110_0073864 3300048913 Bacteria 3027
318 Ga0496112_0175882 3300048915 Unclassified 2105
319 Ga0496113_0037080 3300048916 Bacteria 3575
320 Ga0496115_0193638 3300048918 Bacteria 1680
321 Ga0496126_0002564 3300048929 Bacteria 24301
322 Ga0496126_0010921 3300048929 Bacteria 9460
323 Ga0496126_0339062 3300048929 Bacteria 1232
324 nmdc:mga05p37_27023_c1 3300050507 Bacteria 6984
325 nmdc:mga05p37_642_c1 3300050507 Bacteria 38709
326 nmdc:mga09592_187819_c1 3300050508 Bacteria 1788
327 nmdc:mga0n895_193_c1 3300050512 Bacteria 37906
328 nmdc:mga0rr50_11969_c1 3300050513 Bacteria 5583
329 nmdc:mga08x19_105146_c1 3300050514 Bacteria 1877
330 nmdc:mga08x19_17264_c1 3300050514 Bacteria 4414
331 nmdc:mga0a205_738_c1 3300050515 Bacteria 26375
332 Ga0495601_0021754 3300053077 Unclassified 3930
333 Ga0495601_0026753 3300053077 Bacteria 3564
334 Ga0495601_0232573 3300053077 Unclassified 1204
335 Ga0500556_0001080 3300053104 Bacteria 13755
336 Ga0500655_012306 3300053133 Bacteria 1555
337 Ga0070668_100194002
338 rootH2_10118283
339 Ga0065715_10003293
340 Ga0070658_10029314
341 Ga0070658_10086950
342 Ga0070683_100001452
343 Ga0070683_100040001
344 Ga0070683_100381693
345 Ga0070670_100080048
346 Ga0068869_100009075
347 Ga0070666_10009394
348 Ga0070680_100007222
349 Ga0070680_100056851
350 Ga0068868_100171059
351 Ga0070660_100017999
352 Ga0070661_100028119
353 Ga0070675_100083634
354 Ga0070671_100024533
355 Ga0070673_100044285
356 Ga0070667_100000148
357 Ga0070667_100304068
358 Ga0070709_10028967
359 Ga0070714_100101064
360 Ga0070714_100298531
361 Ga0070713_100014278
362 Ga0070713_100406902
363 Ga0070694_100033599
364 Ga0070678_100243218
365 Ga0070662_100144521
366 Ga0070681_10009748
367 Ga0070681_10023554
368 Ga0070681_10040766
369 Ga0068867_100122565
370 Ga0070679_100027501
371 Ga0070679_100094219
372 Ga0070684_100005700
373 Ga0070684_100523790
374 Ga0070697_100382438
375 Ga0068853_100004717
376 Ga0068853_100153862
377 Ga0068853_100247409
378 Ga0070672_100031929
379 Ga0070695_100011771
380 Ga0070696_100107570
381 Ga0070693_100015007
382 Ga0070704_100062482
383 Ga0068855_100002486
384 Ga0068855_100003652
385 Ga0068855_100007674
386 Ga0068855_100062939
387 Ga0068855_100278245
388 Ga0070664_100329273
389 Ga0068857_100000578
390 Ga0068857_100025127
391 Ga0068857_100034701
392 Ga0068854_100013025
393 Ga0068856_100001009
394 Ga0068856_100010669
395 Ga0068856_100017140
396 Ga0070702_100075092
397 Ga0068852_100000167
398 Ga0068852_100000187
399 Ga0068852_100080447
400 Ga0068852_100297863
401 Ga0068852_100301123
402 Ga0068859_100173126
403 Ga0068864_100045183
404 Ga0068851_10009850
405 Ga0068851_10021009
406 Ga0068863_100032321
407 Ga0068858_100067455
408 Ga0068858_100151589
409 Ga0068860_100009553
410 Ga0068860_100468935
411 Ga0081540_1024698
412 Ga0075365_10231671
413 Ga0070716_100069184
414 Ga0070712_100294642
415 Ga0097621_100015197
416 Ga0097621_100138223
417 Ga0068871_100111511
418 Ga0068871_100484770
419 Ga0075433_10002651
420 Ga0075429_100160010
421 Ga0097620_100173131
422 Ga0075435_100000086
423 Ga0105240_10004090
424 Ga0105240_10004686
425 Ga0105240_10013472
426 Ga0105240_10054700
427 Ga0105240_10063258
428 Ga0105240_10076348
429 Ga0105240_10208744
430 Ga0105240_10226207
431 Ga0105240_10492749
432 Ga0105240_10581804
433 Ga0105245_10016829
434 Ga0105245_10067012
435 Ga0105245_10142300
436 Ga0105245_10368765
437 Ga0105247_10095121
438 Ga0105247_10121067
439 Ga0114129_10113490
440 Ga0105241_10000024
441 Ga0105241_10003746
442 Ga0105241_10273108
443 Ga0105242_10140056
444 Ga0105248_10001736
445 Ga0105248_10019891
446 Ga0105237_10007438
447 Ga0105237_10079759
448 Ga0105237_10106723
449 Ga0105237_10324096
450 Ga0105238_10004489
451 Ga0105238_10009754
452 Ga0105238_10027244
453 Ga0105238_10154255
454 Ga0105238_10178229
455 Ga0105249_10032303
456 Ga0105239_10006366
457 Ga0105239_10012404
458 Ga0105239_10263312
459 Ga0105239_10725710
460 Ga0105246_10086893
461 Ga0157373_10097860
462 Ga0157370_10000001
463 Ga0157370_10001021
464 Ga0157370_10191638
465 Ga0157369_10000017
466 Ga0157369_10003301
467 Ga0157369_10018414
468 Ga0157369_10147260
469 Ga0157369_10198285
470 Ga0157369_10206329
471 Ga0157369_10365847
472 Ga0157374_10061097
473 Ga0157374_10152953
474 Ga0157378_10024388
475 Ga0157378_10034491
476 Ga0157378_10037003
477 Ga0157378_10120444
478 Ga0157372_10000842
479 Ga0157372_10001568
480 Ga0157372_10013598
481 Ga0157372_10038295
482 Ga0157372_10039552
483 Ga0157372_10046486
484 Ga0157372_10059087
485 Ga0157372_10087822
486 Ga0157372_10204011
487 Ga0157372_10227485
488 Ga0157375_10064503
489 Ga0157375_10134718
490 Ga0163163_10028448
491 Ga0163163_10053711
492 Ga0163163_10194969
493 Ga0157379_10120004
494 Ga0157376_10025867
495 Ga0157376_10053802
496 Ga0157376_10058596
497 Ga0163161_10352036
498 Ga0209050_1001808
499 Ga0207656_10080978
500 Ga0207656_10101452
501 Ga0207642_10041596
502 Ga0207710_10004830
503 Ga0207710_10062552
504 Ga0207680_10050134
505 Ga0207647_10075326
506 Ga0207699_10038988
507 Ga0207705_10063142
508 Ga0207705_10232931
509 Ga0207705_10259588
510 Ga0207654_10000330
511 Ga0207654_10001301
512 Ga0207654_10055400
513 Ga0207707_10029612
514 Ga0207707_10064742
515 Ga0207695_10000026
516 Ga0207695_10000911
517 Ga0207695_10001433
518 Ga0207695_10013471
519 Ga0207695_10021084
520 Ga0207695_10046757
521 Ga0207695_10047427
522 Ga0207695_10156797
523 Ga0207695_10160919
524 Ga0207671_10000662
525 Ga0207671_10001640
526 Ga0207671_10024106
527 Ga0207671_10167628
528 Ga0207663_10057863
529 Ga0207660_10032576
530 Ga0207657_10003822
531 Ga0207657_10191102
532 Ga0207649_10004765
533 Ga0207649_10111908
534 Ga0207649_10235969
535 Ga0207652_10165257
536 Ga0207694_10000159
537 Ga0207694_10000208
538 Ga0207694_10214690
539 Ga0207694_10364153
540 Ga0207650_10053008
541 Ga0207687_10034488
542 Ga0207687_10100231
543 Ga0207687_10369956
544 Ga0207700_10006613
545 Ga0207700_10081731
546 Ga0207700_10110346
547 Ga0207664_10191412
548 Ga0207664_10375607
549 Ga0207644_10098923
550 Ga0207706_10005519
551 Ga0207669_10110521
552 Ga0207704_10069170
553 Ga0207691_10022532
554 Ga0207711_10039848
555 Ga0207689_10015636
556 Ga0207661_10007509
557 Ga0207661_10035949
558 Ga0207661_10070271
559 Ga0207661_10119217
560 Ga0207661_10122994
561 Ga0207679_10151708
562 Ga0207667_10004849
563 Ga0207667_10008940
564 Ga0207667_10011591
565 Ga0207667_10029517
566 Ga0207667_10237844
567 Ga0207712_10202062
568 Ga0207668_10044133
569 Ga0207640_10046855
570 Ga0207658_10003463
571 Ga0207658_10225604
572 Ga0207677_10033712
573 Ga0207639_10000187
574 Ga0207639_10029003
575 Ga0207639_10359246
576 Ga0207678_10127836
577 Ga0207708_10033938
578 Ga0207702_10002797
579 Ga0207702_10012642
580 Ga0207702_10023595
581 Ga0207702_10152357
582 Ga0207702_10220775
583 Ga0207702_10349061
584 Ga0207641_10041376
585 Ga0207641_10059401
586 Ga0207648_10121944
587 Ga0207676_10035623
588 Ga0207674_10000232
589 Ga0207674_10012515
590 Ga0207674_10116438
591 Ga0207683_10001989
592 Ga0207698_10000018
593 Ga0207698_10000126
594 Ga0207698_10087751
595 Ga0207698_10281336
596 Ga0209968_1021171
597 Ga0268266_10153114
598 Ga0268266_10258348
599 Ga0268264_10021900
600 Ga0265336_10041026
601 Ga0265338_10009983
602 Ga0265338_10051503
603 Ga0265338_10230737
604 Ga0265330_10007777
605 Ga0265332_10013312
606 Ga0265332_10029037
607 Ga0265328_10061266
608 Ga0265320_10022120
609 Ga0265325_10006129
610 Ga0265325_10009923
611 Ga0265325_10064123
612 Ga0265329_10044381
613 Ga0265340_10017246
614 Ga0265339_10000073
615 Ga0265339_10003616
616 Ga0265316_10073874
617 Ga0265316_10128076
618 Ga0265313_10072178
619 Ga0265314_10001592
620 Ga0265314_10007326
621 Ga0265342_10004592
622 Ga0265342_10056473
623 Ga0316593_10071979
624 Ga0373954_0081532
625 Ga0373943_0065873
626 Ga0373943_0105522
627 Ga0373946_0134341
628 Ga0373947_0019365
629 Ga0373947_0101151
630 Ga0373937_0031760
631 Ga0373925_0014365
632 Ga0373925_0293366
633 Ga0436365_0576220
634 Ga0466966_0158644
635 Ga0453684_0044022
636 Ga0466957_0064187
637 Ga0466959_0052668
638 Ga0466958_0068333
639 Ga0466958_0115967
640 Ga0495580_0315577
641 Ga0495628_0154857
642 Ga0495587_0065049
643 Ga0495645_0015170
644 Ga0495645_0028611
645 Ga0495602_0109057
646 Ga0495602_0318173
647 Ga0496104_0019011
648 Ga0496105_0018952
649 Ga0496105_0066651
650 Ga0496105_0226085
651 Ga0496106_0141054
652 Ga0496107_0057892
653 Ga0496110_0073864
654 Ga0496112_0175882
655 Ga0496113_0037080
656 Ga0496115_0193638
657 Ga0496126_0002564
658 Ga0496126_0010921
659 Ga0496126_0339062
660 nmdc:mga05p37_27023_c1
661 nmdc:mga05p37_642_c1
662 nmdc:mga09592_187819_c1
663 nmdc:mga0n895_193_c1
664 nmdc:mga0rr50_11969_c1
665 nmdc:mga08x19_105146_c1
666 nmdc:mga08x19_17264_c1
667 nmdc:mga0a205_738_c1
668 Ga0495601_0021754
669 Ga0495601_0026753
670 Ga0495601_0232573
671 Ga0500556_0001080
672 Ga0500655_012306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

80

355

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhp-assembly1.cif.gz_A crystal structure of fructokinase (np_810670.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.9298 5 316
2qhp-assembly1.cif.gz_A crystal structure of fructokinase (np_810670.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.9204 5 316
3gbu-assembly1.cif.gz_A crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp 0.8621 7 305
3ewm-assembly1.cif.gz_A crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii 0.856 6 318
6znx-assembly2.cif.gz_B ribokinase from thermus species 0.8358 6 320
ID Description Score Start End Superfamily
2qhpA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9193 7 316 3.40.1190.20
2qhpA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9068 7 316 3.40.1190.20
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8846 7 315 3.40.1190.20
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8653 7 315 3.40.1190.20
af_P45543_2_261_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.861 5 304 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A3M1WJV7-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9712 118 319 GO:0006796
GO:0016301
AF-A0A6C1NWN2-F1-model_v4 Carbohydrate kinase 0.9618 4 313 GO:0016301
AF-A0A1I3AZW4-F1-model_v4 Fructokinase 0.9591 2 322 GO:0016301
AF-A0A2W0BRS3-F1-model_v4 Carbohydrate kinase 0.9573 1 322 GO:0016301
AF-A0A2E8DXY9-F1-model_v4 Carbohydrate kinase 0.9566 2 316 GO:0006796
GO:0016301

Map