F412431

General Info

Members Datasets Scaffolds Average Seq Length
335 206 670 303

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0037910|Ga0501041_0037910_594_1607
Length 337
Sequence MVAIARASLLGDHRPASRGNRIAPTARRSVTVAFISSADCGRHDTGWGHPEHVGRLRAITRALREHPELFTSLEHVDARHATDDELGLVHPPAYIEEVRAMARAGGGRLDPDTVVSDGSWDAGRAGVGAVLDGIDTAVRGPVSRAFCGVRPPGHHATSHRAMGFCLFSNVAIGARYARQRHQLDRVLIVDWDVHHGNGTQAVVEADSNIHFVSMHQWPWYPGTGPADDRGPHDNVWNVPMAPGLDPGRYVDALTRAIDDATATFIPDIVLISAGFDSLRGDPLGGFTLEIEHFVHLTRMLVERAGIWCSGRVVSALEGGYAPERVGEAVVAHMAALR

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
184 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.58
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 8.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0037910 3300049577 Bacteria 2922
2 rootL2_10165165 3300003322 Bacteria 6470
3 Ga0070676_10055546 3300005328 Bacteria 2337
4 Ga0070683_100001001 3300005329 Bacteria 21162
5 Ga0070683_100001577 3300005329 Bacteria 17635
6 Ga0070683_100015491 3300005329 Bacteria 6700
7 Ga0070683_100021608 3300005329 Bacteria 5744
8 Ga0070666_10314836 3300005335 Bacteria 1116
9 Ga0070680_100032977 3300005336 Bacteria 4170
10 Ga0070680_100050478 3300005336 Bacteria 3393
11 Ga0070680_100238974 3300005336 Bacteria 1535
12 Ga0070680_100263046 3300005336 Bacteria 1460
13 Ga0070682_100005198 3300005337 Bacteria 7240
14 Ga0068868_100004655 3300005338 Bacteria 9628
15 Ga0068868_100018635 3300005338 Bacteria 5194
16 Ga0070687_100019416 3300005343 Bacteria 3161
17 Ga0070661_100004000 3300005344 Bacteria 10138
18 Ga0070661_100008426 3300005344 Bacteria 7126
19 Ga0070692_10002160 3300005345 Bacteria 7532
20 Ga0070668_100001478 3300005347 Bacteria 16974
21 Ga0070669_100020250 3300005353 Bacteria 4752
22 Ga0070675_100013236 3300005354 Bacteria 6483
23 Ga0070688_100002915 3300005365 Bacteria 8725
24 Ga0070659_100087470 3300005366 Bacteria 2494
25 Ga0070709_10009638 3300005434 Bacteria 5332
26 Ga0070701_10057085 3300005438 Bacteria 2045
27 Ga0070700_100007038 3300005441 Bacteria 6044
28 Ga0070700_100102171 3300005441 Bacteria 1891
29 Ga0070708_100000320 3300005445 Bacteria 36152
30 Ga0070708_100000439 3300005445 Bacteria 31055
31 Ga0070708_100423345 3300005445 Bacteria 1256
32 Ga0070662_100000530 3300005457 Bacteria 23072
33 Ga0070662_100006936 3300005457 Bacteria 7335
34 Ga0070681_10001020 3300005458 Bacteria 23720
35 Ga0070681_10001756 3300005458 Bacteria 19428
36 Ga0070681_10085584 3300005458 Bacteria 3105
37 Ga0068867_100106957 3300005459 Unclassified 2143
38 Ga0070706_100230950 3300005467 Bacteria 1727
39 Ga0070707_100106372 3300005468 Unclassified 2721
40 Ga0070707_100118570 3300005468 Bacteria 2569
41 Ga0070699_100100092 3300005518 Bacteria 2541
42 Ga0070699_100411386 3300005518 Bacteria 1224
43 Ga0070679_100001017 3300005530 Bacteria 24457
44 Ga0070679_100001683 3300005530 Bacteria 19888
45 Ga0070679_100010955 3300005530 Bacteria 8615
46 Ga0070684_100015264 3300005535 Bacteria 6249
47 Ga0070684_100016187 3300005535 Bacteria 6093
48 Ga0070684_100074871 3300005535 Bacteria 2985
49 Ga0070684_100077091 3300005535 Unclassified 2943
50 Ga0068853_100129862 3300005539 Bacteria 2255
51 Ga0070672_100016410 3300005543 Bacteria 5302
52 Ga0070672_100280974 3300005543 Bacteria 1407
53 Ga0070696_100072018 3300005546 Bacteria 2433
54 Ga0070696_100113623 3300005546 Unclassified 1952
55 Ga0068855_100070645 3300005563 Bacteria 4061
56 Ga0068855_100297325 3300005563 Bacteria 1788
57 Ga0068855_100300458 3300005563 Bacteria 1778
58 Ga0070664_100005308 3300005564 Bacteria 10337
59 Ga0070664_100006513 3300005564 Bacteria 9415
60 Ga0070664_100188458 3300005564 Unclassified 1837
61 Ga0070664_100226722 3300005564 Bacteria 1674
62 Ga0070664_100336607 3300005564 Bacteria 1370
63 Ga0070664_100386531 3300005564 Bacteria 1278
64 Ga0068857_100007231 3300005577 Bacteria 9558
65 Ga0068857_100012219 3300005577 Bacteria 7470
66 Ga0068857_100117700 3300005577 Bacteria 2391
67 Ga0068854_100061598 3300005578 Bacteria 2718
68 Ga0068856_100016243 3300005614 Bacteria 7202
69 Ga0068856_100140883 3300005614 Bacteria 2419
70 Ga0068852_100002490 3300005616 Bacteria 12690
71 Ga0068852_100084779 3300005616 Bacteria 2821
72 Ga0068861_100008533 3300005719 Bacteria 7053
73 Ga0068861_100018709 3300005719 Bacteria 4937
74 Ga0068870_10091080 3300005840 Bacteria 1705
75 Ga0068863_100072040 3300005841 Bacteria 3269
76 Ga0068863_100088801 3300005841 Bacteria 2930
77 Ga0068863_100509788 3300005841 Bacteria 1185
78 Ga0068858_100030331 3300005842 Bacteria 5021
79 Ga0068860_100175933 3300005843 Bacteria 2068
80 Ga0068862_100001071 3300005844 Bacteria 26220
81 Ga0070712_100242603 3300006175 Bacteria 1436
82 Ga0075430_100034328 3300006846 Bacteria 4305
83 Ga0075430_100068351 3300006846 Unclassified 2981
84 Ga0075431_100008936 3300006847 Bacteria 10040
85 Ga0075431_100116753 3300006847 Unclassified 2754
86 Ga0075433_10029346 3300006852 Bacteria 4685
87 Ga0075429_100013431 3300006880 Bacteria 7102
88 Ga0068865_100007635 3300006881 Bacteria 6659
89 Ga0068865_100079641 3300006881 Bacteria 2347
90 Ga0075436_100087124 3300006914 Bacteria 2169
91 Ga0097620_100057846 3300006931 Bacteria 3905
92 Ga0105240_10057369 3300009093 Bacteria 4865
93 Ga0105240_10290883 3300009093 Bacteria 1873
94 Ga0111539_10016423 3300009094 Bacteria 9177
95 Ga0114129_10019063 3300009147 Bacteria 9772
96 Ga0114129_10109680 3300009147 Bacteria 3809
97 Ga0114129_10619824 3300009147 Unclassified 1400
98 Ga0105241_10239369 3300009174 Bacteria 1533
99 Ga0105248_10062226 3300009177 Bacteria 4191
100 Ga0105248_10428219 3300009177 Bacteria 1490
101 Ga0105237_10344325 3300009545 Unclassified 1495
102 Ga0105238_10180926 3300009551 Bacteria 2085
103 Ga0105249_10000277 3300009553 Bacteria 54091
104 Ga0105249_10010477 3300009553 Bacteria 8145
105 Ga0105249_10532730 3300009553 Bacteria 1223
106 Ga0105239_10113510 3300010375 Bacteria 3005
107 Ga0157373_10020595 3300013100 Bacteria 4791
108 Ga0157373_10084804 3300013100 Bacteria 2233
109 Ga0157371_10040105 3300013102 Bacteria 3346
110 Ga0157370_10036742 3300013104 Bacteria 4752
111 Ga0157370_10083385 3300013104 Bacteria 3005
112 Ga0157370_10212621 3300013104 Bacteria 1792
113 Ga0157369_10010379 3300013105 Bacteria 10618
114 Ga0157369_10056410 3300013105 Bacteria 4239
115 Ga0163162_10004147 3300013306 Bacteria 13915
116 Ga0157372_10055289 3300013307 Bacteria 4432
117 Ga0157372_10096153 3300013307 Bacteria 3375
118 Ga0157375_10082812 3300013308 Bacteria 3251
119 Ga0163163_10034224 3300014325 Bacteria 4918
120 Ga0157380_10244589 3300014326 Bacteria 1620
121 Ga0182008_10111988 3300014497 Unclassified 1352
122 Ga0163161_10285491 3300017792 Bacteria 1296
123 Ga0206353_11098524 3300020082 Unclassified 1415
124 Ga0207699_10018855 3300025906 Bacteria 3665
125 Ga0207643_10092611 3300025908 Bacteria 1763
126 Ga0207684_10202841 3300025910 Bacteria 1711
127 Ga0207707_10011924 3300025912 Bacteria 7562
128 Ga0207707_10019012 3300025912 Bacteria 5993
129 Ga0207707_10022587 3300025912 Bacteria 5499
130 Ga0207707_10043104 3300025912 Bacteria 3937
131 Ga0207695_10001711 3300025913 Bacteria 35133
132 Ga0207695_10004801 3300025913 Bacteria 18291
133 Ga0207671_10028574 3300025914 Unclassified 4166
134 Ga0207663_10004687 3300025916 Bacteria 6825
135 Ga0207660_10002547 3300025917 Bacteria 11976
136 Ga0207660_10003081 3300025917 Bacteria 10892
137 Ga0207660_10030965 3300025917 Unclassified 3681
138 Ga0207660_10147000 3300025917 Bacteria 1807
139 Ga0207662_10009657 3300025918 Bacteria 5318
140 Ga0207662_10017566 3300025918 Bacteria 4049
141 Ga0207657_10026591 3300025919 Bacteria 5313
142 Ga0207652_10006140 3300025921 Bacteria 9715
143 Ga0207652_10007511 3300025921 Bacteria 8776
144 Ga0207652_10009083 3300025921 Bacteria 8006
145 Ga0207652_10100710 3300025921 Bacteria 2551
146 Ga0207646_10001245 3300025922 Bacteria 31904
147 Ga0207646_10129190 3300025922 Unclassified 2273
148 Ga0207681_10013983 3300025923 Bacteria 4974
149 Ga0207694_10114419 3300025924 Bacteria 2149
150 Ga0207650_10140046 3300025925 Bacteria 1901
151 Ga0207700_10008454 3300025928 Bacteria 6379
152 Ga0207690_10304952 3300025932 Bacteria 1247
153 Ga0207706_10000474 3300025933 Bacteria 43004
154 Ga0207706_10016884 3300025933 Bacteria 6585
155 Ga0207670_10102468 3300025936 Bacteria 2047
156 Ga0207670_10240966 3300025936 Bacteria 1393
157 Ga0207704_10075920 3300025938 Bacteria 2151
158 Ga0207691_10001561 3300025940 Bacteria 22747
159 Ga0207691_10113637 3300025940 Bacteria 2406
160 Ga0207691_10466087 3300025940 Bacteria 1074
161 Ga0207689_10012884 3300025942 Bacteria 7143
162 Ga0207661_10003544 3300025944 Bacteria 10842
163 Ga0207661_10006972 3300025944 Bacteria 8013
164 Ga0207661_10115155 3300025944 Bacteria 2281
165 Ga0207661_10122616 3300025944 Bacteria 2215
166 Ga0207661_10236479 3300025944 Bacteria 1619
167 Ga0207679_10224626 3300025945 Bacteria 1582
168 Ga0207679_10526834 3300025945 Bacteria 1057
169 Ga0207667_10025670 3300025949 Bacteria 6447
170 Ga0207667_10318505 3300025949 Bacteria 1588
171 Ga0207651_10238005 3300025960 Bacteria 1482
172 Ga0207712_10023822 3300025961 Bacteria 4046
173 Ga0207712_10289051 3300025961 Bacteria 1341
174 Ga0207668_10004281 3300025972 Bacteria 8373
175 Ga0207668_10101563 3300025972 Bacteria 2138
176 Ga0207640_10018173 3300025981 Bacteria 4126
177 Ga0207640_10479726 3300025981 Bacteria 1031
178 Ga0207658_10013592 3300025986 Bacteria 5567
179 Ga0207703_10055538 3300026035 Bacteria 3222
180 Ga0207708_10006786 3300026075 Bacteria 8471
181 Ga0207702_10002071 3300026078 Bacteria 19406
182 Ga0207641_10090703 3300026088 Bacteria 2673
183 Ga0207641_10371166 3300026088 Bacteria 1368
184 Ga0207641_10398821 3300026088 Bacteria 1320
185 Ga0207674_10082895 3300026116 Bacteria 3207
186 Ga0207674_10102600 3300026116 Bacteria 2840
187 Ga0207674_10143689 3300026116 Bacteria 2345
188 Ga0207674_10396221 3300026116 Bacteria 1334
189 Ga0207675_100000194 3300026118 Bacteria 55678
190 Ga0207675_100028454 3300026118 Bacteria 5204
191 Ga0207675_100056201 3300026118 Bacteria 3670
192 Ga0207698_10048094 3300026142 Bacteria 3236
193 Ga0268265_10000575 3300028380 Bacteria 37160
194 Ga0268265_10040526 3300028380 Bacteria 3440
195 Ga0268264_10049422 3300028381 Bacteria 3499
196 Ga0307408_100250342 3300031548 Bacteria 1461
197 Ga0307408_100280291 3300031548 Bacteria 1388
198 Ga0307405_10034921 3300031731 Bacteria 2998
199 Ga0307405_10141279 3300031731 Bacteria 1679
200 Ga0307413_10001439 3300031824 Bacteria 9020
201 Ga0307413_10283050 3300031824 Unclassified 1248
202 Ga0307410_10031859 3300031852 Bacteria 3387
203 Ga0307410_10047306 3300031852 Bacteria 2874
204 Ga0307410_10063468 3300031852 Unclassified 2534
205 Ga0307410_10154750 3300031852 Bacteria 1711
206 Ga0307410_10296150 3300031852 Bacteria 1275
207 Ga0307406_10056477 3300031901 Bacteria 2514
208 Ga0307406_10125690 3300031901 Bacteria 1791
209 Ga0307407_10044734 3300031903 Bacteria 2497
210 Ga0307409_100000098 3300031995 Bacteria 31539
211 Ga0307409_100017453 3300031995 Bacteria 4785
212 Ga0307409_100018442 3300031995 Bacteria 4693
213 Ga0307409_100159131 3300031995 Bacteria 1972
214 Ga0307416_100000818 3300032002 Bacteria 16285
215 Ga0307416_100035791 3300032002 Bacteria 3797
216 Ga0307414_10029691 3300032004 Bacteria 3562
217 Ga0307414_10268702 3300032004 Unclassified 1427
218 Ga0307411_10014975 3300032005 Bacteria 4336
219 Ga0307411_10221827 3300032005 Bacteria 1467
220 Ga0307415_100001960 3300032126 Bacteria 10129
221 Ga0307415_100079080 3300032126 Bacteria 2341
222 Ga0373940_0103266 3300035088 Bacteria 867
223 Ga0373954_0045231 3300035118 Unclassified 2056
224 Ga0373943_0092399 3300035170 Bacteria 1569
225 Ga0373955_0001345 3300035172 Bacteria 10437
226 Ga0373924_0058080 3300035410 Unclassified 1615
227 Ga0373931_0066847 3300035691 Bacteria 1952
228 Ga0373927_0005119 3300035695 Bacteria 9074
229 Ga0373927_0039578 3300035695 Bacteria 3060
230 Ga0373933_0002578 3300035724 Bacteria 10152
231 Ga0373947_0029173 3300035725 Bacteria 3236
232 Ga0373937_0005457 3300036401 Bacteria 10889
233 Ga0439439_0012790 3300041406 Bacteria 2030
234 Ga0439461_0022043 3300041410 Bacteria 1273
235 Ga0439457_041236 3300042014 Bacteria 1028
236 Ga0451577_0008258 3300042876 Bacteria 10141
237 Ga0466963_0354974 3300044694 Bacteria 1033
238 Ga0466967_0266682 3300045976 Bacteria 1639
239 Ga0466967_0386388 3300045976 Bacteria 1360
240 Ga0495629_0166341 3300046459 Bacteria 1531
241 Ga0495580_0070557 3300046472 Bacteria 2441
242 Ga0495582_0246330 3300046473 Bacteria 1024
243 Ga0495639_0057417 3300046475 Bacteria 1778
244 Ga0495594_0055085 3300046499 Bacteria 2192
245 Ga0495594_0111280 3300046499 Bacteria 1544
246 Ga0495608_0079646 3300046511 Unclassified 2130
247 Ga0495628_0060978 3300046516 Bacteria 2959
248 Ga0495630_0087823 3300046517 Bacteria 2348
249 Ga0495665_0119744 3300046531 Bacteria 1379
250 Ga0495586_0003230 3300046535 Bacteria 8755
251 Ga0495586_0028021 3300046535 Bacteria 3014
252 Ga0495586_0077936 3300046535 Unclassified 1818
253 Ga0495587_0023232 3300046536 Unclassified 3811
254 Ga0495645_0006878 3300046543 Bacteria 7906
255 Ga0495667_0004582 3300046559 Bacteria 9344
256 Ga0495599_0001926 3300046678 Bacteria 12015
257 Ga0495623_0028980 3300046679 Bacteria 3563
258 Ga0495658_0248019 3300046683 Bacteria 1119
259 Ga0495581_0133730 3300047315 Bacteria 1445
260 Ga0495604_0241649 3300047317 Unclassified 1234
261 Ga0495674_0049254 3300047319 Bacteria 3724
262 Ga0495674_0167252 3300047319 Unclassified 1837
263 Ga0495674_0235206 3300047319 Bacteria 1511
264 Ga0495675_0057766 3300047444 Unclassified 2460
265 Ga0496102_0037917 3300048905 Bacteria 4348
266 Ga0496103_0144444 3300048906 Bacteria 1522
267 Ga0496104_0014293 3300048907 Bacteria 7168
268 Ga0496108_0000670 3300048911 Bacteria 26442
269 Ga0496108_0529726 3300048911 Unclassified 1028
270 Ga0496109_0000716 3300048912 Bacteria 27631
271 Ga0496110_0051186 3300048913 Bacteria 3629
272 Ga0496111_0100140 3300048914 Bacteria 2128
273 Ga0496112_0012514 3300048915 Bacteria 7795
274 Ga0496112_0276272 3300048915 Bacteria 1627
275 Ga0496113_0003377 3300048916 Bacteria 9544
276 Ga0496113_0007851 3300048916 Bacteria 6898
277 Ga0501298_029837 3300049521 Bacteria 1064
278 Ga0501031_0046318 3300049568 Bacteria 2836
279 Ga0501031_0114596 3300049568 Bacteria 1761
280 Ga0501039_0064203 3300049575 Bacteria 2846
281 Ga0501040_0057262 3300049576 Bacteria 2676
282 Ga0501040_0069769 3300049576 Bacteria 2425
283 Ga0501041_0057415 3300049577 Bacteria 2380
284 Ga0501041_0289820 3300049577 Bacteria 1031
285 Ga0501046_0028820 3300049580 Bacteria 4518
286 Ga0501048_0043034 3300049582 Bacteria 3232
287 Ga0501067_0009871 3300049583 Bacteria 5286
288 Ga0501068_0089972 3300049584 Bacteria 1893
289 Ga0501069_0250257 3300049585 Bacteria 1034
290 Ga0501071_0014407 3300049587 Bacteria 5408
291 Ga0501071_0265691 3300049587 Bacteria 1296
292 Ga0501072_0022277 3300049588 Bacteria 4915
293 Ga0501072_0068649 3300049588 Bacteria 2798
294 Ga0501074_0188908 3300049590 Bacteria 1469
295 Ga0501074_0310466 3300049590 Bacteria 1120
296 Ga0501075_0024490 3300049591 Bacteria 4427
297 Ga0501075_0099365 3300049591 Bacteria 2210
298 Ga0501076_0002874 3300049592 Bacteria 11920
299 Ga0501076_0126049 3300049592 Bacteria 2075
300 Ga0501077_0003796 3300049593 Bacteria 9095
301 Ga0501224_010366 3300049664 Bacteria 1367
302 Ga0501235_000449 3300049669 Bacteria 8032
303 Ga0501249_005182 3300049679 Bacteria 2662
304 Ga0501225_0084980 3300049705 Bacteria 912
305 Ga0501079_0141309 3300049741 Bacteria 1875
306 Ga0501080_0040977 3300049742 Bacteria 4317
307 Ga0501080_0245127 3300049742 Bacteria 1635
308 Ga0501080_0277649 3300049742 Bacteria 1524
309 Ga0501081_0016334 3300049743 Bacteria 4906
310 Ga0501081_0086543 3300049743 Bacteria 2200
311 Ga0501083_0144403 3300049744 Bacteria 1558
312 Ga0501083_0340067 3300049744 Bacteria 976
313 Ga0501045_0040989 3300049824 Bacteria 3368
314 nmdc:mga05p37_123158_c1 3300050507 Unclassified 3185
315 nmdc:mga05p37_328990_c1 3300050507 Bacteria 1806
316 nmdc:mga05p37_785837_c1 3300050507 Unclassified 1044
317 nmdc:mga09592_135553_c1 3300050508 Bacteria 2120
318 nmdc:mga0qj67_424682_c1 3300050509 Bacteria 1071
319 nmdc:mga0qj67_78012_c1 3300050509 Unclassified 2650
320 nmdc:mga06r32_27413_c1 3300050510 Bacteria 5321
321 nmdc:mga08y16_504005_c1 3300050511 Bacteria 1229
322 nmdc:mga0n895_54836_c1 3300050512 Bacteria 3922
323 nmdc:mga08x19_25697_c1 3300050514 Bacteria 3670
324 nmdc:mga08x19_78161_c1 3300050514 Bacteria 2168
325 nmdc:mga0a205_22152_c1 3300050515 Bacteria 6013
326 nmdc:mga0a205_256028_c1 3300050515 Bacteria 1629
327 Ga0495619_0051404 3300053085 Unclassified 2723
328 Ga0501084_0086955 3300054114 Bacteria 2625
329 Ga0501084_0182786 3300054114 Bacteria 1770
330 Ga0590071_001174 3300059421 Bacteria 7084
331 Ga0590074_002019 3300059423 Bacteria 3321
332 Ga0590075_021972 3300059424 Bacteria 1594
333 Ga0590077_005346 3300059426 Bacteria 2633
334 Ga0501082_0034934 3300060353 Bacteria 4333
335 Ga0501082_0182587 3300060353 Bacteria 1825
336 Ga0501041_0037910
337 rootL2_10165165
338 Ga0070676_10055546
339 Ga0070683_100001001
340 Ga0070683_100001577
341 Ga0070683_100015491
342 Ga0070683_100021608
343 Ga0070666_10314836
344 Ga0070680_100032977
345 Ga0070680_100050478
346 Ga0070680_100238974
347 Ga0070680_100263046
348 Ga0070682_100005198
349 Ga0068868_100004655
350 Ga0068868_100018635
351 Ga0070687_100019416
352 Ga0070661_100004000
353 Ga0070661_100008426
354 Ga0070692_10002160
355 Ga0070668_100001478
356 Ga0070669_100020250
357 Ga0070675_100013236
358 Ga0070688_100002915
359 Ga0070659_100087470
360 Ga0070709_10009638
361 Ga0070701_10057085
362 Ga0070700_100007038
363 Ga0070700_100102171
364 Ga0070708_100000320
365 Ga0070708_100000439
366 Ga0070708_100423345
367 Ga0070662_100000530
368 Ga0070662_100006936
369 Ga0070681_10001020
370 Ga0070681_10001756
371 Ga0070681_10085584
372 Ga0068867_100106957
373 Ga0070706_100230950
374 Ga0070707_100106372
375 Ga0070707_100118570
376 Ga0070699_100100092
377 Ga0070699_100411386
378 Ga0070679_100001017
379 Ga0070679_100001683
380 Ga0070679_100010955
381 Ga0070684_100015264
382 Ga0070684_100016187
383 Ga0070684_100074871
384 Ga0070684_100077091
385 Ga0068853_100129862
386 Ga0070672_100016410
387 Ga0070672_100280974
388 Ga0070696_100072018
389 Ga0070696_100113623
390 Ga0068855_100070645
391 Ga0068855_100297325
392 Ga0068855_100300458
393 Ga0070664_100005308
394 Ga0070664_100006513
395 Ga0070664_100188458
396 Ga0070664_100226722
397 Ga0070664_100336607
398 Ga0070664_100386531
399 Ga0068857_100007231
400 Ga0068857_100012219
401 Ga0068857_100117700
402 Ga0068854_100061598
403 Ga0068856_100016243
404 Ga0068856_100140883
405 Ga0068852_100002490
406 Ga0068852_100084779
407 Ga0068861_100008533
408 Ga0068861_100018709
409 Ga0068870_10091080
410 Ga0068863_100072040
411 Ga0068863_100088801
412 Ga0068863_100509788
413 Ga0068858_100030331
414 Ga0068860_100175933
415 Ga0068862_100001071
416 Ga0070712_100242603
417 Ga0075430_100034328
418 Ga0075430_100068351
419 Ga0075431_100008936
420 Ga0075431_100116753
421 Ga0075433_10029346
422 Ga0075429_100013431
423 Ga0068865_100007635
424 Ga0068865_100079641
425 Ga0075436_100087124
426 Ga0097620_100057846
427 Ga0105240_10057369
428 Ga0105240_10290883
429 Ga0111539_10016423
430 Ga0114129_10019063
431 Ga0114129_10109680
432 Ga0114129_10619824
433 Ga0105241_10239369
434 Ga0105248_10062226
435 Ga0105248_10428219
436 Ga0105237_10344325
437 Ga0105238_10180926
438 Ga0105249_10000277
439 Ga0105249_10010477
440 Ga0105249_10532730
441 Ga0105239_10113510
442 Ga0157373_10020595
443 Ga0157373_10084804
444 Ga0157371_10040105
445 Ga0157370_10036742
446 Ga0157370_10083385
447 Ga0157370_10212621
448 Ga0157369_10010379
449 Ga0157369_10056410
450 Ga0163162_10004147
451 Ga0157372_10055289
452 Ga0157372_10096153
453 Ga0157375_10082812
454 Ga0163163_10034224
455 Ga0157380_10244589
456 Ga0182008_10111988
457 Ga0163161_10285491
458 Ga0206353_11098524
459 Ga0207699_10018855
460 Ga0207643_10092611
461 Ga0207684_10202841
462 Ga0207707_10011924
463 Ga0207707_10019012
464 Ga0207707_10022587
465 Ga0207707_10043104
466 Ga0207695_10001711
467 Ga0207695_10004801
468 Ga0207671_10028574
469 Ga0207663_10004687
470 Ga0207660_10002547
471 Ga0207660_10003081
472 Ga0207660_10030965
473 Ga0207660_10147000
474 Ga0207662_10009657
475 Ga0207662_10017566
476 Ga0207657_10026591
477 Ga0207652_10006140
478 Ga0207652_10007511
479 Ga0207652_10009083
480 Ga0207652_10100710
481 Ga0207646_10001245
482 Ga0207646_10129190
483 Ga0207681_10013983
484 Ga0207694_10114419
485 Ga0207650_10140046
486 Ga0207700_10008454
487 Ga0207690_10304952
488 Ga0207706_10000474
489 Ga0207706_10016884
490 Ga0207670_10102468
491 Ga0207670_10240966
492 Ga0207704_10075920
493 Ga0207691_10001561
494 Ga0207691_10113637
495 Ga0207691_10466087
496 Ga0207689_10012884
497 Ga0207661_10003544
498 Ga0207661_10006972
499 Ga0207661_10115155
500 Ga0207661_10122616
501 Ga0207661_10236479
502 Ga0207679_10224626
503 Ga0207679_10526834
504 Ga0207667_10025670
505 Ga0207667_10318505
506 Ga0207651_10238005
507 Ga0207712_10023822
508 Ga0207712_10289051
509 Ga0207668_10004281
510 Ga0207668_10101563
511 Ga0207640_10018173
512 Ga0207640_10479726
513 Ga0207658_10013592
514 Ga0207703_10055538
515 Ga0207708_10006786
516 Ga0207702_10002071
517 Ga0207641_10090703
518 Ga0207641_10371166
519 Ga0207641_10398821
520 Ga0207674_10082895
521 Ga0207674_10102600
522 Ga0207674_10143689
523 Ga0207674_10396221
524 Ga0207675_100000194
525 Ga0207675_100028454
526 Ga0207675_100056201
527 Ga0207698_10048094
528 Ga0268265_10000575
529 Ga0268265_10040526
530 Ga0268264_10049422
531 Ga0307408_100250342
532 Ga0307408_100280291
533 Ga0307405_10034921
534 Ga0307405_10141279
535 Ga0307413_10001439
536 Ga0307413_10283050
537 Ga0307410_10031859
538 Ga0307410_10047306
539 Ga0307410_10063468
540 Ga0307410_10154750
541 Ga0307410_10296150
542 Ga0307406_10056477
543 Ga0307406_10125690
544 Ga0307407_10044734
545 Ga0307409_100000098
546 Ga0307409_100017453
547 Ga0307409_100018442
548 Ga0307409_100159131
549 Ga0307416_100000818
550 Ga0307416_100035791
551 Ga0307414_10029691
552 Ga0307414_10268702
553 Ga0307411_10014975
554 Ga0307411_10221827
555 Ga0307415_100001960
556 Ga0307415_100079080
557 Ga0373940_0103266
558 Ga0373954_0045231
559 Ga0373943_0092399
560 Ga0373955_0001345
561 Ga0373924_0058080
562 Ga0373931_0066847
563 Ga0373927_0005119
564 Ga0373927_0039578
565 Ga0373933_0002578
566 Ga0373947_0029173
567 Ga0373937_0005457
568 Ga0439439_0012790
569 Ga0439461_0022043
570 Ga0439457_041236
571 Ga0451577_0008258
572 Ga0466963_0354974
573 Ga0466967_0266682
574 Ga0466967_0386388
575 Ga0495629_0166341
576 Ga0495580_0070557
577 Ga0495582_0246330
578 Ga0495639_0057417
579 Ga0495594_0055085
580 Ga0495594_0111280
581 Ga0495608_0079646
582 Ga0495628_0060978
583 Ga0495630_0087823
584 Ga0495665_0119744
585 Ga0495586_0003230
586 Ga0495586_0028021
587 Ga0495586_0077936
588 Ga0495587_0023232
589 Ga0495645_0006878
590 Ga0495667_0004582
591 Ga0495599_0001926
592 Ga0495623_0028980
593 Ga0495658_0248019
594 Ga0495581_0133730
595 Ga0495604_0241649
596 Ga0495674_0049254
597 Ga0495674_0167252
598 Ga0495674_0235206
599 Ga0495675_0057766
600 Ga0496102_0037917
601 Ga0496103_0144444
602 Ga0496104_0014293
603 Ga0496108_0000670
604 Ga0496108_0529726
605 Ga0496109_0000716
606 Ga0496110_0051186
607 Ga0496111_0100140
608 Ga0496112_0012514
609 Ga0496112_0276272
610 Ga0496113_0003377
611 Ga0496113_0007851
612 Ga0501298_029837
613 Ga0501031_0046318
614 Ga0501031_0114596
615 Ga0501039_0064203
616 Ga0501040_0057262
617 Ga0501040_0069769
618 Ga0501041_0057415
619 Ga0501041_0289820
620 Ga0501046_0028820
621 Ga0501048_0043034
622 Ga0501067_0009871
623 Ga0501068_0089972
624 Ga0501069_0250257
625 Ga0501071_0014407
626 Ga0501071_0265691
627 Ga0501072_0022277
628 Ga0501072_0068649
629 Ga0501074_0188908
630 Ga0501074_0310466
631 Ga0501075_0024490
632 Ga0501075_0099365
633 Ga0501076_0002874
634 Ga0501076_0126049
635 Ga0501077_0003796
636 Ga0501224_010366
637 Ga0501235_000449
638 Ga0501249_005182
639 Ga0501225_0084980
640 Ga0501079_0141309
641 Ga0501080_0040977
642 Ga0501080_0245127
643 Ga0501080_0277649
644 Ga0501081_0016334
645 Ga0501081_0086543
646 Ga0501083_0144403
647 Ga0501083_0340067
648 Ga0501045_0040989
649 nmdc:mga05p37_123158_c1
650 nmdc:mga05p37_328990_c1
651 nmdc:mga05p37_785837_c1
652 nmdc:mga09592_135553_c1
653 nmdc:mga0qj67_424682_c1
654 nmdc:mga0qj67_78012_c1
655 nmdc:mga06r32_27413_c1
656 nmdc:mga08y16_504005_c1
657 nmdc:mga0n895_54836_c1
658 nmdc:mga08x19_25697_c1
659 nmdc:mga08x19_78161_c1
660 nmdc:mga0a205_22152_c1
661 nmdc:mga0a205_256028_c1
662 Ga0495619_0051404
663 Ga0501084_0086955
664 Ga0501084_0182786
665 Ga0590071_001174
666 Ga0590074_002019
667 Ga0590075_021972
668 Ga0590077_005346
669 Ga0501082_0034934
670 Ga0501082_0182587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00850

Hist_deacetyl

Histone deacetylase domain

49

336

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ji5-assembly1.cif.gz_A crystal structure of a histone deacetylase superfamily protein from burkholderia phymatumphymatum 0.9414 1 296
6j6t-assembly1.cif.gz_B crystal structure of hda15 hd domain 0.9388 2 296
6j6t-assembly1.cif.gz_D crystal structure of hda15 hd domain 0.937 2 296
5g13-assembly1.cif.gz_B pseudomonas aeruginosa hdah (h143a) unliganded. 0.9367 2 296
6j6t-assembly1.cif.gz_C crystal structure of hda15 hd domain 0.9365 3 296
ID Description Score Start End Superfamily
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9414 1 296 3.40.800.20
5li3A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9401 1 296 3.40.800.20
af_D3ZVD8_79_465_3.40.800.20 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9357 2 296 3.40.800.20
5ji5A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.9353 1 296 3.40.800.20
5li3A00 Alpha Beta;3-Layer(aba) Sandwich;Arginase; Chain A;Histone deacetylase domain 0.934 1 296 3.40.800.20
ID Description Score Start End GO Terms
AF-X1L561-F1-model_v4 Histone deacetylase domain-containing protein 0.9827 44 159 GO:0004407
GO:0040029
AF-A0A2V7NSJ0-F1-model_v4 Histone deacetylase domain-containing protein 0.9725 2 297 GO:0004407
GO:0040029
AF-A0A2V7R9V0-F1-model_v4 Histone deacetylase domain-containing protein 0.9715 2 297 GO:0004407
GO:0040029
AF-A0A257SM36-F1-model_v4 Histone deacetylase domain-containing protein 0.9713 2 159 GO:0004407
GO:0040029
AF-A0A5E4IWX4-F1-model_v4 Histone deacetylase domain protein 0.9712 2 173 GO:0004407
GO:0040029

Map