F412419

General Info

Members Datasets Scaffolds Average Seq Length
335 214 322 167

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000009|Ga0496124_0000009_394631_395140
Length 169
Sequence MSGASTLCIRHWQPNDRDAVAALIVGIQRDEFGLDIDLAAQPDLLDVAGFYGSGAGGFWVACDAGLVVGCIGLRDLGQGDGALRKMFVAPTHRGRGLSVAARLLDRLTAHAQAQQLHALFLGTTDRFLAAHRFYEKHGFLQIARADIPRAFPVMAVDSRFYVRWLKHSA

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
3 2739367651 Pedobacter sp. OK291 Isolate Unclassified
4 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
5 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
6 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
7 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
10 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
11 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
12 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
214 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.01
Nodule 0.6
Rhizoplane 5.67
Rhizosphere 57.31
Stem 0
Stem Tuber 0
Unclassified 19.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002651 3300002773 Bacteria 6626
2 JGI25152J39213_1002776 3300002773 Bacteria 6343
3 JGI25150J39212_1000256 3300002774 Bacteria 28172
4 JGI25151J46595_10000916 3300003187 Bacteria 22974
5 JGI25151J46595_10002252 3300003187 Bacteria 11849
6 JGI25153J46596_10005343 3300003215 Bacteria 6748
7 JGI25404J52841_10038690 3300003659 Bacteria 1011
8 JGI25404J52841_10061410 3300003659 Bacteria 787
9 Ga0055526_1024440 3300003771 Bacteria 1976
10 Ga0055536_1000006 3300003781 Bacteria 347733
11 Ga0055528_1015924 3300003790 Bacteria 2687
12 Ga0055530_10000679 3300003791 Bacteria 28914
13 Ga0055540_1008166 3300003792 Bacteria 3810
14 Ga0065165_1019528 3300005262 Bacteria 2415
15 Ga0065714_10066880 3300005288 Bacteria 6126
16 Ga0065712_10000148 3300005290 Bacteria 47942
17 Ga0068869_100093245 3300005334 Bacteria 2268
18 Ga0070689_100681547 3300005340 Bacteria 896
19 Ga0070661_100573838 3300005344 Bacteria 910
20 Ga0070668_100471711 3300005347 Bacteria 1082
21 Ga0070668_101626384 3300005347 Bacteria 592
22 Ga0070669_100366959 3300005353 Bacteria 1172
23 Ga0070663_100724025 3300005455 Bacteria 847
24 Ga0070678_100101073 3300005456 Bacteria 2235
25 Ga0070678_101370693 3300005456 Bacteria 659
26 Ga0070686_100113069 3300005544 Bacteria 1853
27 Ga0070665_100411829 3300005548 Bacteria 1360
28 Ga0070665_100518664 3300005548 Bacteria 1203
29 Ga0070665_101748720 3300005548 Bacteria 629
30 Ga0070702_100113618 3300005615 Bacteria 1683
31 Ga0068864_101158833 3300005618 Bacteria 771
32 Ga0068866_10335279 3300005718 Bacteria 956
33 Ga0068861_101517341 3300005719 Bacteria 658
34 Ga0068851_10069938 3300005834 Bacteria 1814
35 Ga0068860_100716681 3300005843 Bacteria 1011
36 Ga0068862_100235230 3300005844 Bacteria 1663
37 Ga0081455_10137327 3300005937 Bacteria 1903
38 Ga0081540_1000990 3300005983 Bacteria 25618
39 Ga0081540_1003471 3300005983 Bacteria 12440
40 Ga0081540_1075907 3300005983 Bacteria 1534
41 Ga0075365_10052403 3300006038 Bacteria 2698
42 Ga0075368_10214033 3300006042 Bacteria 817
43 Ga0068865_100075972 3300006881 Bacteria 2397
44 Ga0079104_1000010 3300006946 Bacteria 366021
45 Ga0099795_10043101 3300007788 Bacteria 1614
46 Ga0105245_10441471 3300009098 Bacteria 1308
47 Ga0105247_10029429 3300009101 Bacteria 3328
48 Ga0105243_10113056 3300009148 Bacteria 2276
49 Ga0105243_10796793 3300009148 Bacteria 931
50 Ga0105242_10117251 3300009176 Bacteria 2279
51 Ga0105248_10183114 3300009177 Bacteria 2360
52 Ga0105237_10126978 3300009545 Bacteria 2544
53 Ga0105238_10009204 3300009551 Bacteria 9884
54 Ga0105249_10289973 3300009553 Bacteria 1638
55 Ga0105249_11203408 3300009553 Bacteria 829
56 Ga0105246_10193008 3300011119 Bacteria 1578
57 Ga0105246_10336880 3300011119 Bacteria 1231
58 Ga0105246_10345738 3300011119 Bacteria 1217
59 Ga0105246_10791108 3300011119 Bacteria 841
60 Ga0157373_10124290 3300013100 Bacteria 1814
61 Ga0157371_10000296 3300013102 Bacteria 66267
62 Ga0157371_10000383 3300013102 Bacteria 55675
63 Ga0157370_10000383 3300013104 Bacteria 55670
64 Ga0157370_10017361 3300013104 Bacteria 7263
65 Ga0157370_10111062 3300013104 Bacteria 2563
66 Ga0157370_10195236 3300013104 Bacteria 1879
67 Ga0157370_11389437 3300013104 Bacteria 632
68 Ga0157369_10000164 3300013105 Bacteria 94229
69 Ga0163162_10195013 3300013306 Bacteria 2154
70 Ga0163162_10992101 3300013306 Bacteria 949
71 Ga0157372_10029850 3300013307 Bacteria 5958
72 Ga0163163_11691917 3300014325 Bacteria 693
73 Ga0157380_10605641 3300014326 Bacteria 1085
74 Ga0182008_10003578 3300014497 Bacteria 9312
75 Ga0182006_1000546 3300015261 Bacteria 28457
76 Ga0182006_1041808 3300015261 Bacteria 1798
77 Ga0182007_10000005 3300015262 Bacteria 442702
78 Ga0183373_1002 3300015682 Bacteria 990153
79 Ga0163161_10000135 3300017792 Bacteria 69859
80 Ga0163161_10000539 3300017792 Bacteria 30832
81 Ga0213871_10007556 3300021441 Bacteria 2357
82 Ga0207425_1000497 3300025245 Bacteria 24648
83 Ga0209129_1000078 3300025258 Bacteria 192880
84 Ga0209129_1000658 3300025258 Bacteria 23033
85 Ga0209673_1000015 3300025273 Bacteria 530618
86 Ga0209673_1018030 3300025273 Bacteria 2581
87 Ga0209676_1000039 3300025292 Bacteria 443158
88 Ga0209025_1000489 3300025294 Bacteria 76167
89 Ga0209025_1000664 3300025294 Bacteria 59562
90 Ga0209025_1015932 3300025294 Bacteria 4484
91 Ga0209564_1010567 3300025295 Bacteria 4234
92 Ga0209758_1000549 3300025297 Bacteria 59562
93 Ga0209758_1009961 3300025297 Bacteria 5783
94 Ga0209758_1066940 3300025297 Bacteria 1151
95 Ga0209050_1000033 3300025298 Bacteria 442615
96 Ga0209256_1000782 3300025299 Bacteria 41037
97 Ga0209256_1044080 3300025299 Bacteria 1116
98 Ga0209051_1025138 3300025303 Bacteria 2431
99 Ga0209051_1089150 3300025303 Bacteria 863
100 Ga0209051_1104662 3300025303 Bacteria 753
101 Ga0207656_10121985 3300025321 Bacteria 1214
102 Ga0207655_1002547 3300025728 Bacteria 14590
103 Ga0207710_10180779 3300025900 Bacteria 1035
104 Ga0207681_10410290 3300025923 Bacteria 1096
105 Ga0207686_10010194 3300025934 Bacteria 5109
106 Ga0207686_10161364 3300025934 Bacteria 1571
107 Ga0207709_10148093 3300025935 Bacteria 1622
108 Ga0207691_10800091 3300025940 Bacteria 792
109 Ga0207711_10269891 3300025941 Bacteria 1565
110 Ga0207689_10227632 3300025942 Bacteria 1541
111 Ga0207678_10670320 3300026067 Bacteria 912
112 Ga0207641_10242873 3300026088 Bacteria 1679
113 Ga0207683_10085701 3300026121 Bacteria 2800
114 Ga0207683_10683638 3300026121 Bacteria 951
115 Ga0209281_1000078 3300027111 Bacteria 261622
116 Ga0209813_10157017 3300027866 Bacteria 818
117 Ga0268266_10313568 3300028379 Bacteria 1466
118 Ga0268266_10575202 3300028379 Bacteria 1081
119 Ga0268266_10840252 3300028379 Bacteria 887
120 Ga0268266_10937095 3300028379 Bacteria 838
121 Ga0268264_10490259 3300028381 Bacteria 1197
122 Ga0265318_10031938 3300028577 Unclassified 2040
123 Ga0307517_10237438 3300028786 Bacteria 1086
124 Ga0307515_10076486 3300028794 Bacteria 4439
125 Ga0265338_10404385 3300028800 Unclassified 973
126 Ga0265330_10025603 3300031235 Unclassified 2674
127 Ga0265339_10362036 3300031249 Unclassified 682
128 Ga0265331_10036056 3300031250 Unclassified 2431
129 Ga0265316_10034674 3300031344 Bacteria 4098
130 Ga0265314_10001501 3300031711 Bacteria 25863
131 Ga0265342_10021800 3300031712 Unclassified 4084
132 Ga0307405_10000009 3300031731 Bacteria 259388
133 Ga0307407_10000001 3300031903 Bacteria 570048
134 Ga0307412_10386581 3300031911 Bacteria 1135
135 Ga0307409_100004667 3300031995 Bacteria 7747
136 Ga0307416_100000026 3300032002 Bacteria 172622
137 Ga0307414_10003733 3300032004 Bacteria 8173
138 Ga0307414_10599312 3300032004 Bacteria 988
139 Ga0307411_11108356 3300032005 Bacteria 714
140 Ga0373954_0488274 3300035118 Bacteria 610
141 Ga0373925_0114060 3300037068 Bacteria 2091
142 Ga0436360_0630584 3300039438 Bacteria 10161
143 Ga0436362_0732423 3300039453 Unclassified 918
144 Ga0439459_0015040 3300042438 Bacteria 1414
145 Ga0451577_0092296 3300042876 Bacteria 2703
146 Ga0451577_0278262 3300042876 Bacteria 1516
147 Ga0466965_0108192 3300044683 Bacteria 1427
148 Ga0453684_0363158 3300044712 Bacteria 1630
149 Ga0466970_0254393 3300044765 Bacteria 985
150 Ga0451576_0214657 3300045051 Bacteria 2009
151 Ga0495617_125716 3300046452 Bacteria 824
152 Ga0495627_000076 3300046453 Bacteria 120147
153 Ga0495590_0044720 3300046457 Bacteria 1544
154 Ga0495591_000198 3300046458 Bacteria 61546
155 Ga0495591_000924 3300046458 Bacteria 20256
156 Ga0495638_0001240 3300046460 Bacteria 24046
157 Ga0495638_0503042 3300046460 Bacteria 610
158 Ga0495650_0000032 3300046471 Bacteria 425389
159 Ga0495650_0056789 3300046471 Bacteria 1587
160 Ga0495605_0000664 3300046474 Bacteria 26130
161 Ga0495605_0001499 3300046474 Bacteria 15218
162 Ga0495605_0016749 3300046474 Bacteria 3961
163 Ga0495605_0058395 3300046474 Bacteria 1854
164 Ga0495584_0014374 3300046491 Bacteria 4032
165 Ga0495585_0067771 3300046492 Bacteria 1951
166 Ga0495607_0000024 3300046501 Bacteria 159904
167 Ga0495607_0000306 3300046501 Bacteria 51378
168 Ga0495607_0022191 3300046501 Bacteria 3991
169 Ga0495607_0081520 3300046501 Bacteria 1777
170 Ga0495583_0018501 3300046506 Bacteria 3666
171 Ga0495606_0002092 3300046507 Bacteria 24304
172 Ga0495606_0034307 3300046507 Bacteria 3485
173 Ga0495606_0058978 3300046507 Bacteria 2464
174 Ga0495606_0530548 3300046507 Bacteria 589
175 Ga0495610_0000048 3300046512 Bacteria 150249
176 Ga0495610_0000501 3300046512 Bacteria 39971
177 Ga0495616_0005407 3300046513 Bacteria 7868
178 Ga0495616_0084385 3300046513 Bacteria 1514
179 Ga0495620_0186055 3300046515 Bacteria 802
180 Ga0495631_0003302 3300046518 Bacteria 8872
181 Ga0495631_0338615 3300046518 Bacteria 640
182 Ga0495632_0040715 3300046519 Bacteria 2338
183 Ga0495637_0016454 3300046520 Bacteria 3456
184 Ga0495637_0020745 3300046520 Bacteria 3017
185 Ga0495637_0206343 3300046520 Bacteria 720
186 Ga0495643_0102334 3300046522 Bacteria 1466
187 Ga0495643_0415077 3300046522 Bacteria 591
188 Ga0495644_0007413 3300046523 Bacteria 4231
189 Ga0495648_0002443 3300046524 Bacteria 17170
190 Ga0495654_0000108 3300046530 Bacteria 93555
191 Ga0495609_0022210 3300046538 Bacteria 2924
192 Ga0495597_0000676 3300046542 Bacteria 27672
193 Ga0495645_0277713 3300046543 Bacteria 1103
194 Ga0495633_0171315 3300046558 Bacteria 1000
195 Ga0495633_0216749 3300046558 Bacteria 877
196 Ga0495633_0298360 3300046558 Bacteria 732
197 Ga0495668_0040740 3300046616 Bacteria 2590
198 Ga0495668_0045838 3300046616 Bacteria 2430
199 Ga0495611_0001703 3300046648 Bacteria 10675
200 Ga0495611_0361741 3300046648 Bacteria 665
201 Ga0495625_0007909 3300046660 Bacteria 9147
202 Ga0495625_0120543 3300046660 Bacteria 1785
203 Ga0495625_0236239 3300046660 Bacteria 1192
204 Ga0495670_0061100 3300046691 Bacteria 1894
205 Ga0495671_0002801 3300046692 Bacteria 10912
206 Ga0495671_0383777 3300046692 Bacteria 673
207 Ga0495649_0003348 3300046694 Bacteria 10875
208 Ga0495649_0338990 3300046694 Bacteria 761
209 Ga0495589_0019534 3300046794 Bacteria 3472
210 Ga0495600_0217732 3300046809 Bacteria 1222
211 Ga0495660_0000021 3300046810 Bacteria 293250
212 Ga0495660_0000431 3300046810 Bacteria 35256
213 Ga0495672_0000002 3300047320 Bacteria 740116
214 Ga0495672_0008566 3300047320 Bacteria 7526
215 Ga0495672_0009809 3300047320 Bacteria 6892
216 Ga0495672_0014132 3300047320 Bacteria 5477
217 Ga0495672_0105449 3300047320 Bacteria 1521
218 Ga0495676_0480460 3300047321 Bacteria 817
219 Ga0495683_0019354 3300047323 Bacteria 3514
220 Ga0495687_067958 3300047443 Bacteria 1440
221 Ga0495673_0000081 3300047469 Bacteria 199943
222 Ga0495686_0113115 3300047472 Bacteria 1626
223 Ga0496101_0544969 3300048904 Bacteria 917
224 Ga0496102_0211685 3300048905 Bacteria 1827
225 Ga0496103_0093198 3300048906 Bacteria 1902
226 Ga0496106_0026986 3300048909 Bacteria 4276
227 Ga0496106_0302370 3300048909 Bacteria 1283
228 Ga0496106_0372712 3300048909 Bacteria 1147
229 Ga0496107_0030465 3300048910 Bacteria 3845
230 Ga0496108_0040466 3300048911 Bacteria 3886
231 Ga0496109_0017781 3300048912 Bacteria 6236
232 Ga0496109_1228361 3300048912 Bacteria 686
233 Ga0496110_0040792 3300048913 Bacteria 4046
234 Ga0496110_0438613 3300048913 Bacteria 1190
235 Ga0496111_0007015 3300048914 Bacteria 7358
236 Ga0496111_0137044 3300048914 Bacteria 1813
237 Ga0496112_0279592 3300048915 Bacteria 1616
238 Ga0496113_0115886 3300048916 Bacteria 2090
239 Ga0496114_0341212 3300048917 Bacteria 1325
240 Ga0496115_0058201 3300048918 Bacteria 3110
241 Ga0496116_0009801 3300048919 Bacteria 8121
242 Ga0496116_0015044 3300048919 Bacteria 6135
243 Ga0496116_0172793 3300048919 Bacteria 1169
244 Ga0496116_0415498 3300048919 Bacteria 589
245 Ga0496117_0009366 3300048920 Bacteria 9119
246 Ga0496117_0029567 3300048920 Bacteria 4222
247 Ga0496117_0061234 3300048920 Bacteria 2588
248 Ga0496117_0204383 3300048920 Bacteria 1113
249 Ga0496118_0000649 3300048921 Bacteria 56703
250 Ga0496118_0080410 3300048921 Bacteria 2294
251 Ga0496118_0092215 3300048921 Bacteria 2079
252 Ga0496118_0241912 3300048921 Bacteria 1032
253 Ga0496119_0022629 3300048922 Bacteria 4490
254 Ga0496119_0381652 3300048922 Bacteria 676
255 Ga0496120_0009320 3300048923 Bacteria 6981
256 Ga0496121_0000003 3300048924 Bacteria 1191431
257 Ga0496121_0013154 3300048924 Bacteria 8926
258 Ga0496121_0016060 3300048924 Bacteria 7759
259 Ga0496121_0030835 3300048924 Bacteria 4916
260 Ga0496121_0098954 3300048924 Bacteria 2255
261 Ga0496121_0114941 3300048924 Bacteria 2044
262 Ga0496121_0271828 3300048924 Bacteria 1164
263 Ga0496121_0633115 3300048924 Unclassified 654
264 Ga0496122_0067952 3300048925 Bacteria 2562
265 Ga0496122_0078852 3300048925 Bacteria 2304
266 Ga0496122_0080737 3300048925 Bacteria 2266
267 Ga0496122_0158541 3300048925 Bacteria 1384
268 Ga0496122_0159418 3300048925 Bacteria 1378
269 Ga0496122_0226740 3300048925 Bacteria 1066
270 Ga0496122_0293782 3300048925 Bacteria 880
271 Ga0496122_0440391 3300048925 Bacteria 649
272 Ga0496123_0009684 3300048926 Bacteria 8639
273 Ga0496123_0027883 3300048926 Bacteria 4194
274 Ga0496123_0055638 3300048926 Bacteria 2593
275 Ga0496124_0000009 3300048927 Bacteria 734820
276 Ga0496124_0013275 3300048927 Bacteria 8051
277 Ga0496124_0025554 3300048927 Bacteria 5348
278 Ga0496124_0090343 3300048927 Bacteria 2498
279 Ga0496124_0092823 3300048927 Bacteria 2458
280 Ga0496124_0098227 3300048927 Bacteria 2376
281 Ga0496124_0200837 3300048927 Bacteria 1516
282 Ga0496124_0298689 3300048927 Bacteria 1164
283 Ga0496124_0346956 3300048927 Unclassified 1051
284 Ga0496124_0402633 3300048927 Bacteria 949
285 Ga0496124_0433136 3300048927 Bacteria 902
286 Ga0496124_0534758 3300048927 Bacteria 777
287 Ga0496125_0003405 3300048928 Bacteria 19331
288 Ga0496125_0010745 3300048928 Bacteria 9222
289 Ga0496125_0566091 3300048928 Bacteria 627
290 Ga0496126_0205931 3300048929 Bacteria 1658
291 Ga0496126_0366482 3300048929 Bacteria 1176
292 Ga0496126_0373861 3300048929 Bacteria 1161
293 Ga0496126_0375439 3300048929 Bacteria 1158
294 Ga0496126_0494373 3300048929 Bacteria 978
295 Ga0496126_1005101 3300048929 Bacteria 626
296 Ga0495678_000513 3300049459 Bacteria 37746
297 Ga0495678_109759 3300049459 Bacteria 942
298 Ga0495682_0000001 3300049460 Bacteria 1559116
299 nmdc:mga0yw44_192368_c1 3300050492 Bacteria 1346
300 nmdc:mga0k408_284307_c1 3300050493 Bacteria 987
301 nmdc:mga07m45_353029_c1 3300050496 Bacteria 854
302 nmdc:mga07m45_434920_c1 3300050496 Bacteria 761
303 Ga0495601_0504909 3300053077 Unclassified 780
304 Ga0500610_0020576 3300053079 Bacteria 3223
305 Ga0500643_043873 3300053087 Bacteria 1302
306 Ga0500646_0107348 3300053090 Bacteria 884
307 Ga0500583_0208268 3300053092 Bacteria 971
308 Ga0500583_0269535 3300053092 Bacteria 838
309 Ga0500641_0047328 3300053096 Bacteria 1758
310 Ga0500557_005151 3300053105 Bacteria 2831
311 Ga0500562_017472 3300053108 Bacteria 1850
312 Ga0500569_042597 3300053109 Bacteria 1337
313 Ga0500594_0005205 3300053118 Bacteria 2881
314 Ga0500621_000001 3300053126 Bacteria 1049698
315 Ga0500642_0463829 3300053130 Bacteria 541
316 Ga0500568_0002986 3300053139 Bacteria 9676
317 Ga0500573_0182322 3300053140 Bacteria 1128
318 Ga0500588_0109152 3300053146 Bacteria 963
319 Ga0500616_0004523 3300053153 Bacteria 9869
320 Ga0500627_0212037 3300053158 Bacteria 866
321 Ga0500611_061876 3300053727 Bacteria 889
322 Ga0500599_047118 3300053736 Bacteria 676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10009204 Ga0105238_100092047 160
2 iso_pu_bacteria 2585427687 2586206670 160
3 iso_pu_bacteria 2739367651 2739586899 160
4 iso_pu_bacteria 2842722452 2842727658 160
5 iso_pu_bacteria 2842909656 2842911137 160
6 iso_pu_bacteria 2849281842 2849283091 160
7 iso_pu_bacteria 2857627736 2857631925 160
8 iso_pu_bacteria 2945997725 2945997751 160
9 iso_pu_bacteria 2954016120 2954020203 160
10 3300025934 Ga0207686_10010194 Ga0207686_100101942 161
11 3300028794 Ga0307515_10076486 Ga0307515_100764866 161
12 iso_pu_bacteria 2599185155 2599327689 161
13 iso_pu_bacteria 2826581358 2826581907 161
14 iso_pu_bacteria 2842815866 2842816839 161
15 iso_pu_bacteria 2842849001 2842853947 161
16 3300005288 Ga0065714_10066880 Ga0065714_100668803 162
17 3300005548 Ga0070665_100411829 Ga0070665_1004118291 162
18 3300013102 Ga0157371_10000383 Ga0157371_1000038334 162
19 3300014497 Ga0182008_10003578 Ga0182008_100035783 162
20 3300028379 Ga0268266_10313568 Ga0268266_103135682 162
21 3300042876 Ga0451577_0092296 Ga0451577_0092296_514_1002 162
22 3300042876 Ga0451577_0278262 Ga0451577_0278262_43_555 162
23 3300044712 Ga0453684_0363158 Ga0453684_0363158_1061_1549 162
24 3300045051 Ga0451576_0214657 Ga0451576_0214657_927_1415 162
25 3300046458 Ga0495591_000924 Ga0495591_000924_12613_13101 162
26 3300046471 Ga0495650_0000032 Ga0495650_0000032_365128_365616 162
27 3300046474 Ga0495605_0058395 Ga0495605_0058395_88_576 162
28 3300046491 Ga0495584_0014374 Ga0495584_0014374_424_912 162
29 3300046501 Ga0495607_0022191 Ga0495607_0022191_2430_2918 162
30 3300046501 Ga0495607_0081520 Ga0495607_0081520_1159_1662 162
31 3300046507 Ga0495606_0002092 Ga0495606_0002092_13849_14337 162
32 3300046507 Ga0495606_0034307 Ga0495606_0034307_1065_1568 162
33 3300046513 Ga0495616_0005407 Ga0495616_0005407_6904_7392 162
34 3300046520 Ga0495637_0206343 Ga0495637_0206343_22_510 162
35 3300046522 Ga0495643_0415077 Ga0495643_0415077_15_503 162
36 3300046523 Ga0495644_0007413 Ga0495644_0007413_1347_1835 162
37 3300046524 Ga0495648_0002443 Ga0495648_0002443_13783_14271 162
38 3300046530 Ga0495654_0000108 Ga0495654_0000108_7413_7901 162
39 3300046543 Ga0495645_0277713 Ga0495645_0277713_46_534 162
40 3300046648 Ga0495611_0361741 Ga0495611_0361741_41_529 162
41 3300046692 Ga0495671_0002801 Ga0495671_0002801_4027_4515 162
42 3300046694 Ga0495649_0003348 Ga0495649_0003348_1329_1817 162
43 3300046694 Ga0495649_0338990 Ga0495649_0338990_114_605 162
44 3300046794 Ga0495589_0019534 Ga0495589_0019534_1056_1544 162
45 3300046810 Ga0495660_0000021 Ga0495660_0000021_225990_226478 162
46 3300046810 Ga0495660_0000431 Ga0495660_0000431_7447_8001 162
47 3300047320 Ga0495672_0000002 Ga0495672_0000002_340199_340687 162
48 3300047320 Ga0495672_0009809 Ga0495672_0009809_1973_2476 162
49 3300047320 Ga0495672_0105449 Ga0495672_0105449_601_1098 162
50 3300047321 Ga0495676_0480460 Ga0495676_0480460_276_764 162
51 3300047323 Ga0495683_0019354 Ga0495683_0019354_2455_2943 162
52 3300047469 Ga0495673_0000081 Ga0495673_0000081_142809_143297 162
53 3300048920 Ga0496117_0029567 Ga0496117_0029567_750_1241 162
54 3300048921 Ga0496118_0000649 Ga0496118_0000649_4348_4839 162
55 3300048921 Ga0496118_0241912 Ga0496118_0241912_13_504 162
56 3300048924 Ga0496121_0030835 Ga0496121_0030835_4389_4877 162
57 3300048927 Ga0496124_0013275 Ga0496124_0013275_500_988 162
58 3300049459 Ga0495678_000513 Ga0495678_000513_4897_5385 162
59 3300049460 Ga0495682_0000001 Ga0495682_0000001_1505423_1505911 162
60 3300053077 Ga0495601_0504909 Ga0495601_0504909_96_584 162
61 3300053126 Ga0500621_000001 Ga0500621_000001_973811_974299 162
62 3300002773 JGI25152J39213_1002651 JGI25152J39213_10026517 163
63 3300002773 JGI25152J39213_1002776 JGI25152J39213_10027763 163
64 3300002774 JGI25150J39212_1000256 JGI25150J39212_100025619 163
65 3300003187 JGI25151J46595_10000916 JGI25151J46595_100009165 163
66 3300003187 JGI25151J46595_10002252 JGI25151J46595_100022524 163
67 3300003215 JGI25153J46596_10005343 JGI25153J46596_100053432 163
68 3300003659 JGI25404J52841_10038690 JGI25404J52841_100386902 163
69 3300003659 JGI25404J52841_10061410 JGI25404J52841_100614101 163
70 3300003771 Ga0055526_1024440 Ga0055526_10244404 163
71 3300003781 Ga0055536_1000006 Ga0055536_1000006301 163
72 3300003790 Ga0055528_1015924 Ga0055528_10159243 163
73 3300003791 Ga0055530_10000679 Ga0055530_1000067917 163
74 3300003792 Ga0055540_1008166 Ga0055540_10081664 163
75 3300005262 Ga0065165_1019528 Ga0065165_10195282 163
76 3300005290 Ga0065712_10000148 Ga0065712_1000014822 163
77 3300005334 Ga0068869_100093245 Ga0068869_1000932452 163
78 3300005340 Ga0070689_100681547 Ga0070689_1006815471 163
79 3300005344 Ga0070661_100573838 Ga0070661_1005738382 163
80 3300005347 Ga0070668_100471711 Ga0070668_1004717112 163
81 3300005347 Ga0070668_101626384 Ga0070668_1016263841 163
82 3300005353 Ga0070669_100366959 Ga0070669_1003669592 163
83 3300005455 Ga0070663_100724025 Ga0070663_1007240251 163
84 3300005456 Ga0070678_100101073 Ga0070678_1001010733 163
85 3300005456 Ga0070678_101370693 Ga0070678_1013706931 163
86 3300005544 Ga0070686_100113069 Ga0070686_1001130692 163
87 3300005548 Ga0070665_100518664 Ga0070665_1005186642 163
88 3300005548 Ga0070665_101748720 Ga0070665_1017487201 163
89 3300005615 Ga0070702_100113618 Ga0070702_1001136182 163
90 3300005618 Ga0068864_101158833 Ga0068864_1011588332 163
91 3300005718 Ga0068866_10335279 Ga0068866_103352792 163
92 3300005719 Ga0068861_101517341 Ga0068861_1015173411 163
93 3300005834 Ga0068851_10069938 Ga0068851_100699382 163
94 3300005843 Ga0068860_100716681 Ga0068860_1007166812 163
95 3300005844 Ga0068862_100235230 Ga0068862_1002352302 163
96 3300005937 Ga0081455_10137327 Ga0081455_101373272 163
97 3300005983 Ga0081540_1000990 Ga0081540_100099026 163
98 3300005983 Ga0081540_1003471 Ga0081540_10034712 163
99 3300005983 Ga0081540_1075907 Ga0081540_10759072 163
100 3300006038 Ga0075365_10052403 Ga0075365_100524032 163
101 3300006042 Ga0075368_10214033 Ga0075368_102140332 163
102 3300006881 Ga0068865_100075972 Ga0068865_1000759722 163
103 3300006946 Ga0079104_1000010 Ga0079104_1000010394 163
104 3300007788 Ga0099795_10043101 Ga0099795_100431011 163
105 3300009098 Ga0105245_10441471 Ga0105245_104414712 163
106 3300009101 Ga0105247_10029429 Ga0105247_100294293 163
107 3300009148 Ga0105243_10113056 Ga0105243_101130562 163
108 3300009148 Ga0105243_10796793 Ga0105243_107967931 163
109 3300009176 Ga0105242_10117251 Ga0105242_101172512 163
110 3300009177 Ga0105248_10183114 Ga0105248_101831143 163
111 3300009545 Ga0105237_10126978 Ga0105237_101269781 163
112 3300009553 Ga0105249_10289973 Ga0105249_102899732 163
113 3300009553 Ga0105249_11203408 Ga0105249_112034082 163
114 3300011119 Ga0105246_10193008 Ga0105246_101930082 163
115 3300011119 Ga0105246_10336880 Ga0105246_103368803 163
116 3300011119 Ga0105246_10345738 Ga0105246_103457382 163
117 3300011119 Ga0105246_10791108 Ga0105246_107911081 163
118 3300013100 Ga0157373_10124290 Ga0157373_101242902 163
119 3300013102 Ga0157371_10000296 Ga0157371_1000029649 163
120 3300013104 Ga0157370_10000383 Ga0157370_1000038326 163
121 3300013104 Ga0157370_10017361 Ga0157370_100173613 163
122 3300013104 Ga0157370_10111062 Ga0157370_101110622 163
123 3300013104 Ga0157370_10195236 Ga0157370_101952363 163
124 3300013104 Ga0157370_11389437 Ga0157370_113894371 163
125 3300013105 Ga0157369_10000164 Ga0157369_1000016453 163
126 3300013306 Ga0163162_10195013 Ga0163162_101950132 163
127 3300013306 Ga0163162_10992101 Ga0163162_109921011 163
128 3300013307 Ga0157372_10029850 Ga0157372_100298505 163
129 3300014325 Ga0163163_11691917 Ga0163163_116919171 163
130 3300014326 Ga0157380_10605641 Ga0157380_106056411 163
131 3300015261 Ga0182006_1000546 Ga0182006_100054617 163
132 3300015261 Ga0182006_1041808 Ga0182006_10418083 163
133 3300015262 Ga0182007_10000005 Ga0182007_1000000551 163
134 3300015682 Ga0183373_1002 Ga0183373_1002637 163
135 3300017792 Ga0163161_10000135 Ga0163161_1000013556 163
136 3300017792 Ga0163161_10000539 Ga0163161_1000053917 163
137 3300021441 Ga0213871_10007556 Ga0213871_100075564 163
138 3300025245 Ga0207425_1000497 Ga0207425_10004976 163
139 3300025258 Ga0209129_1000078 Ga0209129_100007818 163
140 3300025258 Ga0209129_1000658 Ga0209129_10006586 163
141 3300025273 Ga0209673_1000015 Ga0209673_1000015206 163
142 3300025273 Ga0209673_1018030 Ga0209673_10180302 163
143 3300025292 Ga0209676_1000039 Ga0209676_1000039396 163
144 3300025294 Ga0209025_1000489 Ga0209025_100048935 163
145 3300025294 Ga0209025_1000664 Ga0209025_100066443 163
146 3300025294 Ga0209025_1015932 Ga0209025_10159323 163
147 3300025295 Ga0209564_1010567 Ga0209564_10105676 163
148 3300025297 Ga0209758_1000549 Ga0209758_100054943 163
149 3300025297 Ga0209758_1009961 Ga0209758_10099614 163
150 3300025297 Ga0209758_1066940 Ga0209758_10669402 163
151 3300025298 Ga0209050_1000033 Ga0209050_100003353 163
152 3300025299 Ga0209256_1000782 Ga0209256_100078227 163
153 3300025299 Ga0209256_1044080 Ga0209256_10440802 163
154 3300025303 Ga0209051_1025138 Ga0209051_10251383 163
155 3300025303 Ga0209051_1089150 Ga0209051_10891502 163
156 3300025303 Ga0209051_1104662 Ga0209051_11046622 163
157 3300025321 Ga0207656_10121985 Ga0207656_101219852 163
158 3300025728 Ga0207655_1002547 Ga0207655_10025474 163
159 3300025900 Ga0207710_10180779 Ga0207710_101807792 163
160 3300025923 Ga0207681_10410290 Ga0207681_104102902 163
161 3300025934 Ga0207686_10161364 Ga0207686_101613642 163
162 3300025935 Ga0207709_10148093 Ga0207709_101480932 163
163 3300025940 Ga0207691_10800091 Ga0207691_108000912 163
164 3300025941 Ga0207711_10269891 Ga0207711_102698912 163
165 3300025942 Ga0207689_10227632 Ga0207689_102276322 163
166 3300026067 Ga0207678_10670320 Ga0207678_106703202 163
167 3300026088 Ga0207641_10242873 Ga0207641_102428732 163
168 3300026121 Ga0207683_10085701 Ga0207683_100857013 163
169 3300026121 Ga0207683_10683638 Ga0207683_106836382 163
170 3300027111 Ga0209281_1000078 Ga0209281_1000078271 163
171 3300027866 Ga0209813_10157017 Ga0209813_101570171 163
172 3300028379 Ga0268266_10575202 Ga0268266_105752022 163
173 3300028379 Ga0268266_10840252 Ga0268266_108402522 163
174 3300028379 Ga0268266_10937095 Ga0268266_109370951 163
175 3300028381 Ga0268264_10490259 Ga0268264_104902592 163
176 3300028577 Ga0265318_10031938 Ga0265318_100319383 163
177 3300028786 Ga0307517_10237438 Ga0307517_102374382 163
178 3300028800 Ga0265338_10404385 Ga0265338_104043852 163
179 3300031235 Ga0265330_10025603 Ga0265330_100256032 163
180 3300031249 Ga0265339_10362036 Ga0265339_103620361 163
181 3300031250 Ga0265331_10036056 Ga0265331_100360561 163
182 3300031344 Ga0265316_10034674 Ga0265316_100346741 163
183 3300031711 Ga0265314_10001501 Ga0265314_100015013 163
184 3300031712 Ga0265342_10021800 Ga0265342_100218003 163
185 3300031731 Ga0307405_10000009 Ga0307405_10000009227 163
186 3300031903 Ga0307407_10000001 Ga0307407_10000001404 163
187 3300031911 Ga0307412_10386581 Ga0307412_103865812 163
188 3300031995 Ga0307409_100004667 Ga0307409_1000046674 163
189 3300032002 Ga0307416_100000026 Ga0307416_100000026149 163
190 3300032004 Ga0307414_10003733 Ga0307414_100037335 163
191 3300032004 Ga0307414_10599312 Ga0307414_105993122 163
192 3300032005 Ga0307411_11108356 Ga0307411_111083561 163
193 3300035118 Ga0373954_0488274 Ga0373954_0488274_80_571 163
194 3300037068 Ga0373925_0114060 Ga0373925_0114060_436_1026 163
195 3300039438 Ga0436360_0630584 Ga0436360_0630584_1704_2201 163
196 3300039453 Ga0436362_0732423 Ga0436362_0732423_25_522 163
197 3300042438 Ga0439459_0015040 Ga0439459_0015040_99_698 163
198 3300044683 Ga0466965_0108192 Ga0466965_0108192_813_1307 163
199 3300044765 Ga0466970_0254393 Ga0466970_0254393_388_882 163
200 3300046452 Ga0495617_125716 Ga0495617_125716_58_549 163
201 3300046453 Ga0495627_000076 Ga0495627_000076_5681_6187 163
202 3300046457 Ga0495590_0044720 Ga0495590_0044720_316_807 163
203 3300046458 Ga0495591_000198 Ga0495591_000198_58131_58691 163
204 3300046460 Ga0495638_0001240 Ga0495638_0001240_18818_19309 163
205 3300046460 Ga0495638_0503042 Ga0495638_0503042_40_564 163
206 3300046471 Ga0495650_0056789 Ga0495650_0056789_427_930 163
207 3300046474 Ga0495605_0000664 Ga0495605_0000664_14799_15305 163
208 3300046474 Ga0495605_0001499 Ga0495605_0001499_6109_6600 163
209 3300046474 Ga0495605_0016749 Ga0495605_0016749_1961_2485 163
210 3300046492 Ga0495585_0067771 Ga0495585_0067771_787_1278 163
211 3300046501 Ga0495607_0000024 Ga0495607_0000024_151770_152294 163
212 3300046501 Ga0495607_0000306 Ga0495607_0000306_27910_28470 163
213 3300046506 Ga0495583_0018501 Ga0495583_0018501_293_784 163
214 3300046507 Ga0495606_0058978 Ga0495606_0058978_1831_2334 163
215 3300046507 Ga0495606_0530548 Ga0495606_0530548_11_502 163
216 3300046512 Ga0495610_0000048 Ga0495610_0000048_115546_116049 163
217 3300046512 Ga0495610_0000501 Ga0495610_0000501_32366_32872 163
218 3300046513 Ga0495616_0084385 Ga0495616_0084385_427_918 163
219 3300046515 Ga0495620_0186055 Ga0495620_0186055_85_576 163
220 3300046518 Ga0495631_0003302 Ga0495631_0003302_384_875 163
221 3300046518 Ga0495631_0338615 Ga0495631_0338615_13_537 163
222 3300046519 Ga0495632_0040715 Ga0495632_0040715_325_816 163
223 3300046520 Ga0495637_0016454 Ga0495637_0016454_2199_2759 163
224 3300046520 Ga0495637_0020745 Ga0495637_0020745_707_1210 163
225 3300046522 Ga0495643_0102334 Ga0495643_0102334_649_1140 163
226 3300046538 Ga0495609_0022210 Ga0495609_0022210_97_588 163
227 3300046542 Ga0495597_0000676 Ga0495597_0000676_16992_17552 163
228 3300046558 Ga0495633_0171315 Ga0495633_0171315_86_589 163
229 3300046558 Ga0495633_0216749 Ga0495633_0216749_298_801 163
230 3300046558 Ga0495633_0298360 Ga0495633_0298360_85_588 163
231 3300046616 Ga0495668_0040740 Ga0495668_0040740_1965_2525 163
232 3300046616 Ga0495668_0045838 Ga0495668_0045838_648_1139 163
233 3300046648 Ga0495611_0001703 Ga0495611_0001703_165_656 163
234 3300046660 Ga0495625_0007909 Ga0495625_0007909_3797_4288 163
235 3300046660 Ga0495625_0120543 Ga0495625_0120543_514_1119 163
236 3300046660 Ga0495625_0236239 Ga0495625_0236239_264_755 163
237 3300046691 Ga0495670_0061100 Ga0495670_0061100_672_1163 163
238 3300046692 Ga0495671_0383777 Ga0495671_0383777_14_505 163
239 3300046809 Ga0495600_0217732 Ga0495600_0217732_462_953 163
240 3300047320 Ga0495672_0008566 Ga0495672_0008566_6736_7227 163
241 3300047320 Ga0495672_0014132 Ga0495672_0014132_2546_3070 163
242 3300047443 Ga0495687_067958 Ga0495687_067958_682_1185 163
243 3300047472 Ga0495686_0113115 Ga0495686_0113115_263_766 163
244 3300048904 Ga0496101_0544969 Ga0496101_0544969_140_637 163
245 3300048905 Ga0496102_0211685 Ga0496102_0211685_31_621 163
246 3300048906 Ga0496103_0093198 Ga0496103_0093198_425_1015 163
247 3300048909 Ga0496106_0026986 Ga0496106_0026986_1313_1903 163
248 3300048909 Ga0496106_0302370 Ga0496106_0302370_411_902 163
249 3300048909 Ga0496106_0372712 Ga0496106_0372712_86_613 163
250 3300048910 Ga0496107_0030465 Ga0496107_0030465_1122_1718 163
251 3300048911 Ga0496108_0040466 Ga0496108_0040466_1355_1945 163
252 3300048912 Ga0496109_0017781 Ga0496109_0017781_2750_3340 163
253 3300048912 Ga0496109_1228361 Ga0496109_1228361_181_672 163
254 3300048913 Ga0496110_0040792 Ga0496110_0040792_3304_3894 163
255 3300048913 Ga0496110_0438613 Ga0496110_0438613_488_979 163
256 3300048914 Ga0496111_0007015 Ga0496111_0007015_2617_3111 163
257 3300048914 Ga0496111_0137044 Ga0496111_0137044_156_746 163
258 3300048915 Ga0496112_0279592 Ga0496112_0279592_886_1476 163
259 3300048916 Ga0496113_0115886 Ga0496113_0115886_289_879 163
260 3300048917 Ga0496114_0341212 Ga0496114_0341212_58_585 163
261 3300048918 Ga0496115_0058201 Ga0496115_0058201_285_875 163
262 3300048919 Ga0496116_0009801 Ga0496116_0009801_6088_6585 163
263 3300048919 Ga0496116_0015044 Ga0496116_0015044_4995_5492 163
264 3300048919 Ga0496116_0172793 Ga0496116_0172793_558_1055 163
265 3300048919 Ga0496116_0415498 Ga0496116_0415498_55_546 163
266 3300048920 Ga0496117_0009366 Ga0496117_0009366_3114_3605 163
267 3300048920 Ga0496117_0061234 Ga0496117_0061234_201_698 163
268 3300048920 Ga0496117_0204383 Ga0496117_0204383_503_1000 163
269 3300048921 Ga0496118_0080410 Ga0496118_0080410_1299_1796 163
270 3300048921 Ga0496118_0092215 Ga0496118_0092215_1398_1889 163
271 3300048922 Ga0496119_0022629 Ga0496119_0022629_236_727 163
272 3300048922 Ga0496119_0381652 Ga0496119_0381652_23_514 163
273 3300048923 Ga0496120_0009320 Ga0496120_0009320_5276_5767 163
274 3300048924 Ga0496121_0000003 Ga0496121_0000003_259575_260066 163
275 3300048924 Ga0496121_0013154 Ga0496121_0013154_1480_1977 163
276 3300048924 Ga0496121_0016060 Ga0496121_0016060_1396_1893 163
277 3300048924 Ga0496121_0098954 Ga0496121_0098954_1479_1970 163
278 3300048924 Ga0496121_0114941 Ga0496121_0114941_1356_1850 163
279 3300048924 Ga0496121_0271828 Ga0496121_0271828_246_743 163
280 3300048924 Ga0496121_0633115 Ga0496121_0633115_53_544 163
281 3300048925 Ga0496122_0067952 Ga0496122_0067952_1480_1977 163
282 3300048925 Ga0496122_0078852 Ga0496122_0078852_1502_1993 163
283 3300048925 Ga0496122_0080737 Ga0496122_0080737_1397_1891 163
284 3300048925 Ga0496122_0158541 Ga0496122_0158541_108_602 163
285 3300048925 Ga0496122_0159418 Ga0496122_0159418_296_793 163
286 3300048925 Ga0496122_0226740 Ga0496122_0226740_339_836 163
287 3300048925 Ga0496122_0293782 Ga0496122_0293782_175_669 163
288 3300048925 Ga0496122_0440391 Ga0496122_0440391_10_504 163
289 3300048926 Ga0496123_0009684 Ga0496123_0009684_5878_6375 163
290 3300048926 Ga0496123_0027883 Ga0496123_0027883_3524_4021 163
291 3300048926 Ga0496123_0055638 Ga0496123_0055638_1521_2015 163
292 3300048927 Ga0496124_0000009 Ga0496124_0000009_394631_395140 163
293 3300048927 Ga0496124_0025554 Ga0496124_0025554_1465_1962 163
294 3300048927 Ga0496124_0090343 Ga0496124_0090343_249_746 163
295 3300048927 Ga0496124_0092823 Ga0496124_0092823_1589_2086 163
296 3300048927 Ga0496124_0098227 Ga0496124_0098227_1750_2247 163
297 3300048927 Ga0496124_0200837 Ga0496124_0200837_347_841 163
298 3300048927 Ga0496124_0298689 Ga0496124_0298689_468_959 163
299 3300048927 Ga0496124_0346956 Ga0496124_0346956_468_959 163
300 3300048927 Ga0496124_0402633 Ga0496124_0402633_339_836 163
301 3300048927 Ga0496124_0433136 Ga0496124_0433136_38_529 163
302 3300048927 Ga0496124_0534758 Ga0496124_0534758_203_697 163
303 3300048928 Ga0496125_0003405 Ga0496125_0003405_367_858 163
304 3300048928 Ga0496125_0010745 Ga0496125_0010745_2258_2755 163
305 3300048928 Ga0496125_0566091 Ga0496125_0566091_116_616 163
306 3300048929 Ga0496126_0205931 Ga0496126_0205931_124_618 163
307 3300048929 Ga0496126_0366482 Ga0496126_0366482_523_1035 163
308 3300048929 Ga0496126_0373861 Ga0496126_0373861_456_947 163
309 3300048929 Ga0496126_0375439 Ga0496126_0375439_212_703 163
310 3300048929 Ga0496126_0494373 Ga0496126_0494373_312_803 163
311 3300048929 Ga0496126_1005101 Ga0496126_1005101_71_595 163
312 3300049459 Ga0495678_109759 Ga0495678_109759_262_753 163
313 3300050492 nmdc:mga0yw44_192368_c1 nmdc:mga0yw44_192368_c1_102_641 163
314 3300050493 nmdc:mga0k408_284307_c1 nmdc:mga0k408_284307_c1_19_603 163
315 3300050496 nmdc:mga07m45_353029_c1 nmdc:mga07m45_353029_c1_317_841 163
316 3300050496 nmdc:mga07m45_434920_c1 nmdc:mga07m45_434920_c1_74_568 163
317 3300053079 Ga0500610_0020576 Ga0500610_0020576_2323_2814 163
318 3300053087 Ga0500643_043873 Ga0500643_043873_698_1189 163
319 3300053090 Ga0500646_0107348 Ga0500646_0107348_97_588 163
320 3300053092 Ga0500583_0208268 Ga0500583_0208268_167_658 163
321 3300053092 Ga0500583_0269535 Ga0500583_0269535_132_623 163
322 3300053096 Ga0500641_0047328 Ga0500641_0047328_1055_1546 163
323 3300053105 Ga0500557_005151 Ga0500557_005151_1894_2385 163
324 3300053108 Ga0500562_017472 Ga0500562_017472_1301_1792 163
325 3300053109 Ga0500569_042597 Ga0500569_042597_188_679 163
326 3300053118 Ga0500594_0005205 Ga0500594_0005205_255_746 163
327 3300053130 Ga0500642_0463829 Ga0500642_0463829_18_509 163
328 3300053139 Ga0500568_0002986 Ga0500568_0002986_4533_5024 163
329 3300053140 Ga0500573_0182322 Ga0500573_0182322_529_1035 163
330 3300053146 Ga0500588_0109152 Ga0500588_0109152_244_735 163
331 3300053153 Ga0500616_0004523 Ga0500616_0004523_912_1403 163
332 3300053158 Ga0500627_0212037 Ga0500627_0212037_316_807 163
333 3300053727 Ga0500611_061876 Ga0500611_061876_55_546 163
334 3300053736 Ga0500599_047118 Ga0500599_047118_119_610 163
335 iso_pu_bacteria 8006984368 8006992610 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

23

139

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

49

147

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

54

141

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9562 4 163
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9528 4 163
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9446 4 163
2q7b-assembly1.cif.gz_A-2 crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution 0.9416 1 161
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9414 4 163
ID Description Score Start End Superfamily
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.951 4 163 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9392 4 163 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9244 5 161 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8971 5 161 3.40.630.30
af_E0CYC6_80_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8878 44 141 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A845SRN4-F1-model_v4 GNAT family N-acetyltransferase 0.9969 4 159 GO:0008080
AF-A0A0B4WZH6-F1-model_v4 GCN5-related N-acetyltransferase protein 0.995 1 161 GO:0008080
AF-A0A3M3S969-F1-model_v4 deleted 0.9942 2 161
AF-A0A7G6AXG7-F1-model_v4 deleted 0.994 4 163
AF-A0A4R3QLE4-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9938 1 163 GO:0008080

Feature Viewer

pLDDT pTM Quality
93.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map