F412373

General Info

Members Datasets Scaffolds Average Seq Length
335 220 670 286

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000071|Ga0495606_0000071_75300_76301
Length 333
Sequence MSDETKIIWEVSDFRRIPAATRIHPTITRTSIALPRSLRHHHWIDRRGLPMARIIMPLPQRDFDPSEVALSWRVLTDRGHEVRFAAPDGGSATADPIMLDGIGLDPWGRVPGLRRVRLIGLLLRANRDARRAYAELECDPHFRTPLRWDQASADEFDGLLLPGGHRARGMRDYLESAVLQRLVAAFFDVGKPVGAICHGVLLAARSKRGDGKSVLYGRRTASLTWAQERAASALAHVGRWWDRDYYRTYVEEPGQPDGYMSVEAEVTRALATPDDYVDVPHDAPDFRRKTSGLARDTIDDARPAWVVRDRNYVSARWPGDAHTFAARFAELLG

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
213 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
214 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
215 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
216 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
217 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
218 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
219 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
220 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 2.09
Rhizoplane 5.67
Rhizosphere 81.79
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0000071 3300046507 Bacteria 175933
2 JGI24747J21853_1004659 3300001978 Bacteria 1239
3 JGI24737J22298_10000079 3300001990 Bacteria 28549
4 JGI24735J21928_10037428 3300002067 Bacteria 1422
5 JGI24742J22300_10005593 3300002244 Bacteria 2065
6 JGI25153J46596_10000007 3300003215 Bacteria 377573
7 Ga0070658_10000625 3300005327 Bacteria 30553
8 Ga0070690_100012126 3300005330 Bacteria 5066
9 Ga0068869_100245954 3300005334 Bacteria 1427
10 Ga0070666_10000198 3300005335 Bacteria 40959
11 Ga0070666_10019681 3300005335 Bacteria 4360
12 Ga0070680_100303456 3300005336 Bacteria 1354
13 Ga0070682_100344059 3300005337 Bacteria 1109
14 Ga0068868_100079538 3300005338 Bacteria 2626
15 Ga0070660_100117580 3300005339 Bacteria 2120
16 Ga0070660_100223625 3300005339 Bacteria 1530
17 Ga0070661_100000743 3300005344 Bacteria 23641
18 Ga0070661_100005891 3300005344 Bacteria 8434
19 Ga0070661_100412257 3300005344 Bacteria 1070
20 Ga0070668_100017326 3300005347 Bacteria 5395
21 Ga0070669_100548240 3300005353 Bacteria 964
22 Ga0070671_100098664 3300005355 Bacteria 2450
23 Ga0070674_100000678 3300005356 Bacteria 17210
24 Ga0070674_100006758 3300005356 Bacteria 6717
25 Ga0070673_100048575 3300005364 Bacteria 3309
26 Ga0070673_100072820 3300005364 Bacteria 2764
27 Ga0070667_100007300 3300005367 Bacteria 9190
28 Ga0070667_100074512 3300005367 Bacteria 2896
29 Ga0070667_100105548 3300005367 Bacteria 2438
30 Ga0070714_100035218 3300005435 Bacteria 4195
31 Ga0070710_10245381 3300005437 Bacteria 1149
32 Ga0070711_100242036 3300005439 Bacteria 1411
33 Ga0070678_100000816 3300005456 Bacteria 15760
34 Ga0070662_100161124 3300005457 Bacteria 1755
35 Ga0068867_100026054 3300005459 Bacteria 4196
36 Ga0070699_100233575 3300005518 Bacteria 1640
37 Ga0070679_100127659 3300005530 Bacteria 2525
38 Ga0070684_100282210 3300005535 Bacteria 1521
39 Ga0070697_100126494 3300005536 Bacteria 2141
40 Ga0068853_100004731 3300005539 Bacteria 10570
41 Ga0068853_100151685 3300005539 Bacteria 2086
42 Ga0068853_100738752 3300005539 Unclassified 940
43 Ga0070672_100028581 3300005543 Bacteria 4172
44 Ga0070665_100000044 3300005548 Bacteria 276702
45 Ga0070665_100036069 3300005548 Bacteria 4975
46 Ga0068855_100047883 3300005563 Bacteria 5048
47 Ga0068855_100586513 3300005563 Bacteria 1203
48 Ga0068856_100007448 3300005614 Bacteria 10681
49 Ga0068856_100034714 3300005614 Bacteria 4940
50 Ga0068852_100048098 3300005616 Bacteria 3643
51 Ga0068859_100127004 3300005617 Bacteria 2620
52 Ga0068864_100019956 3300005618 Bacteria 5603
53 Ga0068863_100002017 3300005841 Bacteria 20118
54 Ga0068863_100073714 3300005841 Bacteria 3230
55 Ga0068863_100793952 3300005841 Bacteria 944
56 Ga0068858_100216082 3300005842 Bacteria 1815
57 Ga0068860_100000822 3300005843 Bacteria 34721
58 Ga0068860_100025832 3300005843 Bacteria 5665
59 Ga0070717_10203442 3300006028 Bacteria 1735
60 Ga0070712_100026397 3300006175 Bacteria 3868
61 Ga0075366_10012660 3300006195 Bacteria 4791
62 Ga0097621_100071991 3300006237 Bacteria 2858
63 Ga0097621_100172552 3300006237 Bacteria 1865
64 Ga0097621_100201639 3300006237 Bacteria 1727
65 Ga0097621_100240351 3300006237 Bacteria 1583
66 Ga0068871_100021021 3300006358 Bacteria 5009
67 Ga0068871_100357137 3300006358 Bacteria 1294
68 Ga0068865_100092579 3300006881 Bacteria 2196
69 Ga0068865_100127404 3300006881 Bacteria 1902
70 Ga0097620_100127003 3300006931 Bacteria 2620
71 Ga0099795_10055729 3300007788 Bacteria 1452
72 Ga0105240_10035951 3300009093 Bacteria 6377
73 Ga0105240_10066430 3300009093 Bacteria 4474
74 Ga0105240_10585767 3300009093 Bacteria 1230
75 Ga0105245_10196344 3300009098 Bacteria 1936
76 Ga0105243_10000522 3300009148 Bacteria 39134
77 Ga0105241_10103879 3300009174 Bacteria 2263
78 Ga0105241_10178035 3300009174 Bacteria 1762
79 Ga0105242_10003128 3300009176 Bacteria 12914
80 Ga0105237_10013586 3300009545 Bacteria 8531
81 Ga0105237_10413131 3300009545 Bacteria 1354
82 Ga0105238_10002826 3300009551 Bacteria 17322
83 Ga0105238_10109904 3300009551 Bacteria 2738
84 Ga0105238_10151303 3300009551 Unclassified 2296
85 Ga0105238_10430296 3300009551 Bacteria 1315
86 Ga0105249_10238135 3300009553 Bacteria 1798
87 Ga0099796_10036579 3300010159 Bacteria 1636
88 Ga0105239_10005063 3300010375 Bacteria 15566
89 Ga0105239_10042423 3300010375 Bacteria 4986
90 Ga0105239_10733196 3300010375 Bacteria 1131
91 Ga0105246_10034328 3300011119 Bacteria 3379
92 Ga0105246_10106618 3300011119 Bacteria 2050
93 Ga0157371_10000094 3300013102 Bacteria 139074
94 Ga0157370_10015453 3300013104 Bacteria 7760
95 Ga0157369_10006981 3300013105 Bacteria 13024
96 Ga0157369_10012729 3300013105 Bacteria 9539
97 Ga0157378_10000736 3300013297 Bacteria 30581
98 Ga0163162_10076357 3300013306 Bacteria 3412
99 Ga0163162_10695901 3300013306 Unclassified 1138
100 Ga0157372_10000417 3300013307 Bacteria 46710
101 Ga0157372_10306025 3300013307 Bacteria 1849
102 Ga0157375_10060545 3300013308 Bacteria 3755
103 Ga0163163_10000175 3300014325 Bacteria 66869
104 Ga0163163_10300107 3300014325 Bacteria 1659
105 Ga0157379_10037331 3300014968 Bacteria 4331
106 Ga0157376_10006570 3300014969 Bacteria 8229
107 Ga0157376_10011487 3300014969 Bacteria 6531
108 Ga0157376_10301517 3300014969 Bacteria 1517
109 Ga0213875_10008100 3300021388 Bacteria 5398
110 Ga0209758_1000017 3300025297 Bacteria 754393
111 Ga0207656_10011057 3300025321 Bacteria 3400
112 Ga0207656_10083262 3300025321 Bacteria 1441
113 Ga0207680_10000139 3300025903 Bacteria 34616
114 Ga0207680_10287776 3300025903 Bacteria 1143
115 Ga0207647_10003579 3300025904 Bacteria 11646
116 Ga0207645_10039713 3300025907 Bacteria 3015
117 Ga0207705_10000655 3300025909 Bacteria 28861
118 Ga0207654_10005031 3300025911 Bacteria 6677
119 Ga0207654_10119808 3300025911 Bacteria 1651
120 Ga0207695_10000692 3300025913 Bacteria 66089
121 Ga0207695_10027131 3300025913 Bacteria 6380
122 Ga0207695_10069415 3300025913 Bacteria 3606
123 Ga0207695_10338473 3300025913 Bacteria 1393
124 Ga0207695_10467736 3300025913 Bacteria 1143
125 Ga0207671_10001877 3300025914 Bacteria 23362
126 Ga0207671_10023477 3300025914 Bacteria 4652
127 Ga0207671_10032751 3300025914 Bacteria 3867
128 Ga0207657_10008435 3300025919 Bacteria 10457
129 Ga0207657_10025174 3300025919 Bacteria 5492
130 Ga0207649_10000553 3300025920 Bacteria 25817
131 Ga0207649_10004306 3300025920 Bacteria 7738
132 Ga0207649_10077309 3300025920 Bacteria 2144
133 Ga0207646_10015749 3300025922 Bacteria 7123
134 Ga0207694_10005064 3300025924 Bacteria 10190
135 Ga0207694_10034702 3300025924 Unclassified 3869
136 Ga0207650_10041618 3300025925 Bacteria 3368
137 Ga0207659_10285470 3300025926 Bacteria 1351
138 Ga0207644_10149054 3300025931 Bacteria 1809
139 Ga0207690_10001659 3300025932 Bacteria 13758
140 Ga0207690_10248778 3300025932 Bacteria 1372
141 Ga0207690_10427912 3300025932 Bacteria 1060
142 Ga0207706_10125355 3300025933 Bacteria 2259
143 Ga0207686_10456710 3300025934 Unclassified 984
144 Ga0207709_10000109 3300025935 Bacteria 128086
145 Ga0207669_10000213 3300025937 Bacteria 26506
146 Ga0207669_10000967 3300025937 Bacteria 12162
147 Ga0207704_10048220 3300025938 Bacteria 2552
148 Ga0207704_10108941 3300025938 Unclassified 1867
149 Ga0207691_10042497 3300025940 Bacteria 4190
150 Ga0207689_10015567 3300025942 Bacteria 6441
151 Ga0207679_10252629 3300025945 Bacteria 1500
152 Ga0207667_10000006 3300025949 Bacteria 679876
153 Ga0207667_10006840 3300025949 Bacteria 13781
154 Ga0207667_10013447 3300025949 Bacteria 9366
155 Ga0207651_10019761 3300025960 Bacteria 4047
156 Ga0207651_10051546 3300025960 Bacteria 2801
157 Ga0207658_10037170 3300025986 Bacteria 3496
158 Ga0207658_10109754 3300025986 Bacteria 2179
159 Ga0207677_10075073 3300026023 Bacteria 2401
160 Ga0207677_10128120 3300026023 Bacteria 1922
161 Ga0207639_10006539 3300026041 Bacteria 7927
162 Ga0207639_10015475 3300026041 Bacteria 5384
163 Ga0207639_10018796 3300026041 Bacteria 4916
164 Ga0207639_10086222 3300026041 Bacteria 2499
165 Ga0207702_10012487 3300026078 Bacteria 7065
166 Ga0207702_10023866 3300026078 Bacteria 5073
167 Ga0207702_10055310 3300026078 Bacteria 3365
168 Ga0207641_10004315 3300026088 Bacteria 12349
169 Ga0207641_10209328 3300026088 Bacteria 1803
170 Ga0207641_10217224 3300026088 Bacteria 1771
171 Ga0207648_10023862 3300026089 Bacteria 5470
172 Ga0207648_10036670 3300026089 Bacteria 4319
173 Ga0207676_10047450 3300026095 Bacteria 3329
174 Ga0207674_10008574 3300026116 Bacteria 11784
175 Ga0207674_10012512 3300026116 Bacteria 9480
176 Ga0207683_10003408 3300026121 Bacteria 13838
177 Ga0207683_10007931 3300026121 Bacteria 9087
178 Ga0207683_10036014 3300026121 Bacteria 4306
179 Ga0207683_10037524 3300026121 Bacteria 4220
180 Ga0207683_10075126 3300026121 Unclassified 2991
181 Ga0207698_10290645 3300026142 Bacteria 1517
182 Ga0268266_10000002 3300028379 Bacteria 3059047
183 Ga0268266_10246943 3300028379 Bacteria 1649
184 Ga0268264_10364328 3300028381 Bacteria 1380
185 Ga0268264_10391625 3300028381 Bacteria 1333
186 Ga0265331_10042800 3300031250 Bacteria 2196
187 Ga0307508_10000025 3300031616 Bacteria 174642
188 Ga0265314_10013542 3300031711 Bacteria 6582
189 Ga0307516_10026709 3300031730 Bacteria 5861
190 Ga0373924_0029417 3300035410 Bacteria 2196
191 Ga0373927_0003483 3300035695 Bacteria 11270
192 Ga0373947_0025776 3300035725 Bacteria 3429
193 Ga0373937_0120937 3300036401 Bacteria 2440
194 Ga0436364_0265405 3300037853 Bacteria 5292
195 Ga0436364_1385004 3300037853 Bacteria 9389
196 Ga0436360_1126993 3300039438 Bacteria 1335
197 Ga0451577_0453145 3300042876 Bacteria 1165
198 Ga0466963_0077020 3300044694 Bacteria 2253
199 Ga0466958_0291216 3300045836 Bacteria 1047
200 Ga0466967_0000406 3300045976 Bacteria 20285
201 Ga0466967_0034037 3300045976 Bacteria 4319
202 Ga0466967_0215359 3300045976 Bacteria 1823
203 Ga0466967_0218030 3300045976 Bacteria 1812
204 Ga0495603_0047828 3300046455 Bacteria 2547
205 Ga0495603_0341286 3300046455 Bacteria 859
206 Ga0495629_0050504 3300046459 Bacteria 2912
207 Ga0495638_0000351 3300046460 Bacteria 57664
208 Ga0495638_0001296 3300046460 Bacteria 23258
209 Ga0495650_0000007 3300046471 Bacteria 718072
210 Ga0495650_0000367 3300046471 Bacteria 78952
211 Ga0495580_0029818 3300046472 Bacteria 3957
212 Ga0495582_0015492 3300046473 Bacteria 4188
213 Ga0495639_0047174 3300046475 Unclassified 1951
214 Ga0495664_0154538 3300046477 Unclassified 1392
215 Ga0495585_0001593 3300046492 Bacteria 17538
216 Ga0495585_0126243 3300046492 Bacteria 1350
217 Ga0495585_0177860 3300046492 Bacteria 1095
218 Ga0495583_0000024 3300046506 Bacteria 274122
219 Ga0495583_0001012 3300046506 Bacteria 32120
220 Ga0495583_0006253 3300046506 Bacteria 7833
221 Ga0495606_0005968 3300046507 Bacteria 11425
222 Ga0495606_0031482 3300046507 Bacteria 3687
223 Ga0495610_0000029 3300046512 Bacteria 271137
224 Ga0495616_0068613 3300046513 Bacteria 1721
225 Ga0495618_0149858 3300046514 Bacteria 1490
226 Ga0495631_0039800 3300046518 Bacteria 2084
227 Ga0495631_0065287 3300046518 Bacteria 1575
228 Ga0495637_0041147 3300046520 Bacteria 1985
229 Ga0495643_0000571 3300046522 Bacteria 45536
230 Ga0495648_0000433 3300046524 Bacteria 45500
231 Ga0495648_0086922 3300046524 Bacteria 1762
232 Ga0495663_0000108 3300046525 Bacteria 34182
233 Ga0495642_0004861 3300046528 Bacteria 5193
234 Ga0495652_0033963 3300046529 Bacteria 4448
235 Ga0495654_0000116 3300046530 Bacteria 90109
236 Ga0495640_0022191 3300046533 Bacteria 4645
237 Ga0495587_0043333 3300046536 Bacteria 2680
238 Ga0495587_0230959 3300046536 Bacteria 1042
239 Ga0495622_0000002 3300046557 Bacteria 321742
240 Ga0495622_0013695 3300046557 Bacteria 3760
241 Ga0495633_0010229 3300046558 Bacteria 5132
242 Ga0495656_0016039 3300046615 Bacteria 2838
243 Ga0495634_0031069 3300046642 Bacteria 3681
244 Ga0495625_0001280 3300046660 Bacteria 31552
245 Ga0495625_0002841 3300046660 Bacteria 18199
246 Ga0495625_0004615 3300046660 Bacteria 12951
247 Ga0495625_0007110 3300046660 Bacteria 9830
248 Ga0495625_0015695 3300046660 Bacteria 5984
249 Ga0495625_0020183 3300046660 Bacteria 5150
250 Ga0495625_0049122 3300046660 Bacteria 3034
251 Ga0495635_0099702 3300046663 Bacteria 1985
252 Ga0495659_0006120 3300046664 Bacteria 3804
253 Ga0495661_0062694 3300046665 Bacteria 2201
254 Ga0495646_0024331 3300046680 Bacteria 3814
255 Ga0495647_0083981 3300046681 Unclassified 1295
256 Ga0495658_0001293 3300046683 Bacteria 13116
257 Ga0495669_0000118 3300046684 Bacteria 51189
258 Ga0495613_0063461 3300046689 Bacteria 2703
259 Ga0495613_0193032 3300046689 Bacteria 1439
260 Ga0495649_0023373 3300046694 Bacteria 3454
261 Ga0495600_0001046 3300046809 Bacteria 14984
262 Ga0495660_0019152 3300046810 Bacteria 3930
263 Ga0495604_0029025 3300047317 Bacteria 4402
264 Ga0495604_0041999 3300047317 Bacteria 3585
265 Ga0495674_0009532 3300047319 Bacteria 9223
266 Ga0495672_0003601 3300047320 Bacteria 13159
267 Ga0495676_0227960 3300047321 Bacteria 1281
268 Ga0495683_0001364 3300047323 Bacteria 16234
269 Ga0495687_000347 3300047443 Bacteria 59340
270 Ga0495687_000499 3300047443 Bacteria 47300
271 Ga0495675_0117665 3300047444 Bacteria 1656
272 Ga0495677_0003123 3300047445 Bacteria 6455
273 Ga0495681_0000644 3300047470 Bacteria 26581
274 Ga0495686_0001633 3300047472 Bacteria 23415
275 Ga0495686_0004265 3300047472 Bacteria 11855
276 Ga0495686_0037079 3300047472 Bacteria 3126
277 Ga0496100_0333985 3300048903 Bacteria 1141
278 Ga0496101_0349216 3300048904 Bacteria 1162
279 Ga0496102_0000086 3300048905 Bacteria 132217
280 Ga0496103_0000266 3300048906 Bacteria 50137
281 Ga0496104_0000005 3300048907 Bacteria 620360
282 Ga0496104_0228968 3300048907 Bacteria 1771
283 Ga0496104_0434625 3300048907 Bacteria 1224
284 Ga0496105_0000018 3300048908 Bacteria 197208
285 Ga0496105_0004609 3300048908 Bacteria 10386
286 Ga0496105_0006788 3300048908 Bacteria 8801
287 Ga0496106_0026755 3300048909 Bacteria 4296
288 Ga0496107_0000089 3300048910 Bacteria 43926
289 Ga0496107_0131715 3300048910 Bacteria 1846
290 Ga0496108_0723188 3300048911 Bacteria 862
291 Ga0496109_0257911 3300048912 Bacteria 1642
292 Ga0496110_0003423 3300048913 Bacteria 12141
293 Ga0496111_0032010 3300048914 Bacteria 3748
294 Ga0496115_0000386 3300048918 Bacteria 36344
295 Ga0496115_0013071 3300048918 Bacteria 6269
296 Ga0496116_0002337 3300048919 Bacteria 20077
297 Ga0496117_0000175 3300048920 Bacteria 132363
298 Ga0496118_0002277 3300048921 Bacteria 26191
299 Ga0496118_0105232 3300048921 Bacteria 1892
300 Ga0496119_0002311 3300048922 Bacteria 21031
301 Ga0496119_0065373 3300048922 Bacteria 2154
302 Ga0496120_0007786 3300048923 Bacteria 7913
303 Ga0496121_0000854 3300048924 Bacteria 55170
304 Ga0496121_0001017 3300048924 Bacteria 50104
305 Ga0496121_0021007 3300048924 Bacteria 6422
306 Ga0496122_0009078 3300048925 Bacteria 10547
307 Ga0496123_0077607 3300048926 Bacteria 2039
308 Ga0496124_0000831 3300048927 Bacteria 50314
309 Ga0496125_0002174 3300048928 Bacteria 26196
310 Ga0496126_0000204 3300048929 Bacteria 132495
311 Ga0496126_0015908 3300048929 Bacteria 7553
312 Ga0496126_0017785 3300048929 Bacteria 7077
313 Ga0501047_0224315 3300049581 Bacteria 1735
314 nmdc:mga0sz30_64976_c1 3300050516 Bacteria 1564
315 Ga0495601_0058515 3300053077 Bacteria 2442
316 Ga0500610_0000341 3300053079 Bacteria 14120
317 Ga0495595_0013989 3300053084 Bacteria 3396
318 Ga0495619_0021145 3300053085 Bacteria 4152
319 Ga0500643_036546 3300053087 Bacteria 1466
320 Ga0500595_008088 3300053119 Bacteria 4314
321 Ga0500595_024035 3300053119 Unclassified 2132
322 Ga0500616_0075547 3300053153 Bacteria 1705
323 Ga0500636_0001373 3300053177 Bacteria 13235
324 Ga0500645_000003 3300053730 Bacteria 305887
325 Ga0500596_000048 3300053735 Bacteria 16206
326 Ga0466962_0118555 3300061719 Bacteria 1276
327 2778126473 2775507255 Bacteria 3945731
328 2824662907 2824661429 Bacteria 9877870
329 2932793365 2932784394 Bacteria 9704911
330 2932817716 2932809354 Bacteria 9135765
331 2932827001 2932818245 Bacteria 9955613
332 2935761775 2935760218 Bacteria 9817913
333 2935814113 2935810662 Bacteria 9401221
334 2936001491 2935992306 Bacteria 9802711
335 2936039668 2936037263 Bacteria 9446081
336 Ga0495606_0000071
337 JGI24747J21853_1004659
338 JGI24737J22298_10000079
339 JGI24735J21928_10037428
340 JGI24742J22300_10005593
341 JGI25153J46596_10000007
342 Ga0070658_10000625
343 Ga0070690_100012126
344 Ga0068869_100245954
345 Ga0070666_10000198
346 Ga0070666_10019681
347 Ga0070680_100303456
348 Ga0070682_100344059
349 Ga0068868_100079538
350 Ga0070660_100117580
351 Ga0070660_100223625
352 Ga0070661_100000743
353 Ga0070661_100005891
354 Ga0070661_100412257
355 Ga0070668_100017326
356 Ga0070669_100548240
357 Ga0070671_100098664
358 Ga0070674_100000678
359 Ga0070674_100006758
360 Ga0070673_100048575
361 Ga0070673_100072820
362 Ga0070667_100007300
363 Ga0070667_100074512
364 Ga0070667_100105548
365 Ga0070714_100035218
366 Ga0070710_10245381
367 Ga0070711_100242036
368 Ga0070678_100000816
369 Ga0070662_100161124
370 Ga0068867_100026054
371 Ga0070699_100233575
372 Ga0070679_100127659
373 Ga0070684_100282210
374 Ga0070697_100126494
375 Ga0068853_100004731
376 Ga0068853_100151685
377 Ga0068853_100738752
378 Ga0070672_100028581
379 Ga0070665_100000044
380 Ga0070665_100036069
381 Ga0068855_100047883
382 Ga0068855_100586513
383 Ga0068856_100007448
384 Ga0068856_100034714
385 Ga0068852_100048098
386 Ga0068859_100127004
387 Ga0068864_100019956
388 Ga0068863_100002017
389 Ga0068863_100073714
390 Ga0068863_100793952
391 Ga0068858_100216082
392 Ga0068860_100000822
393 Ga0068860_100025832
394 Ga0070717_10203442
395 Ga0070712_100026397
396 Ga0075366_10012660
397 Ga0097621_100071991
398 Ga0097621_100172552
399 Ga0097621_100201639
400 Ga0097621_100240351
401 Ga0068871_100021021
402 Ga0068871_100357137
403 Ga0068865_100092579
404 Ga0068865_100127404
405 Ga0097620_100127003
406 Ga0099795_10055729
407 Ga0105240_10035951
408 Ga0105240_10066430
409 Ga0105240_10585767
410 Ga0105245_10196344
411 Ga0105243_10000522
412 Ga0105241_10103879
413 Ga0105241_10178035
414 Ga0105242_10003128
415 Ga0105237_10013586
416 Ga0105237_10413131
417 Ga0105238_10002826
418 Ga0105238_10109904
419 Ga0105238_10151303
420 Ga0105238_10430296
421 Ga0105249_10238135
422 Ga0099796_10036579
423 Ga0105239_10005063
424 Ga0105239_10042423
425 Ga0105239_10733196
426 Ga0105246_10034328
427 Ga0105246_10106618
428 Ga0157371_10000094
429 Ga0157370_10015453
430 Ga0157369_10006981
431 Ga0157369_10012729
432 Ga0157378_10000736
433 Ga0163162_10076357
434 Ga0163162_10695901
435 Ga0157372_10000417
436 Ga0157372_10306025
437 Ga0157375_10060545
438 Ga0163163_10000175
439 Ga0163163_10300107
440 Ga0157379_10037331
441 Ga0157376_10006570
442 Ga0157376_10011487
443 Ga0157376_10301517
444 Ga0213875_10008100
445 Ga0209758_1000017
446 Ga0207656_10011057
447 Ga0207656_10083262
448 Ga0207680_10000139
449 Ga0207680_10287776
450 Ga0207647_10003579
451 Ga0207645_10039713
452 Ga0207705_10000655
453 Ga0207654_10005031
454 Ga0207654_10119808
455 Ga0207695_10000692
456 Ga0207695_10027131
457 Ga0207695_10069415
458 Ga0207695_10338473
459 Ga0207695_10467736
460 Ga0207671_10001877
461 Ga0207671_10023477
462 Ga0207671_10032751
463 Ga0207657_10008435
464 Ga0207657_10025174
465 Ga0207649_10000553
466 Ga0207649_10004306
467 Ga0207649_10077309
468 Ga0207646_10015749
469 Ga0207694_10005064
470 Ga0207694_10034702
471 Ga0207650_10041618
472 Ga0207659_10285470
473 Ga0207644_10149054
474 Ga0207690_10001659
475 Ga0207690_10248778
476 Ga0207690_10427912
477 Ga0207706_10125355
478 Ga0207686_10456710
479 Ga0207709_10000109
480 Ga0207669_10000213
481 Ga0207669_10000967
482 Ga0207704_10048220
483 Ga0207704_10108941
484 Ga0207691_10042497
485 Ga0207689_10015567
486 Ga0207679_10252629
487 Ga0207667_10000006
488 Ga0207667_10006840
489 Ga0207667_10013447
490 Ga0207651_10019761
491 Ga0207651_10051546
492 Ga0207658_10037170
493 Ga0207658_10109754
494 Ga0207677_10075073
495 Ga0207677_10128120
496 Ga0207639_10006539
497 Ga0207639_10015475
498 Ga0207639_10018796
499 Ga0207639_10086222
500 Ga0207702_10012487
501 Ga0207702_10023866
502 Ga0207702_10055310
503 Ga0207641_10004315
504 Ga0207641_10209328
505 Ga0207641_10217224
506 Ga0207648_10023862
507 Ga0207648_10036670
508 Ga0207676_10047450
509 Ga0207674_10008574
510 Ga0207674_10012512
511 Ga0207683_10003408
512 Ga0207683_10007931
513 Ga0207683_10036014
514 Ga0207683_10037524
515 Ga0207683_10075126
516 Ga0207698_10290645
517 Ga0268266_10000002
518 Ga0268266_10246943
519 Ga0268264_10364328
520 Ga0268264_10391625
521 Ga0265331_10042800
522 Ga0307508_10000025
523 Ga0265314_10013542
524 Ga0307516_10026709
525 Ga0373924_0029417
526 Ga0373927_0003483
527 Ga0373947_0025776
528 Ga0373937_0120937
529 Ga0436364_0265405
530 Ga0436364_1385004
531 Ga0436360_1126993
532 Ga0451577_0453145
533 Ga0466963_0077020
534 Ga0466958_0291216
535 Ga0466967_0000406
536 Ga0466967_0034037
537 Ga0466967_0215359
538 Ga0466967_0218030
539 Ga0495603_0047828
540 Ga0495603_0341286
541 Ga0495629_0050504
542 Ga0495638_0000351
543 Ga0495638_0001296
544 Ga0495650_0000007
545 Ga0495650_0000367
546 Ga0495580_0029818
547 Ga0495582_0015492
548 Ga0495639_0047174
549 Ga0495664_0154538
550 Ga0495585_0001593
551 Ga0495585_0126243
552 Ga0495585_0177860
553 Ga0495583_0000024
554 Ga0495583_0001012
555 Ga0495583_0006253
556 Ga0495606_0005968
557 Ga0495606_0031482
558 Ga0495610_0000029
559 Ga0495616_0068613
560 Ga0495618_0149858
561 Ga0495631_0039800
562 Ga0495631_0065287
563 Ga0495637_0041147
564 Ga0495643_0000571
565 Ga0495648_0000433
566 Ga0495648_0086922
567 Ga0495663_0000108
568 Ga0495642_0004861
569 Ga0495652_0033963
570 Ga0495654_0000116
571 Ga0495640_0022191
572 Ga0495587_0043333
573 Ga0495587_0230959
574 Ga0495622_0000002
575 Ga0495622_0013695
576 Ga0495633_0010229
577 Ga0495656_0016039
578 Ga0495634_0031069
579 Ga0495625_0001280
580 Ga0495625_0002841
581 Ga0495625_0004615
582 Ga0495625_0007110
583 Ga0495625_0015695
584 Ga0495625_0020183
585 Ga0495625_0049122
586 Ga0495635_0099702
587 Ga0495659_0006120
588 Ga0495661_0062694
589 Ga0495646_0024331
590 Ga0495647_0083981
591 Ga0495658_0001293
592 Ga0495669_0000118
593 Ga0495613_0063461
594 Ga0495613_0193032
595 Ga0495649_0023373
596 Ga0495600_0001046
597 Ga0495660_0019152
598 Ga0495604_0029025
599 Ga0495604_0041999
600 Ga0495674_0009532
601 Ga0495672_0003601
602 Ga0495676_0227960
603 Ga0495683_0001364
604 Ga0495687_000347
605 Ga0495687_000499
606 Ga0495675_0117665
607 Ga0495677_0003123
608 Ga0495681_0000644
609 Ga0495686_0001633
610 Ga0495686_0004265
611 Ga0495686_0037079
612 Ga0496100_0333985
613 Ga0496101_0349216
614 Ga0496102_0000086
615 Ga0496103_0000266
616 Ga0496104_0000005
617 Ga0496104_0228968
618 Ga0496104_0434625
619 Ga0496105_0000018
620 Ga0496105_0004609
621 Ga0496105_0006788
622 Ga0496106_0026755
623 Ga0496107_0000089
624 Ga0496107_0131715
625 Ga0496108_0723188
626 Ga0496109_0257911
627 Ga0496110_0003423
628 Ga0496111_0032010
629 Ga0496115_0000386
630 Ga0496115_0013071
631 Ga0496116_0002337
632 Ga0496117_0000175
633 Ga0496118_0002277
634 Ga0496118_0105232
635 Ga0496119_0002311
636 Ga0496119_0065373
637 Ga0496120_0007786
638 Ga0496121_0000854
639 Ga0496121_0001017
640 Ga0496121_0021007
641 Ga0496122_0009078
642 Ga0496123_0077607
643 Ga0496124_0000831
644 Ga0496125_0002174
645 Ga0496126_0000204
646 Ga0496126_0015908
647 Ga0496126_0017785
648 Ga0501047_0224315
649 nmdc:mga0sz30_64976_c1
650 Ga0495601_0058515
651 Ga0500610_0000341
652 Ga0495595_0013989
653 Ga0495619_0021145
654 Ga0500643_036546
655 Ga0500595_008088
656 Ga0500595_024035
657 Ga0500616_0075547
658 Ga0500636_0001373
659 Ga0500645_000003
660 Ga0500596_000048
661 Ga0466962_0118555
662 2778126473
663 2824662907
664 2932793365
665 2932817716
666 2932827001
667 2935761775
668 2935814113
669 2936001491
670 2936039668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

130

233

0.8

PF17124

ThiJ_like

ThiJ/PfpI family-like

58

262

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qws-assembly1.cif.gz_A structure of the d181n variant of catalase hpii from e. coli 0.901 2 152
6jqq-assembly1.cif.gz_C kate h392c from escherichia coli 0.9 2 154
1p81-assembly1.cif.gz_A crystal structure of the d181e variant of catalase hpii from e. coli 0.8991 2 154
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.8987 1 283
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.8935 1 283
ID Description Score Start End Superfamily
1sy7B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8868 2 156 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8835 2 282 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8753 2 283 3.40.50.880
af_Q58377_26_203_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8685 2 282 3.40.50.880
4bflA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8495 2 161 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V9HQL5-F1-model_v4 ThiJ/pfpI-family protein 0.9984 1 133
AF-A0A7V8HLG4-F1-model_v4 deleted 0.9967 1 283
AF-A0A7V8HLG4-F1-model_v4 deleted 0.9932 1 283
AF-A0A1E3SBI1-F1-model_v4 ThiJ/pfpI-family protein 0.993 1 282
AF-A0A1E3SBI1-F1-model_v4 ThiJ/pfpI-family protein 0.986 1 282

Map