F412317

General Info

Members Datasets Scaffolds Average Seq Length
335 179 334 402

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0018293|Ga0373924_0018293_391_1578
Length 395
Sequence MIRRVIIVAAWLLFLIASANADAAFQQWLQALWPQAHELGVTRATFDAGIRGLEPNYALPDLALPGRPEKQPQQPEFVQTPAQYLREPTFQRLAAQGKKFAEQYRDTLARIEKEFGVPGNVVLAIWARETDYGSERQPNDALQVLATQAYVGKRKDFFRNEFLRALKMLQDGVPRANLRSSWGGAMGLTQFLPSEYYKYAVDFDGDGKADIWHSAAKQLKDKGWQAGKPWAIEVRVPASVDCTVAEPSHVLPVVEWLKRGYIPAYGQRLTKTELAADASLLLPEGTYGPAFLTPKNYYVIKEYNYSDLYVLFVGHLADLIGGGRPFEHPWSKNAQLHTKDVESMQQRLTSLGLYSDKLDGKAGMLTRAALGAYQKKNGLKVDCWPTAAVLDHMRR

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
67 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 0
Rhizoplane 1.19
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003150 3300003215 Bacteria 9301
2 Ga0070658_10014169 3300005327 Bacteria 6399
3 Ga0070658_10034113 3300005327 Bacteria 4094
4 Ga0070682_100087360 3300005337 Bacteria 2032
5 Ga0070660_100014053 3300005339 Bacteria 5762
6 Ga0070660_100053125 3300005339 Bacteria 3124
7 Ga0070714_100012498 3300005435 Bacteria 6781
8 Ga0070714_100119330 3300005435 Bacteria 2344
9 Ga0070713_100023217 3300005436 Bacteria 4808
10 Ga0070711_100025869 3300005439 Bacteria 3841
11 Ga0070711_100131551 3300005439 Bacteria 1864
12 Ga0070663_100085008 3300005455 Bacteria 2334
13 Ga0070681_10005456 3300005458 Bacteria 12287
14 Ga0070681_10183526 3300005458 Bacteria 2013
15 Ga0070679_100014281 3300005530 Bacteria 7626
16 Ga0070672_100092724 3300005543 Bacteria 2439
17 Ga0070693_100028409 3300005547 Bacteria 3040
18 Ga0068855_100069510 3300005563 Bacteria 4098
19 Ga0068855_100269746 3300005563 Bacteria 1892
20 Ga0068852_100035436 3300005616 Bacteria 4163
21 Ga0068852_100065368 3300005616 Bacteria 3173
22 Ga0068852_100069574 3300005616 Bacteria 3086
23 Ga0075368_10060168 3300006042 Bacteria 1521
24 Ga0070712_100209042 3300006175 Bacteria 1538
25 Ga0075366_10001418 3300006195 Bacteria 11954
26 Ga0075436_100010557 3300006914 Bacteria 6334
27 Ga0099795_10022867 3300007788 Bacteria 2068
28 Ga0105240_10028482 3300009093 Bacteria 7296
29 Ga0105245_10008091 3300009098 Bacteria 9197
30 Ga0105248_10069786 3300009177 Bacteria 3946
31 Ga0105237_10066911 3300009545 Bacteria 3587
32 Ga0105238_10031412 3300009551 Bacteria 5406
33 Ga0105238_10220754 3300009551 Bacteria 1872
34 Ga0099796_10005703 3300010159 Bacteria 3125
35 Ga0157370_10037024 3300013104 Bacteria 4733
36 Ga0157370_10088858 3300013104 Bacteria 2902
37 Ga0157369_10194580 3300013105 Bacteria 2130
38 Ga0157374_10109159 3300013296 Bacteria 2660
39 Ga0163163_10138653 3300014325 Bacteria 2474
40 Ga0213876_10005857 3300021384 Bacteria 6728
41 Ga0213875_10000040 3300021388 Bacteria 156362
42 Ga0209233_1012512 3300025261 Bacteria 2460
43 Ga0209758_1000157 3300025297 Bacteria 156173
44 Ga0207699_10036069 3300025906 Bacteria 2817
45 Ga0207699_10127226 3300025906 Bacteria 1656
46 Ga0207705_10011941 3300025909 Bacteria 6275
47 Ga0207705_10088940 3300025909 Bacteria 2259
48 Ga0207707_10097048 3300025912 Bacteria 2575
49 Ga0207707_10099298 3300025912 Bacteria 2544
50 Ga0207707_10101913 3300025912 Bacteria 2509
51 Ga0207695_10110229 3300025913 Bacteria 2733
52 Ga0207693_10020415 3300025915 Bacteria 5269
53 Ga0207693_10118170 3300025915 Bacteria 2082
54 Ga0207663_10089880 3300025916 Bacteria 2035
55 Ga0207657_10043632 3300025919 Bacteria 3948
56 Ga0207657_10092433 3300025919 Bacteria 2521
57 Ga0207652_10243052 3300025921 Bacteria 1623
58 Ga0207694_10102051 3300025924 Bacteria 2274
59 Ga0207687_10095556 3300025927 Bacteria 2177
60 Ga0207664_10137865 3300025929 Bacteria 2060
61 Ga0207690_10052128 3300025932 Bacteria 2739
62 Ga0207669_10007932 3300025937 Bacteria 4952
63 Ga0207691_10098145 3300025940 Bacteria 2617
64 Ga0207711_10046454 3300025941 Bacteria 3710
65 Ga0207667_10022607 3300025949 Bacteria 6940
66 Ga0207667_10212232 3300025949 Bacteria 1984
67 Ga0207703_10028442 3300026035 Bacteria 4406
68 Ga0207678_10059716 3300026067 Bacteria 3281
69 Ga0207698_10032016 3300026142 Bacteria 3805
70 Ga0207698_10095989 3300026142 Bacteria 2442
71 Ga0265337_1000084 3300028556 Bacteria 45523
72 Ga0265338_10047284 3300028800 Bacteria 3931
73 Ga0265325_10000030 3300031241 Bacteria 103532
74 Ga0265325_10003464 3300031241 Bacteria 10294
75 Ga0265325_10015931 3300031241 Bacteria 4212
76 Ga0265325_10038966 3300031241 Bacteria 2505
77 Ga0265340_10008087 3300031247 Bacteria 5692
78 Ga0265339_10060791 3300031249 Bacteria 2035
79 Ga0265331_10018632 3300031250 Bacteria 3595
80 Ga0265331_10041225 3300031250 Bacteria 2244
81 Ga0265316_10028270 3300031344 Bacteria 4628
82 Ga0265316_10070498 3300031344 Bacteria 2696
83 Ga0265313_10001306 3300031595 Bacteria 23513
84 Ga0265313_10007394 3300031595 Bacteria 7524
85 Ga0265313_10023239 3300031595 Bacteria 3344
86 Ga0265313_10045163 3300031595 Bacteria 2146
87 Ga0265314_10007261 3300031711 Bacteria 9627
88 Ga0265314_10046111 3300031711 Bacteria 3077
89 Ga0265314_10048063 3300031711 Bacteria 2997
90 Ga0265342_10000085 3300031712 Bacteria 100652
91 Ga0265342_10001600 3300031712 Bacteria 20914
92 Ga0265342_10008071 3300031712 Bacteria 7610
93 Ga0373944_0000642 3300035089 Bacteria 8312
94 Ga0373923_0000033 3300035111 Bacteria 20803
95 Ga0373923_0007234 3300035111 Bacteria 3893
96 Ga0373923_0042319 3300035111 Bacteria 1881
97 Ga0373936_0000211 3300035113 Bacteria 19242
98 Ga0373939_0012500 3300035114 Bacteria 2166
99 Ga0373941_0033652 3300035115 Bacteria 1542
100 Ga0373945_0001430 3300035116 Bacteria 7267
101 Ga0373945_0040535 3300035116 Bacteria 1681
102 Ga0373953_0037010 3300035117 Bacteria 1924
103 Ga0373954_0004866 3300035118 Bacteria 5796
104 Ga0373956_0002854 3300035119 Bacteria 6995
105 Ga0373956_0027611 3300035119 Bacteria 2466
106 Ga0373957_0005936 3300035120 Bacteria 3819
107 Ga0373957_0016427 3300035120 Bacteria 2561
108 Ga0373943_0001244 3300035170 Bacteria 11400
109 Ga0373943_0013100 3300035170 Bacteria 3741
110 Ga0373946_0001753 3300035171 Bacteria 7571
111 Ga0373946_0003371 3300035171 Bacteria 5669
112 Ga0373955_0057767 3300035172 Bacteria 2132
113 Ga0373955_0057966 3300035172 Bacteria 2129
114 Ga0373924_0003604 3300035410 Bacteria 5340
115 Ga0373924_0008621 3300035410 Bacteria 3713
116 Ga0373924_0018293 3300035410 Bacteria 2698
117 Ga0373935_0000812 3300035692 Bacteria 16745
118 Ga0373927_0009694 3300035695 Bacteria 6458
119 Ga0373927_0018900 3300035695 Bacteria 4521
120 Ga0373933_0001256 3300035724 Bacteria 14975
121 Ga0373933_0002157 3300035724 Bacteria 11275
122 Ga0373933_0070052 3300035724 Bacteria 2133
123 Ga0373947_0000529 3300035725 Bacteria 22292
124 Ga0373947_0012067 3300035725 Bacteria 4947
125 Ga0373937_0002841 3300036401 Bacteria 14468
126 Ga0373937_0003021 3300036401 Bacteria 14107
127 Ga0373925_0000058 3300037068 Bacteria 122682
128 Ga0373925_0044582 3300037068 Bacteria 3293
129 Ga0395899_0020151 3300037312 Bacteria 5060
130 Ga0395900_0004449 3300037418 Bacteria 14845
131 Ga0395900_0017512 3300037418 Bacteria 7311
132 Ga0436364_0004209 3300037853 Bacteria 23852
133 Ga0395901_0013941 3300038443 Bacteria 8181
134 Ga0395901_0030445 3300038443 Bacteria 5560
135 Ga0436365_0506780 3300039437 Bacteria 2288
136 Ga0436363_1633966 3300039450 Bacteria 1443
137 Ga0466966_0039779 3300044684 Bacteria 3027
138 Ga0466963_0020365 3300044694 Bacteria 4171
139 Ga0466967_0006432 3300045976 Bacteria 8310
140 Ga0495592_0000298 3300046454 Bacteria 42312
141 Ga0495592_0011392 3300046454 Bacteria 6728
142 Ga0495603_0073628 3300046455 Bacteria 2006
143 Ga0495651_0004236 3300046462 Bacteria 10994
144 Ga0495651_0023609 3300046462 Bacteria 4781
145 Ga0495651_0025672 3300046462 Bacteria 4588
146 Ga0495651_0038871 3300046462 Bacteria 3705
147 Ga0495653_0000259 3300046463 Bacteria 42610
148 Ga0495653_0023787 3300046463 Bacteria 4945
149 Ga0495653_0121599 3300046463 Bacteria 1860
150 Ga0495580_0039004 3300046472 Bacteria 3399
151 Ga0495582_0034457 3300046473 Bacteria 2782
152 Ga0495582_0110695 3300046473 Bacteria 1542
153 Ga0495639_0032612 3300046475 Bacteria 2323
154 Ga0495662_0015386 3300046476 Bacteria 3715
155 Ga0495664_0000009 3300046477 Bacteria 289534
156 Ga0495594_0012894 3300046499 Bacteria 4359
157 Ga0495607_0013045 3300046501 Bacteria 5463
158 Ga0495608_0000199 3300046511 Bacteria 42582
159 Ga0495608_0009359 3300046511 Bacteria 6850
160 Ga0495608_0010401 3300046511 Bacteria 6494
161 Ga0495608_0152123 3300046511 Bacteria 1474
162 Ga0495618_0000203 3300046514 Bacteria 42631
163 Ga0495628_0000012 3300046516 Bacteria 224162
164 Ga0495630_0000655 3300046517 Bacteria 25028
165 Ga0495644_0000690 3300046523 Bacteria 13986
166 Ga0495652_0000587 3300046529 Bacteria 42494
167 Ga0495652_0005594 3300046529 Bacteria 11799
168 Ga0495652_0061188 3300046529 Bacteria 3179
169 Ga0495640_0001482 3300046533 Bacteria 18474
170 Ga0495640_0112669 3300046533 Bacteria 1776
171 Ga0495587_0000033 3300046536 Bacteria 123885
172 Ga0495587_0010027 3300046536 Bacteria 6050
173 Ga0495587_0021959 3300046536 Bacteria 3934
174 Ga0495587_0058755 3300046536 Bacteria 2259
175 Ga0495645_0000017 3300046543 Bacteria 156865
176 Ga0495645_0015631 3300046543 Bacteria 5399
177 Ga0495622_0002604 3300046557 Bacteria 8699
178 Ga0495667_0000179 3300046559 Bacteria 42848
179 Ga0495667_0007133 3300046559 Bacteria 7578
180 Ga0495667_0011116 3300046559 Bacteria 6089
181 Ga0495667_0061484 3300046559 Bacteria 2462
182 Ga0495656_0001316 3300046615 Bacteria 8082
183 Ga0495634_0000407 3300046642 Bacteria 42447
184 Ga0495634_0134097 3300046642 Bacteria 1576
185 Ga0495611_0011604 3300046648 Bacteria 3737
186 Ga0495635_0000019 3300046663 Bacteria 193402
187 Ga0495635_0017411 3300046663 Bacteria 5019
188 Ga0495635_0021215 3300046663 Bacteria 4528
189 Ga0495635_0100662 3300046663 Bacteria 1975
190 Ga0495659_0001281 3300046664 Bacteria 8649
191 Ga0495588_0025102 3300046674 Bacteria 2966
192 Ga0495657_0000349 3300046675 Bacteria 42782
193 Ga0495657_0022669 3300046675 Bacteria 4494
194 Ga0495657_0076555 3300046675 Bacteria 2172
195 Ga0495599_0000024 3300046678 Bacteria 121388
196 Ga0495599_0014586 3300046678 Bacteria 4866
197 Ga0495623_0000540 3300046679 Bacteria 25144
198 Ga0495646_0000095 3300046680 Bacteria 43349
199 Ga0495647_0012811 3300046681 Bacteria 2892
200 Ga0495613_0013297 3300046689 Bacteria 6115
201 Ga0495613_0013647 3300046689 Bacteria 6028
202 Ga0495613_0135653 3300046689 Bacteria 1761
203 Ga0495670_0010873 3300046691 Bacteria 4473
204 Ga0495600_0000129 3300046809 Bacteria 42502
205 Ga0495600_0000464 3300046809 Bacteria 21076
206 Ga0495600_0005501 3300046809 Bacteria 7644
207 Ga0495600_0079843 3300046809 Bacteria 2136
208 Ga0495604_0000330 3300047317 Bacteria 42446
209 Ga0495604_0002437 3300047317 Bacteria 14887
210 Ga0495604_0003490 3300047317 Bacteria 12534
211 Ga0495604_0028845 3300047317 Bacteria 4416
212 Ga0495604_0063717 3300047317 Bacteria 2811
213 Ga0495674_0000015 3300047319 Bacteria 224071
214 Ga0495676_0075121 3300047321 Bacteria 2585
215 Ga0495680_0001651 3300047322 Bacteria 23706
216 Ga0495680_0006325 3300047322 Bacteria 11023
217 Ga0495680_0006657 3300047322 Bacteria 10698
218 Ga0495680_0030424 3300047322 Bacteria 4408
219 Ga0495675_0000858 3300047444 Bacteria 18544
220 Ga0495675_0010846 3300047444 Bacteria 5711
221 Ga0495684_0000249 3300047471 Bacteria 42567
222 Ga0495684_0007097 3300047471 Bacteria 8695
223 Ga0495593_0006064 3300047673 Bacteria 7110
224 Ga0495593_0015818 3300047673 Bacteria 4263
225 Ga0495602_0000358 3300048088 Bacteria 42545
226 Ga0495602_0000791 3300048088 Bacteria 30188
227 Ga0496104_0000065 3300048907 Bacteria 108770
228 Ga0496105_0000530 3300048908 Bacteria 25203
229 Ga0496115_0069911 3300048918 Bacteria 2845
230 Ga0496115_0111980 3300048918 Bacteria 2242
231 Ga0501031_0007887 3300049568 Bacteria 6930
232 Ga0501031_0044132 3300049568 Bacteria 2909
233 Ga0501032_0009959 3300049569 Bacteria 6862
234 Ga0501032_0036813 3300049569 Bacteria 3339
235 Ga0501032_0129226 3300049569 Bacteria 1667
236 Ga0501032_0141803 3300049569 Bacteria 1582
237 Ga0501033_0014579 3300049570 Bacteria 5967
238 Ga0501034_0000295 3300049571 Bacteria 88435
239 Ga0501034_0006275 3300049571 Bacteria 12792
240 Ga0501034_0045831 3300049571 Bacteria 4417
241 Ga0501034_0116194 3300049571 Bacteria 2664
242 Ga0501034_0127821 3300049571 Bacteria 2526
243 Ga0501034_0204616 3300049571 Bacteria 1930
244 Ga0501036_0000331 3300049572 Bacteria 33074
245 Ga0501036_0005712 3300049572 Bacteria 10093
246 Ga0501036_0054254 3300049572 Bacteria 3394
247 Ga0501036_0068036 3300049572 Bacteria 3013
248 Ga0501037_0008940 3300049573 Bacteria 7341
249 Ga0501037_0187690 3300049573 Bacteria 1464
250 Ga0501038_0025151 3300049574 Bacteria 5308
251 Ga0501038_0176823 3300049574 Bacteria 1724
252 Ga0501039_0006421 3300049575 Bacteria 8932
253 Ga0501039_0006690 3300049575 Bacteria 8765
254 Ga0501039_0033176 3300049575 Bacteria 3982
255 Ga0501043_0004168 3300049579 Bacteria 11814
256 Ga0501043_0031774 3300049579 Bacteria 4151
257 Ga0501043_0032263 3300049579 Bacteria 4118
258 Ga0501046_0000775 3300049580 Bacteria 30863
259 Ga0501046_0114573 3300049580 Bacteria 2056
260 Ga0501047_0000382 3300049581 Bacteria 49844
261 Ga0501047_0017754 3300049581 Bacteria 6817
262 Ga0501047_0041324 3300049581 Bacteria 4456
263 Ga0501047_0045145 3300049581 Bacteria 4259
264 Ga0501047_0063809 3300049581 Bacteria 3553
265 Ga0501047_0066395 3300049581 Bacteria 3477
266 Ga0501048_0000031 3300049582 Bacteria 65561
267 Ga0501048_0000978 3300049582 Bacteria 21174
268 Ga0501067_0120370 3300049583 Bacteria 1460
269 Ga0501067_0134688 3300049583 Bacteria 1375
270 Ga0501068_0030438 3300049584 Bacteria 3202
271 Ga0501069_0072014 3300049585 Bacteria 1937
272 Ga0501070_0005736 3300049586 Bacteria 10585
273 Ga0501070_0006610 3300049586 Bacteria 9867
274 Ga0501070_0016193 3300049586 Bacteria 6265
275 Ga0501070_0033906 3300049586 Bacteria 4271
276 Ga0501070_0063376 3300049586 Bacteria 3062
277 Ga0501070_0192188 3300049586 Bacteria 1677
278 Ga0501070_0198900 3300049586 Bacteria 1646
279 Ga0501071_0224426 3300049587 Bacteria 1414
280 Ga0501072_0044001 3300049588 Bacteria 3511
281 Ga0501072_0050258 3300049588 Bacteria 3283
282 Ga0501073_0046302 3300049589 Bacteria 3059
283 Ga0501073_0078319 3300049589 Bacteria 2300
284 Ga0501073_0090828 3300049589 Bacteria 2122
285 Ga0501073_0100671 3300049589 Bacteria 2006
286 Ga0501074_0003074 3300049590 Bacteria 11773
287 Ga0501074_0003327 3300049590 Bacteria 11380
288 Ga0501074_0047630 3300049590 Bacteria 3098
289 Ga0501074_0087488 3300049590 Bacteria 2231
290 Ga0501080_0000478 3300049742 Bacteria 31148
291 Ga0501080_0020521 3300049742 Bacteria 6118
292 Ga0501080_0026761 3300049742 Bacteria 5360
293 Ga0501080_0057659 3300049742 Bacteria 3616
294 Ga0501080_0108044 3300049742 Bacteria 2579
295 Ga0501083_0003656 3300049744 Bacteria 10792
296 Ga0501035_0003860 3300049822 Bacteria 14291
297 Ga0501035_0004642 3300049822 Bacteria 13031
298 Ga0501035_0038845 3300049822 Bacteria 4309
299 Ga0501035_0108152 3300049822 Bacteria 2438
300 Ga0501035_0123574 3300049822 Bacteria 2260
301 Ga0501044_0031259 3300049823 Bacteria 5604
302 Ga0501044_0050681 3300049823 Bacteria 4282
303 Ga0501044_0108792 3300049823 Bacteria 2781
304 Ga0501044_0119592 3300049823 Bacteria 2636
305 Ga0501044_0297293 3300049823 Bacteria 1544
306 Ga0501045_0202021 3300049824 Bacteria 1481
307 nmdc:mga03683_32099_c1 3300050489 Bacteria 2111
308 nmdc:mga07m45_107658_c1 3300050496 Bacteria 1604
309 nmdc:mga0n895_7034_c1 3300050512 Bacteria 9611
310 Ga0495601_0000024 3300053077 Bacteria 133160
311 Ga0495601_0000152 3300053077 Bacteria 38651
312 Ga0495601_0011631 3300053077 Bacteria 5272
313 Ga0495601_0168190 3300053077 Bacteria 1432
314 Ga0495612_0000190 3300053078 Bacteria 26158
315 Ga0495612_0001026 3300053078 Bacteria 11463
316 Ga0495595_0000089 3300053084 Bacteria 42657
317 Ga0495595_0000594 3300053084 Bacteria 13801
318 Ga0495595_0001920 3300053084 Bacteria 8066
319 Ga0495595_0025041 3300053084 Bacteria 2639
320 Ga0495619_0000034 3300053085 Bacteria 129851
321 Ga0495619_0006285 3300053085 Bacteria 7536
322 Ga0495619_0006433 3300053085 Bacteria 7441
323 Ga0495619_0009317 3300053085 Bacteria 6197
324 Ga0500643_003290 3300053087 Bacteria 7851
325 Ga0500651_0003359 3300053093 Bacteria 8741
326 Ga0500641_0060973 3300053096 Bacteria 1570
327 Ga0500595_000003 3300053119 Bacteria 419332
328 Ga0500616_0000002 3300053153 Bacteria 1611257
329 Ga0500616_0057470 3300053153 Bacteria 2027
330 Ga0500645_002675 3300053730 Bacteria 7758
331 Ga0501084_0051340 3300054114 Bacteria 3451
332 Ga0501084_0086297 3300054114 Bacteria 2635
333 Ga0501082_0014673 3300060353 Bacteria 6751
334 Ga0501082_0072710 3300060353 Bacteria 2962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0116194 Ga0501034_0116194_1445_2653 351
2 3300005339 Ga0070660_100053125 Ga0070660_1000531253 353
3 3300005616 Ga0068852_100065368 Ga0068852_1000653684 353
4 3300025909 Ga0207705_10011941 Ga0207705_100119416 353
5 3300025932 Ga0207690_10052128 Ga0207690_100521282 353
6 3300026142 Ga0207698_10095989 Ga0207698_100959893 353
7 3300031595 Ga0265313_10007394 Ga0265313_100073944 353
8 3300031712 Ga0265342_10001600 Ga0265342_1000160021 353
9 3300049581 Ga0501047_0063809 Ga0501047_0063809_1361_2569 353
10 3300009545 Ga0105237_10066911 Ga0105237_100669112 364
11 3300048918 Ga0496115_0111980 Ga0496115_0111980_793_1989 364
12 3300025919 Ga0207657_10092433 Ga0207657_100924333 366
13 3300026067 Ga0207678_10059716 Ga0207678_100597164 366
14 3300031344 Ga0265316_10028270 Ga0265316_100282705 367
15 3300025921 Ga0207652_10243052 Ga0207652_102430521 372
16 3300013296 Ga0157374_10109159 Ga0157374_101091593 373
17 3300035115 Ga0373941_0033652 Ga0373941_0033652_190_1410 373
18 3300025912 Ga0207707_10099298 Ga0207707_100992982 374
19 3300025915 Ga0207693_10020415 Ga0207693_100204156 374
20 3300005435 Ga0070714_100119330 Ga0070714_1001193302 375
21 3300005458 Ga0070681_10183526 Ga0070681_101835261 382
22 3300025906 Ga0207699_10127226 Ga0207699_101272261 382
23 3300006914 Ga0075436_100010557 Ga0075436_1000105576 385
24 3300035111 Ga0373923_0000033 Ga0373923_0000033_9125_10363 385
25 3300035113 Ga0373936_0000211 Ga0373936_0000211_9026_10264 385
26 3300035116 Ga0373945_0040535 Ga0373945_0040535_206_1444 385
27 3300035170 Ga0373943_0001244 Ga0373943_0001244_1021_2259 385
28 3300035171 Ga0373946_0003371 Ga0373946_0003371_4092_5330 385
29 3300035172 Ga0373955_0057966 Ga0373955_0057966_366_1604 385
30 3300035410 Ga0373924_0008621 Ga0373924_0008621_104_1342 385
31 3300035692 Ga0373935_0000812 Ga0373935_0000812_606_1844 385
32 3300035695 Ga0373927_0009694 Ga0373927_0009694_4251_5489 385
33 3300035724 Ga0373933_0001256 Ga0373933_0001256_8514_9752 385
34 3300035725 Ga0373947_0000529 Ga0373947_0000529_12041_13279 385
35 3300036401 Ga0373937_0002841 Ga0373937_0002841_4155_5393 385
36 3300037068 Ga0373925_0000058 Ga0373925_0000058_9328_10566 385
37 3300046454 Ga0495592_0000298 Ga0495592_0000298_32161_33399 385
38 3300046462 Ga0495651_0004236 Ga0495651_0004236_8489_9727 385
39 3300046463 Ga0495653_0000259 Ga0495653_0000259_9099_10337 385
40 3300046473 Ga0495582_0110695 Ga0495582_0110695_67_1305 385
41 3300046477 Ga0495664_0000009 Ga0495664_0000009_279242_280480 385
42 3300046511 Ga0495608_0000199 Ga0495608_0000199_32221_33459 385
43 3300046514 Ga0495618_0000203 Ga0495618_0000203_32266_33504 385
44 3300046516 Ga0495628_0000012 Ga0495628_0000012_9157_10395 385
45 3300046517 Ga0495630_0000655 Ga0495630_0000655_8847_10085 385
46 3300046529 Ga0495652_0000587 Ga0495652_0000587_9037_10275 385
47 3300046533 Ga0495640_0001482 Ga0495640_0001482_9009_10247 385
48 3300046536 Ga0495587_0000033 Ga0495587_0000033_113580_114818 385
49 3300046543 Ga0495645_0000017 Ga0495645_0000017_21292_22530 385
50 3300046559 Ga0495667_0000179 Ga0495667_0000179_32228_33466 385
51 3300046642 Ga0495634_0000407 Ga0495634_0000407_8987_10225 385
52 3300046663 Ga0495635_0000019 Ga0495635_0000019_61416_62654 385
53 3300046675 Ga0495657_0000349 Ga0495657_0000349_32250_33488 385
54 3300046678 Ga0495599_0000024 Ga0495599_0000024_8992_10230 385
55 3300046679 Ga0495623_0000540 Ga0495623_0000540_14930_16168 385
56 3300046680 Ga0495646_0000095 Ga0495646_0000095_9873_11111 385
57 3300046689 Ga0495613_0013297 Ga0495613_0013297_764_2002 385
58 3300046809 Ga0495600_0000129 Ga0495600_0000129_32289_33527 385
59 3300047317 Ga0495604_0000330 Ga0495604_0000330_9048_10286 385
60 3300047319 Ga0495674_0000015 Ga0495674_0000015_9172_10410 385
61 3300047322 Ga0495680_0001651 Ga0495680_0001651_8994_10232 385
62 3300047444 Ga0495675_0000858 Ga0495675_0000858_6655_7893 385
63 3300047471 Ga0495684_0000249 Ga0495684_0000249_32228_33466 385
64 3300047673 Ga0495593_0006064 Ga0495593_0006064_5663_6901 385
65 3300048088 Ga0495602_0000358 Ga0495602_0000358_9039_10277 385
66 3300053077 Ga0495601_0000024 Ga0495601_0000024_21316_22554 385
67 3300053078 Ga0495612_0000190 Ga0495612_0000190_15955_17193 385
68 3300053084 Ga0495595_0000089 Ga0495595_0000089_32303_33541 385
69 3300053085 Ga0495619_0000034 Ga0495619_0000034_9132_10370 385
70 3300035410 Ga0373924_0018293 Ga0373924_0018293_391_1578 390
71 3300035724 Ga0373933_0070052 Ga0373933_0070052_946_2121 391
72 3300037312 Ga0395899_0020151 Ga0395899_0020151_120_1325 391
73 3300037418 Ga0395900_0004449 Ga0395900_0004449_5723_6928 391
74 3300038443 Ga0395901_0013941 Ga0395901_0013941_6549_7754 391
75 3300005327 Ga0070658_10014169 Ga0070658_100141697 392
76 3300053153 Ga0500616_0000002 Ga0500616_0000002_1512514_1513737 392
77 3300035114 Ga0373939_0012500 Ga0373939_0012500_522_1718 393
78 3300049571 Ga0501034_0006275 Ga0501034_0006275_2575_3792 393
79 3300031595 Ga0265313_10001306 Ga0265313_1000130622 394
80 3300045976 Ga0466967_0006432 Ga0466967_0006432_6133_7458 394
81 3300049568 Ga0501031_0044132 Ga0501031_0044132_261_1460 394
82 3300049569 Ga0501032_0036813 Ga0501032_0036813_1495_2694 394
83 3300049569 Ga0501032_0129226 Ga0501032_0129226_139_1338 394
84 3300049571 Ga0501034_0000295 Ga0501034_0000295_61566_62765 394
85 3300049571 Ga0501034_0045831 Ga0501034_0045831_239_1438 394
86 3300049572 Ga0501036_0000331 Ga0501036_0000331_28998_30197 394
87 3300049572 Ga0501036_0068036 Ga0501036_0068036_244_1443 394
88 3300049573 Ga0501037_0187690 Ga0501037_0187690_24_1223 394
89 3300049575 Ga0501039_0033176 Ga0501039_0033176_408_1607 394
90 3300049579 Ga0501043_0032263 Ga0501043_0032263_779_1978 394
91 3300049581 Ga0501047_0000382 Ga0501047_0000382_21482_22681 394
92 3300049581 Ga0501047_0066395 Ga0501047_0066395_177_1376 394
93 3300049582 Ga0501048_0000031 Ga0501048_0000031_52449_53648 394
94 3300049583 Ga0501067_0134688 Ga0501067_0134688_102_1301 394
95 3300049585 Ga0501069_0072014 Ga0501069_0072014_385_1584 394
96 3300049586 Ga0501070_0063376 Ga0501070_0063376_1084_2283 394
97 3300049587 Ga0501071_0224426 Ga0501071_0224426_81_1280 394
98 3300049589 Ga0501073_0046302 Ga0501073_0046302_285_1484 394
99 3300049590 Ga0501074_0003074 Ga0501074_0003074_255_1454 394
100 3300049742 Ga0501080_0000478 Ga0501080_0000478_24969_26168 394
101 3300049742 Ga0501080_0026761 Ga0501080_0026761_354_1553 394
102 3300049744 Ga0501083_0003656 Ga0501083_0003656_1296_2495 394
103 3300049822 Ga0501035_0123574 Ga0501035_0123574_823_2022 394
104 3300049824 Ga0501045_0202021 Ga0501045_0202021_259_1458 394
105 3300054114 Ga0501084_0086297 Ga0501084_0086297_1077_2276 394
106 3300005337 Ga0070682_100087360 Ga0070682_1000873602 395
107 3300005455 Ga0070663_100085008 Ga0070663_1000850082 395
108 3300049569 Ga0501032_0141803 Ga0501032_0141803_151_1353 395
109 3300049571 Ga0501034_0204616 Ga0501034_0204616_583_1785 395
110 3300049572 Ga0501036_0054254 Ga0501036_0054254_1505_2707 395
111 3300049573 Ga0501037_0008940 Ga0501037_0008940_6071_7273 395
112 3300049574 Ga0501038_0025151 Ga0501038_0025151_3950_5152 395
113 3300049579 Ga0501043_0004168 Ga0501043_0004168_5471_6673 395
114 3300049580 Ga0501046_0114573 Ga0501046_0114573_170_1372 395
115 3300049581 Ga0501047_0045145 Ga0501047_0045145_1667_2869 395
116 3300049589 Ga0501073_0078319 Ga0501073_0078319_912_2114 395
117 3300060353 Ga0501082_0072710 Ga0501082_0072710_669_1871 395
118 3300013104 Ga0157370_10037024 Ga0157370_100370242 396
119 3300049574 Ga0501038_0176823 Ga0501038_0176823_146_1345 396
120 3300049586 Ga0501070_0033906 Ga0501070_0033906_157_1356 396
121 3300049588 Ga0501072_0050258 Ga0501072_0050258_1191_2396 396
122 3300049822 Ga0501035_0038845 Ga0501035_0038845_238_1437 396
123 3300049823 Ga0501044_0119592 Ga0501044_0119592_956_2155 396
124 3300031247 Ga0265340_10008087 Ga0265340_100080872 397
125 3300031595 Ga0265313_10045163 Ga0265313_100451631 397
126 3300035111 Ga0373923_0042319 Ga0373923_0042319_436_1644 397
127 3300035117 Ga0373953_0037010 Ga0373953_0037010_443_1651 397
128 3300035119 Ga0373956_0002854 Ga0373956_0002854_5434_6642 397
129 3300035120 Ga0373957_0016427 Ga0373957_0016427_1138_2346 397
130 3300036401 Ga0373937_0003021 Ga0373937_0003021_3714_4922 397
131 3300046462 Ga0495651_0038871 Ga0495651_0038871_1213_2421 397
132 3300046463 Ga0495653_0121599 Ga0495653_0121599_299_1507 397
133 3300046511 Ga0495608_0152123 Ga0495608_0152123_233_1441 397
134 3300046536 Ga0495587_0058755 Ga0495587_0058755_715_1923 397
135 3300046559 Ga0495667_0007133 Ga0495667_0007133_4806_6014 397
136 3300046663 Ga0495635_0100662 Ga0495635_0100662_340_1548 397
137 3300046675 Ga0495657_0076555 Ga0495657_0076555_810_2018 397
138 3300046809 Ga0495600_0079843 Ga0495600_0079843_576_1784 397
139 3300047317 Ga0495604_0028845 Ga0495604_0028845_424_1632 397
140 3300047322 Ga0495680_0006325 Ga0495680_0006325_567_1775 397
141 3300049581 Ga0501047_0041324 Ga0501047_0041324_2590_3783 397
142 3300049586 Ga0501070_0005736 Ga0501070_0005736_6925_8118 397
143 3300049590 Ga0501074_0047630 Ga0501074_0047630_941_2134 397
144 3300049742 Ga0501080_0108044 Ga0501080_0108044_641_1834 397
145 3300049822 Ga0501035_0108152 Ga0501035_0108152_680_1873 397
146 3300049823 Ga0501044_0108792 Ga0501044_0108792_1577_2770 397
147 3300053077 Ga0495601_0011631 Ga0495601_0011631_236_1444 397
148 3300053084 Ga0495595_0001920 Ga0495595_0001920_6633_7841 397
149 3300053085 Ga0495619_0006285 Ga0495619_0006285_2349_3557 397
150 3300005436 Ga0070713_100023217 Ga0070713_1000232171 398
151 3300005439 Ga0070711_100025869 Ga0070711_1000258695 398
152 3300005563 Ga0068855_100269746 Ga0068855_1002697461 398
153 3300005616 Ga0068852_100069574 Ga0068852_1000695743 398
154 3300006175 Ga0070712_100209042 Ga0070712_1002090422 398
155 3300021384 Ga0213876_10005857 Ga0213876_100058572 398
156 3300025906 Ga0207699_10036069 Ga0207699_100360692 398
157 3300025915 Ga0207693_10118170 Ga0207693_101181702 398
158 3300028800 Ga0265338_10047284 Ga0265338_100472843 398
159 3300031241 Ga0265325_10000030 Ga0265325_10000030125 398
160 3300031241 Ga0265325_10003464 Ga0265325_100034649 398
161 3300031241 Ga0265325_10015931 Ga0265325_100159316 398
162 3300031249 Ga0265339_10060791 Ga0265339_100607911 398
163 3300031595 Ga0265313_10023239 Ga0265313_100232392 398
164 3300031712 Ga0265342_10008071 Ga0265342_1000807110 398
165 3300035118 Ga0373954_0004866 Ga0373954_0004866_3922_5133 398
166 3300035119 Ga0373956_0027611 Ga0373956_0027611_244_1455 398
167 3300035120 Ga0373957_0005936 Ga0373957_0005936_464_1675 398
168 3300035724 Ga0373933_0002157 Ga0373933_0002157_2482_3693 398
169 3300037068 Ga0373925_0044582 Ga0373925_0044582_1633_2844 398
170 3300039437 Ga0436365_0506780 Ga0436365_0506780_558_1760 398
171 3300039450 Ga0436363_1633966 Ga0436363_1633966_172_1374 398
172 3300046454 Ga0495592_0011392 Ga0495592_0011392_5325_6536 398
173 3300046462 Ga0495651_0025672 Ga0495651_0025672_58_1269 398
174 3300046511 Ga0495608_0009359 Ga0495608_0009359_2156_3367 398
175 3300046529 Ga0495652_0005594 Ga0495652_0005594_2818_4029 398
176 3300046533 Ga0495640_0112669 Ga0495640_0112669_89_1300 398
177 3300046536 Ga0495587_0010027 Ga0495587_0010027_1537_2748 398
178 3300046543 Ga0495645_0015631 Ga0495645_0015631_2026_3237 398
179 3300046559 Ga0495667_0061484 Ga0495667_0061484_108_1319 398
180 3300046663 Ga0495635_0021215 Ga0495635_0021215_59_1270 398
181 3300046675 Ga0495657_0022669 Ga0495657_0022669_2963_4174 398
182 3300046678 Ga0495599_0014586 Ga0495599_0014586_3253_4464 398
183 3300046809 Ga0495600_0000464 Ga0495600_0000464_11857_13068 398
184 3300047317 Ga0495604_0002437 Ga0495604_0002437_2421_3632 398
185 3300047322 Ga0495680_0030424 Ga0495680_0030424_1774_2985 398
186 3300047444 Ga0495675_0010846 Ga0495675_0010846_2966_4177 398
187 3300048088 Ga0495602_0000791 Ga0495602_0000791_28936_30147 398
188 3300048907 Ga0496104_0000065 Ga0496104_0000065_12969_14180 398
189 3300048908 Ga0496105_0000530 Ga0496105_0000530_10274_11485 398
190 3300048918 Ga0496115_0069911 Ga0496115_0069911_1430_2641 398
191 3300049586 Ga0501070_0016193 Ga0501070_0016193_2335_3534 398
192 3300049742 Ga0501080_0057659 Ga0501080_0057659_178_1377 398
193 3300049822 Ga0501035_0003860 Ga0501035_0003860_1968_3167 398
194 3300053077 Ga0495601_0000152 Ga0495601_0000152_36016_37227 398
195 3300053078 Ga0495612_0001026 Ga0495612_0001026_720_1931 398
196 3300053084 Ga0495595_0000594 Ga0495595_0000594_1424_2635 398
197 3300053085 Ga0495619_0006433 Ga0495619_0006433_1150_2361 398
198 3300005439 Ga0070711_100131551 Ga0070711_1001315512 399
199 3300005547 Ga0070693_100028409 Ga0070693_1000284091 399
200 3300025916 Ga0207663_10089880 Ga0207663_100898802 399
201 3300050496 nmdc:mga07m45_107658_c1 nmdc:mga07m45_107658_c1_101_1330 399
202 3300009093 Ga0105240_10028482 Ga0105240_100284825 400
203 3300013104 Ga0157370_10088858 Ga0157370_100888583 400
204 3300013105 Ga0157369_10194580 Ga0157369_101945801 400
205 3300021388 Ga0213875_10000040 Ga0213875_10000040132 400
206 3300025909 Ga0207705_10088940 Ga0207705_100889402 400
207 3300025912 Ga0207707_10097048 Ga0207707_100970481 400
208 3300025913 Ga0207695_10110229 Ga0207695_101102294 400
209 3300025949 Ga0207667_10212232 Ga0207667_102122321 400
210 3300037418 Ga0395900_0017512 Ga0395900_0017512_3700_4905 400
211 3300037853 Ga0436364_0004209 Ga0436364_0004209_9519_10742 400
212 3300038443 Ga0395901_0030445 Ga0395901_0030445_3869_5074 400
213 3300044684 Ga0466966_0039779 Ga0466966_0039779_1671_2876 400
214 3300044694 Ga0466963_0020365 Ga0466963_0020365_2780_3985 400
215 3300049568 Ga0501031_0007887 Ga0501031_0007887_4037_5284 400
216 3300049569 Ga0501032_0009959 Ga0501032_0009959_70_1317 400
217 3300049570 Ga0501033_0014579 Ga0501033_0014579_4182_5429 400
218 3300049571 Ga0501034_0127821 Ga0501034_0127821_1009_2265 400
219 3300049572 Ga0501036_0005712 Ga0501036_0005712_598_1863 400
220 3300049575 Ga0501039_0006421 Ga0501039_0006421_5848_7095 400
221 3300049575 Ga0501039_0006690 Ga0501039_0006690_1904_3169 400
222 3300049579 Ga0501043_0031774 Ga0501043_0031774_217_1464 400
223 3300049580 Ga0501046_0000775 Ga0501046_0000775_20236_21501 400
224 3300049581 Ga0501047_0017754 Ga0501047_0017754_4037_5284 400
225 3300049582 Ga0501048_0000978 Ga0501048_0000978_197_1462 400
226 3300049583 Ga0501067_0120370 Ga0501067_0120370_35_1291 400
227 3300049584 Ga0501068_0030438 Ga0501068_0030438_587_1834 400
228 3300049586 Ga0501070_0006610 Ga0501070_0006610_2420_3667 400
229 3300049586 Ga0501070_0192188 Ga0501070_0192188_73_1320 400
230 3300049586 Ga0501070_0198900 Ga0501070_0198900_203_1468 400
231 3300049588 Ga0501072_0044001 Ga0501072_0044001_2014_3270 400
232 3300049589 Ga0501073_0090828 Ga0501073_0090828_826_2082 400
233 3300049589 Ga0501073_0100671 Ga0501073_0100671_721_1986 400
234 3300049590 Ga0501074_0003327 Ga0501074_0003327_3398_4663 400
235 3300049590 Ga0501074_0087488 Ga0501074_0087488_932_2188 400
236 3300049742 Ga0501080_0020521 Ga0501080_0020521_1694_2959 400
237 3300049822 Ga0501035_0004642 Ga0501035_0004642_11092_12339 400
238 3300049823 Ga0501044_0031259 Ga0501044_0031259_176_1423 400
239 3300049823 Ga0501044_0050681 Ga0501044_0050681_1342_2598 400
240 3300049823 Ga0501044_0297293 Ga0501044_0297293_85_1350 400
241 3300054114 Ga0501084_0051340 Ga0501084_0051340_2100_3365 400
242 3300060353 Ga0501082_0014673 Ga0501082_0014673_1075_2340 400
243 3300005327 Ga0070658_10034113 Ga0070658_100341135 401
244 3300005435 Ga0070714_100012498 Ga0070714_1000124988 401
245 3300005563 Ga0068855_100069510 Ga0068855_1000695107 401
246 3300005616 Ga0068852_100035436 Ga0068852_1000354365 401
247 3300007788 Ga0099795_10022867 Ga0099795_100228673 401
248 3300009551 Ga0105238_10031412 Ga0105238_100314125 401
249 3300010159 Ga0099796_10005703 Ga0099796_100057032 401
250 3300025261 Ga0209233_1012512 Ga0209233_10125122 401
251 3300025929 Ga0207664_10137865 Ga0207664_101378651 401
252 3300025949 Ga0207667_10022607 Ga0207667_100226075 401
253 3300026142 Ga0207698_10032016 Ga0207698_100320165 401
254 3300028556 Ga0265337_1000084 Ga0265337_100008443 401
255 3300031241 Ga0265325_10038966 Ga0265325_100389663 401
256 3300031344 Ga0265316_10070498 Ga0265316_100704982 401
257 3300031711 Ga0265314_10007261 Ga0265314_100072615 401
258 3300031711 Ga0265314_10048063 Ga0265314_100480634 401
259 3300035089 Ga0373944_0000642 Ga0373944_0000642_856_2073 401
260 3300035111 Ga0373923_0007234 Ga0373923_0007234_1769_2986 401
261 3300035116 Ga0373945_0001430 Ga0373945_0001430_41_1258 401
262 3300035170 Ga0373943_0013100 Ga0373943_0013100_1742_2959 401
263 3300035171 Ga0373946_0001753 Ga0373946_0001753_6241_7458 401
264 3300035172 Ga0373955_0057767 Ga0373955_0057767_42_1259 401
265 3300035410 Ga0373924_0003604 Ga0373924_0003604_3082_4299 401
266 3300035695 Ga0373927_0018900 Ga0373927_0018900_1307_2524 401
267 3300035725 Ga0373947_0012067 Ga0373947_0012067_585_1802 401
268 3300046455 Ga0495603_0073628 Ga0495603_0073628_701_1918 401
269 3300046462 Ga0495651_0023609 Ga0495651_0023609_1523_2740 401
270 3300046463 Ga0495653_0023787 Ga0495653_0023787_3609_4826 401
271 3300046472 Ga0495580_0039004 Ga0495580_0039004_1543_2760 401
272 3300046473 Ga0495582_0034457 Ga0495582_0034457_1445_2662 401
273 3300046475 Ga0495639_0032612 Ga0495639_0032612_1012_2229 401
274 3300046476 Ga0495662_0015386 Ga0495662_0015386_1767_2984 401
275 3300046499 Ga0495594_0012894 Ga0495594_0012894_1892_3109 401
276 3300046501 Ga0495607_0013045 Ga0495607_0013045_2952_4169 401
277 3300046511 Ga0495608_0010401 Ga0495608_0010401_618_1835 401
278 3300046523 Ga0495644_0000690 Ga0495644_0000690_11399_12616 401
279 3300046529 Ga0495652_0061188 Ga0495652_0061188_941_2158 401
280 3300046536 Ga0495587_0021959 Ga0495587_0021959_2463_3680 401
281 3300046557 Ga0495622_0002604 Ga0495622_0002604_1872_3089 401
282 3300046559 Ga0495667_0011116 Ga0495667_0011116_1091_2308 401
283 3300046615 Ga0495656_0001316 Ga0495656_0001316_3558_4775 401
284 3300046642 Ga0495634_0134097 Ga0495634_0134097_239_1456 401
285 3300046648 Ga0495611_0011604 Ga0495611_0011604_1149_2366 401
286 3300046663 Ga0495635_0017411 Ga0495635_0017411_491_1708 401
287 3300046664 Ga0495659_0001281 Ga0495659_0001281_1049_2266 401
288 3300046674 Ga0495588_0025102 Ga0495588_0025102_941_2158 401
289 3300046681 Ga0495647_0012811 Ga0495647_0012811_1185_2402 401
290 3300046689 Ga0495613_0013647 Ga0495613_0013647_2400_3617 401
291 3300046689 Ga0495613_0135653 Ga0495613_0135653_399_1637 401
292 3300046691 Ga0495670_0010873 Ga0495670_0010873_3143_4360 401
293 3300046809 Ga0495600_0005501 Ga0495600_0005501_3252_4469 401
294 3300047317 Ga0495604_0003490 Ga0495604_0003490_8654_9871 401
295 3300047317 Ga0495604_0063717 Ga0495604_0063717_914_2152 401
296 3300047321 Ga0495676_0075121 Ga0495676_0075121_783_2000 401
297 3300047322 Ga0495680_0006657 Ga0495680_0006657_3430_4647 401
298 3300047471 Ga0495684_0007097 Ga0495684_0007097_1220_2437 401
299 3300047673 Ga0495593_0015818 Ga0495593_0015818_1068_2285 401
300 3300050489 nmdc:mga03683_32099_c1 nmdc:mga03683_32099_c1_843_2060 401
301 3300050512 nmdc:mga0n895_7034_c1 nmdc:mga0n895_7034_c1_209_1447 401
302 3300053077 Ga0495601_0168190 Ga0495601_0168190_95_1312 401
303 3300053084 Ga0495595_0025041 Ga0495595_0025041_239_1456 401
304 3300053085 Ga0495619_0009317 Ga0495619_0009317_4267_5484 401
305 3300053087 Ga0500643_003290 Ga0500643_003290_6356_7567 401
306 3300053093 Ga0500651_0003359 Ga0500651_0003359_7064_8287 401
307 3300053096 Ga0500641_0060973 Ga0500641_0060973_15_1280 401
308 3300053119 Ga0500595_000003 Ga0500595_000003_328551_329762 401
309 3300053730 Ga0500645_002675 Ga0500645_002675_2608_3831 401
310 iso_pu_bacteria 2643221547 2643754886 401
311 3300006042 Ga0075368_10060168 Ga0075368_100601681 402
312 3300031250 Ga0265331_10018632 Ga0265331_100186325 402
313 3300005339 Ga0070660_100014053 Ga0070660_1000140536 403
314 3300005458 Ga0070681_10005456 Ga0070681_100054563 403
315 3300005530 Ga0070679_100014281 Ga0070679_1000142816 403
316 3300025912 Ga0207707_10101913 Ga0207707_101019132 403
317 3300025919 Ga0207657_10043632 Ga0207657_100436324 403
318 3300053153 Ga0500616_0057470 Ga0500616_0057470_263_1495 403
319 3300005543 Ga0070672_100092724 Ga0070672_1000927242 404
320 3300009098 Ga0105245_10008091 Ga0105245_100080913 404
321 3300009177 Ga0105248_10069786 Ga0105248_100697864 404
322 3300009551 Ga0105238_10220754 Ga0105238_102207542 404
323 3300014325 Ga0163163_10138653 Ga0163163_101386532 404
324 3300025924 Ga0207694_10102051 Ga0207694_101020512 404
325 3300025927 Ga0207687_10095556 Ga0207687_100955561 404
326 3300025937 Ga0207669_10007932 Ga0207669_100079322 404
327 3300025940 Ga0207691_10098145 Ga0207691_100981453 404
328 3300025941 Ga0207711_10046454 Ga0207711_100464543 404
329 3300026035 Ga0207703_10028442 Ga0207703_100284423 404
330 3300031250 Ga0265331_10041225 Ga0265331_100412252 404
331 3300031711 Ga0265314_10046111 Ga0265314_100461112 404
332 3300031712 Ga0265342_10000085 Ga0265342_1000008537 404
333 3300003215 JGI25153J46596_10003150 JGI25153J46596_100031509 405
334 3300006195 Ga0075366_10001418 Ga0075366_100014183 405
335 3300025297 Ga0209758_1000157 Ga0209758_100015776 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13406

SLT_2

Transglycosylase SLT domain

24

318

0.97

PF01471

PG_binding_1

Putative peptidoglycan binding domain

337

393

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.9176 25 401
5ao7-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.9126 25 402
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.906 25 401
5ao7-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.9011 25 402
6tci-assembly1.cif.gz_A the crystal structure of sleb n-terminal domain 0.8942 349 404
ID Description Score Start End Superfamily
1l6jA01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.9419 348 402 1.10.101.10
af_I1N5Y3_46_297_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8581 347 399 3.40.390.10
af_Q94LQ4_46_318_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.854 349 400 3.40.390.10
af_K7K641_72_302_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8504 347 399 3.40.390.10
3bkvA01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.8492 347 403 1.10.101.10
ID Description Score Start End GO Terms
AF-A0A537V6F9-F1-model_v4 Lytic murein transglycosylase 0.989 91 404 GO:0008933
GO:0009253
AF-A0A6N6P3L4-F1-model_v4 Lytic murein transglycosylase 0.9784 250 402 GO:0008933
GO:0009253
AF-F7QRA9-F1-model_v4 Lytic murein transglycosylase 0.9748 14 405 GO:0008933
GO:0009253
AF-A0A3A0F6H7-F1-model_v4 Lytic murein transglycosylase 0.9744 14 404 GO:0008933
GO:0009253
AF-A5EPS5-F1-model_v4 deleted 0.974 17 405

Feature Viewer

pLDDT pTM Quality
91.78 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map