F412294

General Info

Members Datasets Scaffolds Average Seq Length
335 224 670 272

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10002536|Ga0265325_100025362
Length 317
Sequence MLRSRAKRGVSKHGAASSFETRPSPLLRMRRREVVDREGFALLSGMADVTANVIDAPAAPRAESRLHVLWRNAFPFIVVFGLWEIVARAGIFPPKLFPSLVTVAQALVDLTISGILPHHVFDTVLRLLAGFFLASVFGVALGILMGRSRRMEDVFLPLVSIMAPIPGLAYAPLFLLWFGLGNKSAVLLVAFVSSFSVIFNTWTGVKAVKEIWVRSAQAMGADDRRLFIKVIIPGALPYILTGLRLGLAQAWRILVGIEMLAAVPWGLGWMIFGAREFLNTDVMLAGVVVIGXXGLALEKLVFQKIEQYTVMRWGMLT

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 8.06
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10002536 3300031241 Bacteria 12296
2 JGI25153J46596_10003184 3300003215 Bacteria 9241
3 rootH2_10248175 3300003320 Bacteria 1121
4 JGI25405J52794_10002477 3300003911 Bacteria 3186
5 Ga0070676_10028118 3300005328 Bacteria 3193
6 Ga0070683_100108972 3300005329 Bacteria 2612
7 Ga0070690_100003116 3300005330 Bacteria 9025
8 Ga0070680_100021923 3300005336 Bacteria 5080
9 Ga0070689_100003399 3300005340 Bacteria 10580
10 Ga0070661_100235853 3300005344 Bacteria 1407
11 Ga0070669_100146238 3300005353 Bacteria 1827
12 Ga0070675_100045897 3300005354 Bacteria 3577
13 Ga0070674_100036693 3300005356 Bacteria 3292
14 Ga0070673_100078510 3300005364 Bacteria 2671
15 Ga0070688_100003863 3300005365 Bacteria 7770
16 Ga0070659_100360618 3300005366 Bacteria 1221
17 Ga0070709_10034437 3300005434 Bacteria 3070
18 Ga0070709_10216759 3300005434 Bacteria 1363
19 Ga0070714_100086200 3300005435 Bacteria 2744
20 Ga0070714_100145157 3300005435 Bacteria 2134
21 Ga0070714_100213284 3300005435 Bacteria 1771
22 Ga0070710_10055864 3300005437 Bacteria 2233
23 Ga0070711_100365020 3300005439 Bacteria 1164
24 Ga0070678_100305712 3300005456 Bacteria 1353
25 Ga0070662_100065940 3300005457 Bacteria 2655
26 Ga0070681_10090028 3300005458 Bacteria 3019
27 Ga0070681_10198211 3300005458 Bacteria 1926
28 Ga0070679_100023026 3300005530 Bacteria 6093
29 Ga0070679_100056408 3300005530 Bacteria 3914
30 Ga0070684_100673289 3300005535 Bacteria 964
31 Ga0068853_100101005 3300005539 Bacteria 2551
32 Ga0070686_100103076 3300005544 Bacteria 1931
33 Ga0070693_100006878 3300005547 Bacteria 5528
34 Ga0068855_100213453 3300005563 Bacteria 2167
35 Ga0070664_100230077 3300005564 Bacteria 1661
36 Ga0068857_100217852 3300005577 Bacteria 1743
37 Ga0068856_100189862 3300005614 Bacteria 2068
38 Ga0068856_100285637 3300005614 Bacteria 1667
39 Ga0068859_100037800 3300005617 Bacteria 4844
40 Ga0068864_100093083 3300005618 Bacteria 2662
41 Ga0068864_100474288 3300005618 Bacteria 1200
42 Ga0068861_100306532 3300005719 Bacteria 1377
43 Ga0068863_100251688 3300005841 Bacteria 1707
44 Ga0068863_100630614 3300005841 Bacteria 1062
45 Ga0068862_100168831 3300005844 Bacteria 1958
46 Ga0081455_10003284 3300005937 Bacteria 18715
47 Ga0081455_10363636 3300005937 Bacteria 1016
48 Ga0081538_10047804 3300005981 Bacteria 2619
49 Ga0081540_1002413 3300005983 Bacteria 15223
50 Ga0081540_1024424 3300005983 Bacteria 3507
51 Ga0081540_1027356 3300005983 Bacteria 3233
52 Ga0070717_10056934 3300006028 Bacteria 3231
53 Ga0075365_10203981 3300006038 Unclassified 1385
54 Ga0075432_10001490 3300006058 Bacteria 7644
55 Ga0070715_10006260 3300006163 Bacteria 4033
56 Ga0075369_10073630 3300006186 Bacteria 1506
57 Ga0075366_10297793 3300006195 Bacteria 987
58 Ga0075428_100007282 3300006844 Bacteria 12256
59 Ga0075428_100056127 3300006844 Bacteria 4315
60 Ga0075430_100000223 3300006846 Bacteria 39224
61 Ga0075430_100028858 3300006846 Bacteria 4711
62 Ga0075430_100066950 3300006846 Bacteria 3016
63 Ga0075430_100115881 3300006846 Bacteria 2233
64 Ga0075431_100001810 3300006847 Bacteria 20184
65 Ga0075431_100088072 3300006847 Bacteria 3204
66 Ga0075431_100120887 3300006847 Bacteria 2702
67 Ga0075433_10002034 3300006852 Bacteria 15272
68 Ga0075433_10125683 3300006852 Bacteria 2277
69 Ga0075433_10215742 3300006852 Unclassified 1705
70 Ga0075434_100042973 3300006871 Bacteria 4481
71 Ga0075434_100060322 3300006871 Bacteria 3773
72 Ga0075434_100274114 3300006871 Bacteria 1706
73 Ga0075434_100365546 3300006871 Bacteria 1464
74 Ga0075429_100006040 3300006880 Bacteria 10474
75 Ga0075429_100164457 3300006880 Bacteria 1944
76 Ga0068865_100400775 3300006881 Bacteria 1124
77 Ga0097620_100037803 3300006931 Bacteria 4844
78 Ga0075435_100008330 3300007076 Bacteria 7430
79 Ga0075435_100039209 3300007076 Bacteria 3780
80 Ga0075435_100166634 3300007076 Bacteria 1858
81 Ga0099794_10013385 3300007265 Bacteria 3570
82 Ga0105240_10071123 3300009093 Bacteria 4303
83 Ga0105240_10289087 3300009093 Bacteria 1880
84 Ga0111539_10004448 3300009094 Bacteria 18316
85 Ga0111539_10013539 3300009094 Bacteria 10195
86 Ga0111539_10044251 3300009094 Bacteria 5334
87 Ga0111539_10061746 3300009094 Bacteria 4439
88 Ga0111539_10214399 3300009094 Bacteria 2243
89 Ga0114129_10000742 3300009147 Bacteria 41451
90 Ga0114129_10011756 3300009147 Bacteria 12458
91 Ga0114129_10105879 3300009147 Bacteria 3886
92 Ga0114129_10115499 3300009147 Bacteria 3700
93 Ga0114129_10123209 3300009147 Bacteria 3566
94 Ga0114129_10314904 3300009147 Bacteria 2082
95 Ga0105238_10125728 3300009551 Bacteria 2543
96 Ga0105239_10503459 3300010375 Bacteria 1377
97 Ga0157370_10627426 3300013104 Bacteria 983
98 Ga0157369_10145241 3300013105 Bacteria 2509
99 Ga0157369_10220624 3300013105 Bacteria 1985
100 Ga0157372_10091294 3300013307 Bacteria 3464
101 Ga0163163_10044684 3300014325 Bacteria 4347
102 Ga0213872_10049199 3300021361 Bacteria 1915
103 Ga0209758_1001233 3300025297 Bacteria 31967
104 Ga0207697_10039973 3300025315 Bacteria 1925
105 Ga0207692_10007044 3300025898 Bacteria 4591
106 Ga0207692_10037445 3300025898 Bacteria 2372
107 Ga0207710_10056849 3300025900 Bacteria 1766
108 Ga0207699_10053272 3300025906 Bacteria 2398
109 Ga0207699_10201691 3300025906 Bacteria 1348
110 Ga0207645_10065470 3300025907 Bacteria 2323
111 Ga0207707_10059227 3300025912 Bacteria 3332
112 Ga0207693_10010718 3300025915 Bacteria 7439
113 Ga0207693_10035665 3300025915 Bacteria 3921
114 Ga0207693_10074770 3300025915 Bacteria 2653
115 Ga0207662_10006900 3300025918 Bacteria 6157
116 Ga0207657_10019458 3300025919 Bacteria 6446
117 Ga0207652_10050201 3300025921 Bacteria 3574
118 Ga0207652_10237764 3300025921 Bacteria 1642
119 Ga0207646_10255964 3300025922 Bacteria 1582
120 Ga0207681_10195887 3300025923 Bacteria 1549
121 Ga0207694_10160209 3300025924 Bacteria 1817
122 Ga0207650_10313168 3300025925 Bacteria 1284
123 Ga0207700_10034585 3300025928 Bacteria 3629
124 Ga0207700_10282265 3300025928 Bacteria 1429
125 Ga0207664_10098305 3300025929 Bacteria 2413
126 Ga0207664_10232383 3300025929 Bacteria 1603
127 Ga0207706_10026317 3300025933 Bacteria 5207
128 Ga0207669_10051596 3300025937 Bacteria 2465
129 Ga0207669_10124235 3300025937 Bacteria 1759
130 Ga0207665_10005513 3300025939 Bacteria 8442
131 Ga0207665_10052253 3300025939 Bacteria 2753
132 Ga0207691_10279984 3300025940 Bacteria 1435
133 Ga0207689_10046437 3300025942 Bacteria 3589
134 Ga0207667_10040115 3300025949 Bacteria 4985
135 Ga0207667_10174010 3300025949 Bacteria 2212
136 Ga0207667_10284057 3300025949 Bacteria 1691
137 Ga0207677_10241265 3300026023 Bacteria 1462
138 Ga0207702_10145190 3300026078 Bacteria 2152
139 Ga0207702_10197282 3300026078 Bacteria 1864
140 Ga0207641_10418082 3300026088 Bacteria 1290
141 Ga0207676_10047064 3300026095 Bacteria 3341
142 Ga0207676_10106197 3300026095 Bacteria 2339
143 Ga0207676_10169816 3300026095 Bacteria 1899
144 Ga0207674_10080241 3300026116 Bacteria 3266
145 Ga0207674_10191770 3300026116 Bacteria 1993
146 Ga0207675_100398388 3300026118 Bacteria 1356
147 Ga0207683_10103910 3300026121 Bacteria 2538
148 Ga0207428_10000172 3300027907 Bacteria 90200
149 Ga0207428_10013736 3300027907 Bacteria 7059
150 Ga0265357_1001449 3300028023 Bacteria 1742
151 Ga0268265_10129671 3300028380 Bacteria 2093
152 Ga0268264_10146205 3300028381 Bacteria 2114
153 Ga0265763_1004087 3300030763 Bacteria 1183
154 Ga0265330_10039488 3300031235 Bacteria 2097
155 Ga0265325_10013945 3300031241 Bacteria 4559
156 Ga0265340_10007715 3300031247 Bacteria 5836
157 Ga0265340_10011101 3300031247 Bacteria 4801
158 Ga0265339_10046940 3300031249 Bacteria 2372
159 Ga0265316_10189847 3300031344 Bacteria 1527
160 Ga0265313_10014690 3300031595 Bacteria 4610
161 Ga0265314_10007897 3300031711 Bacteria 9182
162 Ga0265342_10024497 3300031712 Bacteria 3809
163 Ga0307411_10283921 3300032005 Bacteria 1319
164 Ga0373950_0031509 3300034818 Bacteria 984
165 Ga0373944_0003519 3300035089 Bacteria 4048
166 Ga0373936_0066550 3300035113 Bacteria 1479
167 Ga0373939_0027526 3300035114 Bacteria 1611
168 Ga0373945_0058453 3300035116 Bacteria 1434
169 Ga0373943_0020151 3300035170 Bacteria 3072
170 Ga0373946_0012923 3300035171 Bacteria 3131
171 Ga0373961_0028263 3300035241 Bacteria 1545
172 Ga0373931_0009232 3300035691 Bacteria 4710
173 Ga0373935_0009944 3300035692 Bacteria 5700
174 Ga0373935_0230635 3300035692 Bacteria 1289
175 Ga0373927_0308915 3300035695 Bacteria 1041
176 Ga0373947_0351179 3300035725 Bacteria 989
177 Ga0373925_0043540 3300037068 Bacteria 3332
178 Ga0395899_0090758 3300037312 Bacteria 2215
179 Ga0395900_0022366 3300037418 Bacteria 6466
180 Ga0395900_0670721 3300037418 Bacteria 972
181 Ga0395898_0003941 3300037466 Bacteria 16375
182 Ga0395898_0024197 3300037466 Bacteria 6126
183 Ga0395898_0110844 3300037466 Bacteria 2630
184 Ga0436364_0412501 3300037853 Unclassified 1575
185 Ga0395901_0075175 3300038443 Bacteria 3524
186 Ga0395901_0171107 3300038443 Bacteria 2279
187 Ga0436365_0715620 3300039437 Bacteria 987
188 Ga0436365_1614912 3300039437 Bacteria 4311
189 Ga0436361_0561320 3300039447 Bacteria 6955
190 Ga0439456_039994 3300042013 Bacteria 1015
191 Ga0466967_0038904 3300045976 Bacteria 4083
192 Ga0495603_0050857 3300046455 Bacteria 2463
193 Ga0495629_0215245 3300046459 Bacteria 1326
194 Ga0495651_0065353 3300046462 Bacteria 2778
195 Ga0495580_0110402 3300046472 Bacteria 1910
196 Ga0495582_0032148 3300046473 Bacteria 2887
197 Ga0495584_0037617 3300046491 Bacteria 2447
198 Ga0495584_0088728 3300046491 Bacteria 1559
199 Ga0495585_0032994 3300046492 Bacteria 2933
200 Ga0495594_0051429 3300046499 Bacteria 2267
201 Ga0495616_0079554 3300046513 Bacteria 1571
202 Ga0495630_0188231 3300046517 Bacteria 1575
203 Ga0495637_0103395 3300046520 Bacteria 1111
204 Ga0495663_0021273 3300046525 Bacteria 1868
205 Ga0495666_0165719 3300046526 Bacteria 1023
206 Ga0495665_0136240 3300046531 Bacteria 1284
207 Ga0495609_0052449 3300046538 Bacteria 1815
208 Ga0495622_0114422 3300046557 Bacteria 1234
209 Ga0495656_0051896 3300046615 Bacteria 1757
210 Ga0495656_0055718 3300046615 Bacteria 1706
211 Ga0495634_0128106 3300046642 Bacteria 1620
212 Ga0495588_0025753 3300046674 Bacteria 2933
213 Ga0495647_0083375 3300046681 Bacteria 1299
214 Ga0495613_0092606 3300046689 Bacteria 2188
215 Ga0495613_0129919 3300046689 Bacteria 1804
216 Ga0495624_0031182 3300046690 Bacteria 3469
217 Ga0495670_0047900 3300046691 Bacteria 2137
218 Ga0495670_0134187 3300046691 Bacteria 1292
219 Ga0495671_0075119 3300046692 Bacteria 1658
220 Ga0495581_0320722 3300047315 Bacteria 905
221 Ga0495675_0129284 3300047444 Bacteria 1571
222 Ga0495677_0109398 3300047445 Bacteria 1050
223 Ga0495685_051105 3300047447 Bacteria 1402
224 Ga0495684_0282786 3300047471 Bacteria 1196
225 Ga0495602_0165344 3300048088 Bacteria 1723
226 Ga0495626_0062581 3300048091 Bacteria 1690
227 Ga0496100_0021550 3300048903 Bacteria 3883
228 Ga0496100_0109524 3300048903 Bacteria 1916
229 Ga0496100_0276961 3300048903 Bacteria 1249
230 Ga0496101_0051974 3300048904 Bacteria 2953
231 Ga0496101_0060493 3300048904 Bacteria 2748
232 Ga0496102_0047059 3300048905 Bacteria 3918
233 Ga0496102_0175344 3300048905 Bacteria 2019
234 Ga0496104_0018853 3300048907 Bacteria 6302
235 Ga0496104_0086618 3300048907 Bacteria 2990
236 Ga0496105_0004562 3300048908 Bacteria 10431
237 Ga0496106_0009344 3300048909 Bacteria 7247
238 Ga0496106_0050986 3300048909 Bacteria 3120
239 Ga0496107_0015050 3300048910 Bacteria 5419
240 Ga0496107_0022186 3300048910 Bacteria 4486
241 Ga0496108_0010045 3300048911 Bacteria 7677
242 Ga0496108_0054148 3300048911 Bacteria 3367
243 Ga0496109_0000340 3300048912 Bacteria 43565
244 Ga0496109_0165008 3300048912 Bacteria 2076
245 Ga0496110_0233776 3300048913 Bacteria 1672
246 Ga0496110_0484551 3300048913 Bacteria 1127
247 Ga0496111_0007077 3300048914 Bacteria 7329
248 Ga0496111_0108052 3300048914 Bacteria 2049
249 Ga0496112_0006271 3300048915 Bacteria 10427
250 Ga0496113_0000463 3300048916 Bacteria 19814
251 Ga0496114_0021314 3300048917 Bacteria 5271
252 Ga0496114_0081951 3300048917 Bacteria 2726
253 Ga0496115_0095403 3300048918 Bacteria 2434
254 Ga0501032_0019959 3300049569 Bacteria 4677
255 Ga0501033_0017940 3300049570 Bacteria 5343
256 Ga0501034_0006692 3300049571 Bacteria 12361
257 Ga0501037_0007895 3300049573 Bacteria 7797
258 Ga0501038_0073593 3300049574 Bacteria 2893
259 Ga0501039_0366054 3300049575 Bacteria 1132
260 Ga0501040_0073186 3300049576 Bacteria 2368
261 Ga0501042_0042852 3300049578 Bacteria 3222
262 Ga0501042_0140275 3300049578 Bacteria 1743
263 Ga0501043_0015891 3300049579 Bacteria 5900
264 Ga0501047_0161996 3300049581 Bacteria 2109
265 Ga0501048_0004440 3300049582 Bacteria 10687
266 Ga0501067_0018631 3300049583 Bacteria 3843
267 Ga0501068_0043146 3300049584 Bacteria 2713
268 Ga0501069_0013468 3300049585 Bacteria 4360
269 Ga0501070_0014654 3300049586 Bacteria 6597
270 Ga0501072_0106796 3300049588 Bacteria 2227
271 Ga0501072_0288131 3300049588 Bacteria 1306
272 Ga0501072_0389745 3300049588 Bacteria 1105
273 Ga0501073_0013043 3300049589 Bacteria 6061
274 Ga0501074_0016035 3300049590 Bacteria 5445
275 Ga0501075_0085345 3300049591 Bacteria 2392
276 Ga0501075_0311328 3300049591 Bacteria 1200
277 Ga0501076_0086410 3300049592 Bacteria 2521
278 Ga0501083_0026837 3300049744 Bacteria 3979
279 Ga0501083_0115125 3300049744 Bacteria 1766
280 Ga0501035_0073298 3300049822 Bacteria 3029
281 Ga0501044_0001312 3300049823 Bacteria 29308
282 Ga0501045_0097225 3300049824 Bacteria 2178
283 Ga0501045_0460954 3300049824 Bacteria 945
284 nmdc:mga03683_50923_c1 3300050489 Bacteria 1727
285 nmdc:mga00v17_162055_c1 3300050491 Bacteria 1440
286 nmdc:mga0yw44_268118_c1 3300050492 Bacteria 1139
287 nmdc:mga0yw44_60962_c1 3300050492 Bacteria 2313
288 nmdc:mga0k408_89590_c1 3300050493 Bacteria 1807
289 nmdc:mga06z11_220455_c1 3300050494 Bacteria 1108
290 nmdc:mga05p37_111833_c1 3300050507 Bacteria 3359
291 nmdc:mga05p37_1808_c2 3300050507 Bacteria 13333
292 nmdc:mga05p37_22036_c1 3300050507 Bacteria 7720
293 nmdc:mga05p37_472019_c1 3300050507 Bacteria 1447
294 nmdc:mga05p37_508_c2 3300050507 Bacteria 7955
295 nmdc:mga05p37_604447_c1 3300050507 Unclassified 1237
296 nmdc:mga05p37_750809_c1 3300050507 Bacteria 1075
297 nmdc:mga09592_19515_c1 3300050508 Bacteria 5568
298 nmdc:mga09592_97587_c1 3300050508 Bacteria 2515
299 nmdc:mga0qj67_210322_c1 3300050509 Bacteria 1580
300 nmdc:mga0qj67_52_c1 3300050509 Bacteria 84067
301 nmdc:mga0qj67_63707_c1 3300050509 Bacteria 2932
302 nmdc:mga06r32_142417_c1 3300050510 Bacteria 2374
303 nmdc:mga06r32_145092_c1 3300050510 Bacteria 2351
304 nmdc:mga06r32_1960_c1 3300050510 Bacteria 18367
305 nmdc:mga06r32_3441_c1 3300050510 Bacteria 14162
306 nmdc:mga06r32_59228_c1 3300050510 Bacteria 3682
307 nmdc:mga08y16_2332_c1 3300050511 Bacteria 19466
308 nmdc:mga08y16_3146_c1 3300050511 Bacteria 17090
309 nmdc:mga08y16_89125_c1 3300050511 Bacteria 3215
310 nmdc:mga0n895_165596_c1 3300050512 Bacteria 2242
311 nmdc:mga0n895_30075_c1 3300050512 Bacteria 5187
312 nmdc:mga0n895_375678_c1 3300050512 Bacteria 1439
313 nmdc:mga0n895_82513_c1 3300050512 Bacteria 3205
314 nmdc:mga0rr50_221594_c1 3300050513 Bacteria 1562
315 nmdc:mga0rr50_74434_c1 3300050513 Bacteria 2600
316 nmdc:mga08x19_181380_c1 3300050514 Bacteria 1437
317 nmdc:mga0a205_178763_c1 3300050515 Bacteria 2016
318 nmdc:mga0a205_2724_c1 3300050515 Bacteria 15622
319 nmdc:mga0a205_287506_c1 3300050515 Bacteria 1519
320 nmdc:mga0a205_446576_c1 3300050515 Bacteria 1154
321 Ga0495601_0056328 3300053077 Bacteria 2489
322 Ga0495612_0082250 3300053078 Bacteria 1354
323 Ga0495619_0010541 3300053085 Bacteria 5815
324 Ga0495619_0018993 3300053085 Bacteria 4366
325 Ga0495619_0105512 3300053085 Bacteria 1921
326 Ga0495619_0184870 3300053085 Bacteria 1442
327 Ga0500642_0031888 3300053130 Bacteria 2206
328 Ga0500658_0206157 3300053134 Bacteria 900
329 Ga0500616_0046790 3300053153 Bacteria 2299
330 Ga0500616_0110613 3300053153 Bacteria 1327
331 Ga0501084_0126436 3300054114 Bacteria 2151
332 Ga0590071_014618 3300059421 Bacteria 1842
333 Ga0501082_0027888 3300060353 Bacteria 4863
334 Ga0501082_0052297 3300060353 Bacteria 3521
335 Ga0501082_0098028 3300060353 Bacteria 2535
336 Ga0265325_10002536
337 JGI25153J46596_10003184
338 rootH2_10248175
339 JGI25405J52794_10002477
340 Ga0070676_10028118
341 Ga0070683_100108972
342 Ga0070690_100003116
343 Ga0070680_100021923
344 Ga0070689_100003399
345 Ga0070661_100235853
346 Ga0070669_100146238
347 Ga0070675_100045897
348 Ga0070674_100036693
349 Ga0070673_100078510
350 Ga0070688_100003863
351 Ga0070659_100360618
352 Ga0070709_10034437
353 Ga0070709_10216759
354 Ga0070714_100086200
355 Ga0070714_100145157
356 Ga0070714_100213284
357 Ga0070710_10055864
358 Ga0070711_100365020
359 Ga0070678_100305712
360 Ga0070662_100065940
361 Ga0070681_10090028
362 Ga0070681_10198211
363 Ga0070679_100023026
364 Ga0070679_100056408
365 Ga0070684_100673289
366 Ga0068853_100101005
367 Ga0070686_100103076
368 Ga0070693_100006878
369 Ga0068855_100213453
370 Ga0070664_100230077
371 Ga0068857_100217852
372 Ga0068856_100189862
373 Ga0068856_100285637
374 Ga0068859_100037800
375 Ga0068864_100093083
376 Ga0068864_100474288
377 Ga0068861_100306532
378 Ga0068863_100251688
379 Ga0068863_100630614
380 Ga0068862_100168831
381 Ga0081455_10003284
382 Ga0081455_10363636
383 Ga0081538_10047804
384 Ga0081540_1002413
385 Ga0081540_1024424
386 Ga0081540_1027356
387 Ga0070717_10056934
388 Ga0075365_10203981
389 Ga0075432_10001490
390 Ga0070715_10006260
391 Ga0075369_10073630
392 Ga0075366_10297793
393 Ga0075428_100007282
394 Ga0075428_100056127
395 Ga0075430_100000223
396 Ga0075430_100028858
397 Ga0075430_100066950
398 Ga0075430_100115881
399 Ga0075431_100001810
400 Ga0075431_100088072
401 Ga0075431_100120887
402 Ga0075433_10002034
403 Ga0075433_10125683
404 Ga0075433_10215742
405 Ga0075434_100042973
406 Ga0075434_100060322
407 Ga0075434_100274114
408 Ga0075434_100365546
409 Ga0075429_100006040
410 Ga0075429_100164457
411 Ga0068865_100400775
412 Ga0097620_100037803
413 Ga0075435_100008330
414 Ga0075435_100039209
415 Ga0075435_100166634
416 Ga0099794_10013385
417 Ga0105240_10071123
418 Ga0105240_10289087
419 Ga0111539_10004448
420 Ga0111539_10013539
421 Ga0111539_10044251
422 Ga0111539_10061746
423 Ga0111539_10214399
424 Ga0114129_10000742
425 Ga0114129_10011756
426 Ga0114129_10105879
427 Ga0114129_10115499
428 Ga0114129_10123209
429 Ga0114129_10314904
430 Ga0105238_10125728
431 Ga0105239_10503459
432 Ga0157370_10627426
433 Ga0157369_10145241
434 Ga0157369_10220624
435 Ga0157372_10091294
436 Ga0163163_10044684
437 Ga0213872_10049199
438 Ga0209758_1001233
439 Ga0207697_10039973
440 Ga0207692_10007044
441 Ga0207692_10037445
442 Ga0207710_10056849
443 Ga0207699_10053272
444 Ga0207699_10201691
445 Ga0207645_10065470
446 Ga0207707_10059227
447 Ga0207693_10010718
448 Ga0207693_10035665
449 Ga0207693_10074770
450 Ga0207662_10006900
451 Ga0207657_10019458
452 Ga0207652_10050201
453 Ga0207652_10237764
454 Ga0207646_10255964
455 Ga0207681_10195887
456 Ga0207694_10160209
457 Ga0207650_10313168
458 Ga0207700_10034585
459 Ga0207700_10282265
460 Ga0207664_10098305
461 Ga0207664_10232383
462 Ga0207706_10026317
463 Ga0207669_10051596
464 Ga0207669_10124235
465 Ga0207665_10005513
466 Ga0207665_10052253
467 Ga0207691_10279984
468 Ga0207689_10046437
469 Ga0207667_10040115
470 Ga0207667_10174010
471 Ga0207667_10284057
472 Ga0207677_10241265
473 Ga0207702_10145190
474 Ga0207702_10197282
475 Ga0207641_10418082
476 Ga0207676_10047064
477 Ga0207676_10106197
478 Ga0207676_10169816
479 Ga0207674_10080241
480 Ga0207674_10191770
481 Ga0207675_100398388
482 Ga0207683_10103910
483 Ga0207428_10000172
484 Ga0207428_10013736
485 Ga0265357_1001449
486 Ga0268265_10129671
487 Ga0268264_10146205
488 Ga0265763_1004087
489 Ga0265330_10039488
490 Ga0265325_10013945
491 Ga0265340_10007715
492 Ga0265340_10011101
493 Ga0265339_10046940
494 Ga0265316_10189847
495 Ga0265313_10014690
496 Ga0265314_10007897
497 Ga0265342_10024497
498 Ga0307411_10283921
499 Ga0373950_0031509
500 Ga0373944_0003519
501 Ga0373936_0066550
502 Ga0373939_0027526
503 Ga0373945_0058453
504 Ga0373943_0020151
505 Ga0373946_0012923
506 Ga0373961_0028263
507 Ga0373931_0009232
508 Ga0373935_0009944
509 Ga0373935_0230635
510 Ga0373927_0308915
511 Ga0373947_0351179
512 Ga0373925_0043540
513 Ga0395899_0090758
514 Ga0395900_0022366
515 Ga0395900_0670721
516 Ga0395898_0003941
517 Ga0395898_0024197
518 Ga0395898_0110844
519 Ga0436364_0412501
520 Ga0395901_0075175
521 Ga0395901_0171107
522 Ga0436365_0715620
523 Ga0436365_1614912
524 Ga0436361_0561320
525 Ga0439456_039994
526 Ga0466967_0038904
527 Ga0495603_0050857
528 Ga0495629_0215245
529 Ga0495651_0065353
530 Ga0495580_0110402
531 Ga0495582_0032148
532 Ga0495584_0037617
533 Ga0495584_0088728
534 Ga0495585_0032994
535 Ga0495594_0051429
536 Ga0495616_0079554
537 Ga0495630_0188231
538 Ga0495637_0103395
539 Ga0495663_0021273
540 Ga0495666_0165719
541 Ga0495665_0136240
542 Ga0495609_0052449
543 Ga0495622_0114422
544 Ga0495656_0051896
545 Ga0495656_0055718
546 Ga0495634_0128106
547 Ga0495588_0025753
548 Ga0495647_0083375
549 Ga0495613_0092606
550 Ga0495613_0129919
551 Ga0495624_0031182
552 Ga0495670_0047900
553 Ga0495670_0134187
554 Ga0495671_0075119
555 Ga0495581_0320722
556 Ga0495675_0129284
557 Ga0495677_0109398
558 Ga0495685_051105
559 Ga0495684_0282786
560 Ga0495602_0165344
561 Ga0495626_0062581
562 Ga0496100_0021550
563 Ga0496100_0109524
564 Ga0496100_0276961
565 Ga0496101_0051974
566 Ga0496101_0060493
567 Ga0496102_0047059
568 Ga0496102_0175344
569 Ga0496104_0018853
570 Ga0496104_0086618
571 Ga0496105_0004562
572 Ga0496106_0009344
573 Ga0496106_0050986
574 Ga0496107_0015050
575 Ga0496107_0022186
576 Ga0496108_0010045
577 Ga0496108_0054148
578 Ga0496109_0000340
579 Ga0496109_0165008
580 Ga0496110_0233776
581 Ga0496110_0484551
582 Ga0496111_0007077
583 Ga0496111_0108052
584 Ga0496112_0006271
585 Ga0496113_0000463
586 Ga0496114_0021314
587 Ga0496114_0081951
588 Ga0496115_0095403
589 Ga0501032_0019959
590 Ga0501033_0017940
591 Ga0501034_0006692
592 Ga0501037_0007895
593 Ga0501038_0073593
594 Ga0501039_0366054
595 Ga0501040_0073186
596 Ga0501042_0042852
597 Ga0501042_0140275
598 Ga0501043_0015891
599 Ga0501047_0161996
600 Ga0501048_0004440
601 Ga0501067_0018631
602 Ga0501068_0043146
603 Ga0501069_0013468
604 Ga0501070_0014654
605 Ga0501072_0106796
606 Ga0501072_0288131
607 Ga0501072_0389745
608 Ga0501073_0013043
609 Ga0501074_0016035
610 Ga0501075_0085345
611 Ga0501075_0311328
612 Ga0501076_0086410
613 Ga0501083_0026837
614 Ga0501083_0115125
615 Ga0501035_0073298
616 Ga0501044_0001312
617 Ga0501045_0097225
618 Ga0501045_0460954
619 nmdc:mga03683_50923_c1
620 nmdc:mga00v17_162055_c1
621 nmdc:mga0yw44_268118_c1
622 nmdc:mga0yw44_60962_c1
623 nmdc:mga0k408_89590_c1
624 nmdc:mga06z11_220455_c1
625 nmdc:mga05p37_111833_c1
626 nmdc:mga05p37_1808_c2
627 nmdc:mga05p37_22036_c1
628 nmdc:mga05p37_472019_c1
629 nmdc:mga05p37_508_c2
630 nmdc:mga05p37_604447_c1
631 nmdc:mga05p37_750809_c1
632 nmdc:mga09592_19515_c1
633 nmdc:mga09592_97587_c1
634 nmdc:mga0qj67_210322_c1
635 nmdc:mga0qj67_52_c1
636 nmdc:mga0qj67_63707_c1
637 nmdc:mga06r32_142417_c1
638 nmdc:mga06r32_145092_c1
639 nmdc:mga06r32_1960_c1
640 nmdc:mga06r32_3441_c1
641 nmdc:mga06r32_59228_c1
642 nmdc:mga08y16_2332_c1
643 nmdc:mga08y16_3146_c1
644 nmdc:mga08y16_89125_c1
645 nmdc:mga0n895_165596_c1
646 nmdc:mga0n895_30075_c1
647 nmdc:mga0n895_375678_c1
648 nmdc:mga0n895_82513_c1
649 nmdc:mga0rr50_221594_c1
650 nmdc:mga0rr50_74434_c1
651 nmdc:mga08x19_181380_c1
652 nmdc:mga0a205_178763_c1
653 nmdc:mga0a205_2724_c1
654 nmdc:mga0a205_287506_c1
655 nmdc:mga0a205_446576_c1
656 Ga0495601_0056328
657 Ga0495612_0082250
658 Ga0495619_0010541
659 Ga0495619_0018993
660 Ga0495619_0105512
661 Ga0495619_0184870
662 Ga0500642_0031888
663 Ga0500658_0206157
664 Ga0500616_0046790
665 Ga0500616_0110613
666 Ga0501084_0126436
667 Ga0590071_014618
668 Ga0501082_0027888
669 Ga0501082_0052297
670 Ga0501082_0098028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

138

302

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7253 66 265
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.6951 70 254
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.679 58 264
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.6772 71 254
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6763 66 265
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8372 67 261 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8266 76 265 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8251 67 261 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8224 76 262 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8127 75 261 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A498D7V0-F1-model_v4 ABC transporter permease 0.8486 20 269 GO:0005886
GO:0055085
AF-A0A8A7CSU3-F1-model_v4 deleted 0.8458 22 270
AF-A0A529IIQ6-F1-model_v4 deleted 0.8378 24 268
AF-A0A7Y0TQK8-F1-model_v4 ABC transporter permease 0.8372 23 267 GO:0005886
GO:0055085
AF-A0A498D7V0-F1-model_v4 ABC transporter permease 0.8363 20 269 GO:0005886
GO:0055085

Map