F412241

General Info

Members Datasets Scaffolds Average Seq Length
335 228 300 138

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10021841|Ga0157372_100218416
Length 176
Sequence LAENYQLLSVPPLYQREAASYNHQTRRKETVHMPSLISEVPAASPAESLQHFSRRLAFETDCSDVHQSQKTGNVDYVLVDVRNGEAFAKAHVPGAISIPTRTLTEERMAGYPRETLFVVYCAGPHCNGVHRAAIRLAGLGFAVKEMIGGLTGWVDEGIPLQGEHIPAPADGFSCEC

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
3 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
4 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
7 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
8 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
9 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
10 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
11 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
12 2718217882 Rhizobium sp. N741 Isolate Nodule
13 2718218009 Rhizobium sp. N561 Isolate Nodule
14 2718218363 Rhizobium sp. N113 Isolate Nodule
15 2718218366 Rhizobium sp. N621 Isolate Nodule
16 2721755514 Rhizobium sp. N6212 Isolate Nodule
17 2721755810 Rhizobium sp. N871 Isolate Nodule
18 2728369365 Rhizobium sp. N1341 Isolate Nodule
19 2728369397 Rhizobium sp. N1314 Isolate Nodule
20 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
21 2791355264 Rhizobium sp. S9 Isolate Nodule
22 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
23 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
24 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
25 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
26 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
27 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
28 2933599457 Rhizobium phaseoli M3 Isolate Nodule
29 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
30 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
106 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
131 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
137 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
138 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
139 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
143 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
224 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
225 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
226 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
227 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
228 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.3
Isolates 10.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 5.67
Rhizoplane 1.49
Rhizosphere 77.31
Stem 0
Stem Tuber 0
Unclassified 10.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000058 3300002704 Bacteria 72188
2 JGI25156J39149_1000080 3300002705 Bacteria 72430
3 JGI25162J39368_1002591 3300002737 Bacteria 6796
4 JGI25154J39366_1000253 3300002738 Bacteria 34195
5 JGI25157J39369_1000101 3300002741 Bacteria 72430
6 JGI25165J46597_1001762 3300003214 Bacteria 9418
7 JGI25165J46597_1014770 3300003214 Bacteria 1060
8 Ga0058692_1000136 3300003856 Bacteria 46599
9 Ga0058692_1002723 3300003856 Bacteria 5812
10 Ga0068869_100925840 3300005334 Bacteria 755
11 Ga0070689_100479525 3300005340 Bacteria 1062
12 Ga0070668_101049384 3300005347 Bacteria 734
13 Ga0070675_101058598 3300005354 Bacteria 745
14 Ga0070671_100287128 3300005355 Bacteria 1400
15 Ga0070673_100021003 3300005364 Bacteria 4722
16 Ga0070673_100806264 3300005364 Bacteria 867
17 Ga0070688_100494976 3300005365 Bacteria 921
18 Ga0070667_100566110 3300005367 Bacteria 1045
19 Ga0070667_101680133 3300005367 Bacteria 597
20 Ga0070700_100218111 3300005441 Bacteria 1350
21 Ga0070694_100462859 3300005444 Bacteria 1003
22 Ga0070685_10031744 3300005466 Bacteria 2954
23 Ga0070672_100196000 3300005543 Bacteria 1688
24 Ga0070672_100199472 3300005543 Bacteria 1673
25 Ga0070665_100145816 3300005548 Bacteria 2370
26 Ga0068855_100025837 3300005563 Bacteria 7023
27 Ga0068854_100085096 3300005578 Bacteria 2341
28 Ga0068856_100156873 3300005614 Bacteria 2286
29 Ga0070702_100428047 3300005615 Bacteria 954
30 Ga0068852_100479193 3300005616 Bacteria 1236
31 Ga0068858_100474933 3300005842 Bacteria 1206
32 Ga0068858_101870388 3300005842 Bacteria 593
33 Ga0068860_102461404 3300005843 Bacteria 540
34 Ga0068862_100293463 3300005844 Bacteria 1494
35 Ga0075366_10104642 3300006195 Bacteria 1701
36 Ga0097621_101946054 3300006237 Bacteria 561
37 Ga0075370_10010359 3300006353 Bacteria 4873
38 Ga0075428_100043810 3300006844 Bacteria 4919
39 Ga0075431_100078096 3300006847 Bacteria 3417
40 Ga0105251_10036030 3300009011 Bacteria 2438
41 Ga0105244_10465990 3300009036 Bacteria 581
42 Ga0105240_10000005 3300009093 Bacteria 702630
43 Ga0114129_10280639 3300009147 Bacteria 2226
44 Ga0105248_11266424 3300009177 Bacteria 834
45 Ga0105237_10001344 3300009545 Bacteria 32586
46 Ga0105238_10146957 3300009551 Bacteria 2333
47 Ga0105239_10020469 3300010375 Bacteria 7298
48 Ga0157370_10000948 3300013104 Bacteria 36781
49 Ga0157372_10021841 3300013307 Bacteria 6919
50 Ga0157372_11112665 3300013307 Bacteria 914
51 Ga0182007_10007629 3300015262 Bacteria 4515
52 Ga0182005_1008077 3300015265 Bacteria 3120
53 Ga0224712_10000092 3300022467 Bacteria 14147
54 Ga0209435_100045 3300025206 Bacteria 96483
55 Ga0209437_100122 3300025233 Bacteria 201364
56 Ga0209437_127610 3300025233 Bacteria 605
57 Ga0209646_1000154 3300025246 Bacteria 96483
58 Ga0209026_1000177 3300025250 Bacteria 96629
59 Ga0209677_100440 3300025253 Bacteria 24115
60 Ga0209677_101638 3300025253 Bacteria 9421
61 Ga0209759_1000274 3300025256 Bacteria 72593
62 Ga0209233_1000170 3300025261 Bacteria 147527
63 Ga0209233_1000297 3300025261 Bacteria 61773
64 Ga0207655_1037529 3300025728 Bacteria 2133
65 Ga0207695_10000011 3300025913 Bacteria 910221
66 Ga0207695_11172706 3300025913 Bacteria 648
67 Ga0207671_10010390 3300025914 Bacteria 7684
68 Ga0207657_11108462 3300025919 Bacteria 605
69 Ga0207681_10309285 3300025923 Bacteria 1253
70 Ga0207694_10339399 3300025924 Bacteria 1242
71 Ga0207706_11626400 3300025933 Bacteria 522
72 Ga0207670_10404875 3300025936 Bacteria 1092
73 Ga0207670_11070363 3300025936 Bacteria 680
74 Ga0207691_10150595 3300025940 Bacteria 2046
75 Ga0207691_10167603 3300025940 Bacteria 1924
76 Ga0207711_11505607 3300025941 Bacteria 616
77 Ga0207651_10025380 3300025960 Bacteria 3682
78 Ga0207668_10399945 3300025972 Bacteria 1161
79 Ga0207640_10076258 3300025981 Bacteria 2275
80 Ga0207658_10331018 3300025986 Bacteria 1321
81 Ga0207658_10733197 3300025986 Bacteria 894
82 Ga0207678_10378761 3300026067 Bacteria 1223
83 Ga0207708_10097999 3300026075 Bacteria 2266
84 Ga0207702_10072042 3300026078 Bacteria 2977
85 Ga0209281_1003642 3300027111 Bacteria 4966
86 Ga0209371_1000017 3300027312 Bacteria 625776
87 Ga0209371_1000134 3300027312 Bacteria 121747
88 Ga0209371_1000453 3300027312 Bacteria 40780
89 Ga0268266_10668459 3300028379 Bacteria 1000
90 Ga0268265_10257031 3300028380 Bacteria 1551
91 Ga0268264_12176460 3300028381 Bacteria 563
92 Ga0268256_1000116 3300030500 Bacteria 115451
93 Ga0268256_1000208 3300030500 Bacteria 66543
94 Ga0268256_1000461 3300030500 Bacteria 35515
95 Ga0268256_1000629 3300030500 Bacteria 27210
96 Ga0316183_1185279 3300030742 Bacteria 2454
97 Ga0316182_1067637 3300030745 Bacteria 982
98 Ga0316182_1375135 3300030745 Bacteria 1090
99 Ga0307513_10241651 3300031456 Bacteria 1610
100 Ga0307408_100014912 3300031548 Bacteria 5169
101 Ga0307514_10001271 3300031649 Bacteria 32966
102 Ga0316578_10011911 3300031728 Bacteria 4569
103 Ga0307405_10000826 3300031731 Bacteria 12179
104 Ga0316577_10000784 3300031733 Bacteria 13702
105 Ga0307413_10051285 3300031824 Bacteria 2485
106 Ga0307406_10017199 3300031901 Bacteria 4209
107 Ga0307412_10000128 3300031911 Bacteria 55850
108 Ga0307412_10538681 3300031911 Bacteria 978
109 Ga0307409_100018187 3300031995 Bacteria 4713
110 Ga0307416_100121111 3300032002 Bacteria 2332
111 Ga0307414_10014547 3300032004 Bacteria 4723
112 Ga0307411_10003901 3300032005 Bacteria 7033
113 Ga0316580_10023000 3300032139 Bacteria 1924
114 Ga0373939_0056279 3300035114 Bacteria 1237
115 Ga0316574_0000334 3300035398 Bacteria 18157
116 Ga0316584_0005949 3300036712 Bacteria 8234
117 Ga0439438_077475 3300041405 Bacteria 818
118 Ga0439447_000213 3300041407 Bacteria 20435
119 Ga0439466_0007397 3300041411 Bacteria 4160
120 Ga0439465_0000286 3300041413 Bacteria 14239
121 Ga0439431_0003633 3300041997 Bacteria 3403
122 Ga0439437_001828 3300042000 Bacteria 2258
123 Ga0439443_086237 3300042003 Bacteria 588
124 Ga0439445_0001991 3300042004 Bacteria 4501
125 Ga0439449_0000350 3300042007 Bacteria 16878
126 Ga0439455_0116240 3300042012 Bacteria 747
127 Ga0439463_006757 3300042016 Bacteria 2837
128 Ga0450911_000001 3300042115 Bacteria 311012
129 Ga0450902_004878 3300042137 Bacteria 2009
130 Ga0450904_000116 3300042139 Bacteria 17747
131 Ga0450905_029997 3300042142 Bacteria 835
132 Ga0439446_0005319 3300042156 Bacteria 3309
133 Ga0439435_0100084 3300042436 Bacteria 890
134 Ga0450916_032148 3300042530 Bacteria 768
135 Ga0450893_0003909 3300042532 Bacteria 2362
136 Ga0495617_010626 3300046452 Bacteria 3153
137 Ga0495627_004443 3300046453 Bacteria 5868
138 Ga0495590_0000009 3300046457 Bacteria 320425
139 Ga0495590_0017609 3300046457 Bacteria 2569
140 Ga0495591_000511 3300046458 Bacteria 30479
141 Ga0495591_079859 3300046458 Bacteria 835
142 Ga0495638_0133366 3300046460 Bacteria 1457
143 Ga0495651_0309425 3300046462 Bacteria 1057
144 Ga0495650_0015804 3300046471 Bacteria 3857
145 Ga0495605_0000008 3300046474 Bacteria 334602
146 Ga0495605_0022827 3300046474 Bacteria 3297
147 Ga0495605_0026231 3300046474 Bacteria 3030
148 Ga0495605_0040653 3300046474 Bacteria 2320
149 Ga0495584_0015814 3300046491 Bacteria 3848
150 Ga0495584_0099375 3300046491 Bacteria 1470
151 Ga0495585_0007370 3300046492 Bacteria 6743
152 Ga0495585_0159415 3300046492 Bacteria 1171
153 Ga0495585_0173237 3300046492 Bacteria 1113
154 Ga0495594_0002037 3300046499 Bacteria 10522
155 Ga0495596_0074664 3300046500 Bacteria 1316
156 Ga0495607_0002755 3300046501 Bacteria 14012
157 Ga0495607_0022384 3300046501 Bacteria 3969
158 Ga0495607_0042976 3300046501 Bacteria 2675
159 Ga0495607_0061638 3300046501 Bacteria 2130
160 Ga0495583_0000039 3300046506 Bacteria 241501
161 Ga0495583_0003487 3300046506 Bacteria 11918
162 Ga0495583_0155634 3300046506 Bacteria 945
163 Ga0495606_0001356 3300046507 Bacteria 33234
164 Ga0495606_0061170 3300046507 Bacteria 2409
165 Ga0495610_0001261 3300046512 Bacteria 22679
166 Ga0495610_0009840 3300046512 Bacteria 5991
167 Ga0495610_0047903 3300046512 Bacteria 2100
168 Ga0495616_0012839 3300046513 Bacteria 4738
169 Ga0495620_0000031 3300046515 Bacteria 120343
170 Ga0495620_0000155 3300046515 Bacteria 55845
171 Ga0495631_0005562 3300046518 Bacteria 6586
172 Ga0495631_0012987 3300046518 Bacteria 4054
173 Ga0495631_0040052 3300046518 Bacteria 2077
174 Ga0495632_0044002 3300046519 Bacteria 2229
175 Ga0495632_0077482 3300046519 Bacteria 1589
176 Ga0495632_0528018 3300046519 Bacteria 507
177 Ga0495637_0000003 3300046520 Bacteria 623293
178 Ga0495637_0003191 3300046520 Bacteria 8748
179 Ga0495637_0037919 3300046520 Bacteria 2089
180 Ga0495637_0083976 3300046520 Bacteria 1265
181 Ga0495643_0000049 3300046522 Bacteria 212242
182 Ga0495643_0005938 3300046522 Bacteria 8147
183 Ga0495643_0029169 3300046522 Bacteria 3088
184 Ga0495643_0087757 3300046522 Bacteria 1609
185 Ga0495643_0325966 3300046522 Bacteria 693
186 Ga0495644_0016511 3300046523 Bacteria 2825
187 Ga0495644_0024312 3300046523 Bacteria 2304
188 Ga0495648_0000862 3300046524 Bacteria 31961
189 Ga0495648_0013551 3300046524 Bacteria 6016
190 Ga0495648_0232854 3300046524 Bacteria 900
191 Ga0495642_0055698 3300046528 Bacteria 1632
192 Ga0495642_0155441 3300046528 Bacteria 990
193 Ga0495642_0424447 3300046528 Bacteria 587
194 Ga0495654_0005800 3300046530 Bacteria 7114
195 Ga0495654_0013732 3300046530 Bacteria 4328
196 Ga0495609_0000031 3300046538 Bacteria 213813
197 Ga0495609_0014498 3300046538 Bacteria 3703
198 Ga0495597_0004022 3300046542 Bacteria 8245
199 Ga0495597_0010850 3300046542 Bacteria 4436
200 Ga0495633_0000011 3300046558 Bacteria 268237
201 Ga0495633_0002876 3300046558 Bacteria 11798
202 Ga0495656_0304449 3300046615 Bacteria 817
203 Ga0495668_0000364 3300046616 Bacteria 59836
204 Ga0495668_0031011 3300046616 Bacteria 3013
205 Ga0495611_0000645 3300046648 Bacteria 19981
206 Ga0495611_0080004 3300046648 Bacteria 1501
207 Ga0495625_0028790 3300046660 Bacteria 4161
208 Ga0495625_0029520 3300046660 Bacteria 4099
209 Ga0495625_0627817 3300046660 Bacteria 642
210 Ga0495661_0035387 3300046665 Bacteria 3133
211 Ga0495661_0100139 3300046665 Bacteria 1632
212 Ga0495661_0144624 3300046665 Bacteria 1290
213 Ga0495661_0413307 3300046665 Bacteria 654
214 Ga0495599_0047214 3300046678 Bacteria 2698
215 Ga0495623_0005480 3300046679 Bacteria 8295
216 Ga0495669_0016111 3300046684 Bacteria 3201
217 Ga0495669_0201189 3300046684 Bacteria 952
218 Ga0495670_0001750 3300046691 Bacteria 10657
219 Ga0495670_0085368 3300046691 Bacteria 1611
220 Ga0495671_0006439 3300046692 Bacteria 6779
221 Ga0495671_0012301 3300046692 Bacteria 4678
222 Ga0495671_0135428 3300046692 Bacteria 1201
223 Ga0495671_0139152 3300046692 Bacteria 1183
224 Ga0495649_0000088 3300046694 Bacteria 79155
225 Ga0495649_0009130 3300046694 Bacteria 5911
226 Ga0495649_0403202 3300046694 Bacteria 686
227 Ga0495589_0002989 3300046794 Bacteria 9313
228 Ga0495589_0152604 3300046794 Bacteria 1102
229 Ga0495589_0220681 3300046794 Bacteria 890
230 Ga0495660_0002193 3300046810 Bacteria 12575
231 Ga0495660_0014259 3300046810 Bacteria 4603
232 Ga0495660_0062836 3300046810 Bacteria 1989
233 Ga0495660_0197822 3300046810 Bacteria 961
234 Ga0495660_0286006 3300046810 Bacteria 752
235 Ga0495604_0000745 3300047317 Bacteria 27317
236 Ga0495672_0000319 3300047320 Bacteria 63963
237 Ga0495680_0062297 3300047322 Bacteria 2868
238 Ga0495683_0000008 3300047323 Bacteria 241577
239 Ga0495683_0000136 3300047323 Bacteria 72177
240 Ga0495683_0076319 3300047323 Bacteria 1639
241 Ga0495677_0000552 3300047445 Bacteria 15461
242 Ga0495677_0011276 3300047445 Bacteria 3272
243 Ga0495679_000920 3300047446 Bacteria 18404
244 Ga0495679_001481 3300047446 Bacteria 13274
245 Ga0495679_008554 3300047446 Bacteria 4151
246 Ga0495679_012882 3300047446 Bacteria 3162
247 Ga0495685_019469 3300047447 Bacteria 2332
248 Ga0495673_0000012 3300047469 Bacteria 656908
249 Ga0495673_0009328 3300047469 Bacteria 5437
250 Ga0495673_0180252 3300047469 Bacteria 800
251 Ga0495681_0008051 3300047470 Bacteria 6644
252 Ga0495681_0025770 3300047470 Bacteria 3072
253 Ga0495681_0043870 3300047470 Bacteria 2153
254 Ga0495681_0090172 3300047470 Bacteria 1355
255 Ga0495686_0063005 3300047472 Bacteria 2298
256 Ga0495602_0012684 3300048088 Bacteria 8647
257 Ga0495626_0013406 3300048091 Bacteria 4259
258 Ga0495626_0019611 3300048091 Bacteria 3380
259 Ga0495626_0042874 3300048091 Bacteria 2124
260 Ga0495626_0330621 3300048091 Bacteria 597
261 Ga0496100_0061082 3300048903 Bacteria 2482
262 Ga0496101_0166513 3300048904 Bacteria 1692
263 Ga0496102_0101371 3300048905 Bacteria 2674
264 Ga0496103_0066404 3300048906 Bacteria 2251
265 Ga0496106_0631971 3300048909 Bacteria 856
266 Ga0496116_0066620 3300048919 Bacteria 2303
267 Ga0496117_0003941 3300048920 Bacteria 16793
268 Ga0496118_0002145 3300048921 Bacteria 27524
269 Ga0496119_0017024 3300048922 Bacteria 5495
270 Ga0496120_0014751 3300048923 Bacteria 5187
271 Ga0496121_0002644 3300048924 Bacteria 26901
272 Ga0496121_0005121 3300048924 Bacteria 17074
273 Ga0496121_0142307 3300048924 Bacteria 1777
274 Ga0496122_0045401 3300048925 Bacteria 3415
275 Ga0496122_0052549 3300048925 Bacteria 3082
276 Ga0496122_0147389 3300048925 Bacteria 1460
277 Ga0496123_0022455 3300048926 Bacteria 4862
278 Ga0496123_0027336 3300048926 Bacteria 4251
279 Ga0496124_0026574 3300048927 Bacteria 5216
280 Ga0496124_0233972 3300048927 Bacteria 1371
281 Ga0496124_0448536 3300048927 Bacteria 880
282 Ga0496125_0073953 3300048928 Bacteria 2645
283 Ga0496126_0023041 3300048929 Bacteria 6039
284 Ga0496126_0288198 3300048929 Bacteria 1358
285 Ga0496126_0919076 3300048929 Bacteria 662
286 Ga0496126_1068193 3300048929 Bacteria 601
287 Ga0495678_000018 3300049459 Bacteria 279747
288 Ga0495678_000139 3300049459 Bacteria 87263
289 Ga0495678_000256 3300049459 Bacteria 59602
290 Ga0495678_008689 3300049459 Bacteria 5100
291 Ga0495678_020280 3300049459 Bacteria 2948
292 Ga0501241_001144 3300049758 Bacteria 5514
293 Ga0501226_000003 3300049853 Bacteria 358977
294 nmdc:mga07m45_142702_c1 3300050496 Bacteria 1387
295 nmdc:mga06r32_225689_c1 3300050510 Bacteria 1862
296 Ga0500618_011462 3300053125 Bacteria 2349
297 Ga0500618_092420 3300053125 Bacteria 680
298 Ga0500633_0182911 3300053160 Bacteria 786
299 Ga0500636_0215986 3300053177 Bacteria 1003
300 Ga0500645_004133 3300053730 Bacteria 5659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0005938 Ga0495643_0005938_6379_6858 118
2 iso_pu_bacteria 2582581308 2585277061 126
3 iso_pu_bacteria 2582581315 2585323931 126
4 iso_pu_bacteria 2582581316 2585333719 126
5 iso_pu_bacteria 2585427527 2585534201 126
6 iso_pu_bacteria 2585427530 2585551946 126
7 iso_pu_bacteria 2615840626 2616308437 126
8 iso_pu_bacteria 2775507266 2778177778 126
9 iso_pu_bacteria 2818991448 2819612848 126
10 iso_pu_bacteria 2818991453 2819638049 126
11 iso_pu_bacteria 2842482326 2842488415 126
12 iso_pu_bacteria 2852387548 2852389750 126
13 iso_pu_bacteria 3005416602 3005420244 126
14 iso_pu_bacteria 8005314921 8005317195 126
15 iso_pu_bacteria 8005484373 8005485005 126
16 iso_pu_bacteria 8005645114 8005648742 126
17 iso_pu_bacteria 8046767195 8046769452 126
18 iso_pu_bacteria 8057575449 8057578908 126
19 iso_pu_bacteria 2510917022 2511134974 127
20 iso_pu_bacteria 2582581307 2585270713 127
21 iso_pu_bacteria 2585427531 2585558436 127
22 iso_pu_bacteria 2585427609 2585904594 127
23 iso_pu_bacteria 2585428125 2587980290 127
24 iso_pu_bacteria 2718217882 2719182260 127
25 iso_pu_bacteria 2718218009 2719732976 127
26 iso_pu_bacteria 2718218363 2721148373 127
27 iso_pu_bacteria 2718218366 2721165187 127
28 iso_pu_bacteria 2721755514 2722841357 127
29 iso_pu_bacteria 2721755810 2724045732 127
30 iso_pu_bacteria 2728369365 2730165495 127
31 iso_pu_bacteria 2728369397 2730299391 127
32 iso_pu_bacteria 2791355264 2793349683 127
33 iso_pu_bacteria 2838068647 2838069719 127
34 iso_pu_bacteria 2842422224 2842423333 127
35 iso_pu_bacteria 2933599457 2933600526 127
36 iso_pu_bacteria 8018127388 8018127580 127
37 3300046457 Ga0495590_0000009 Ga0495590_0000009_222569_222961 129
38 3300046457 Ga0495590_0017609 Ga0495590_0017609_256_648 129
39 3300046458 Ga0495591_000511 Ga0495591_000511_28160_28552 129
40 3300046458 Ga0495591_079859 Ga0495591_079859_14_412 129
41 3300046460 Ga0495638_0133366 Ga0495638_0133366_219_611 129
42 3300046474 Ga0495605_0022827 Ga0495605_0022827_2434_2832 129
43 3300046474 Ga0495605_0026231 Ga0495605_0026231_412_804 129
44 3300046474 Ga0495605_0040653 Ga0495605_0040653_311_703 129
45 3300046491 Ga0495584_0015814 Ga0495584_0015814_600_998 129
46 3300046492 Ga0495585_0007370 Ga0495585_0007370_6209_6601 129
47 3300046492 Ga0495585_0159415 Ga0495585_0159415_631_1029 129
48 3300046500 Ga0495596_0074664 Ga0495596_0074664_490_888 129
49 3300046501 Ga0495607_0002755 Ga0495607_0002755_409_807 129
50 3300046501 Ga0495607_0042976 Ga0495607_0042976_79_471 129
51 3300046501 Ga0495607_0061638 Ga0495607_0061638_1422_1814 129
52 3300046506 Ga0495583_0003487 Ga0495583_0003487_10919_11311 129
53 3300046506 Ga0495583_0155634 Ga0495583_0155634_243_641 129
54 3300046507 Ga0495606_0061170 Ga0495606_0061170_1521_1919 129
55 3300046512 Ga0495610_0001261 Ga0495610_0001261_4922_5314 129
56 3300046512 Ga0495610_0047903 Ga0495610_0047903_376_774 129
57 3300046513 Ga0495616_0012839 Ga0495616_0012839_3738_4136 129
58 3300046518 Ga0495631_0012987 Ga0495631_0012987_1234_1626 129
59 3300046518 Ga0495631_0040052 Ga0495631_0040052_395_793 129
60 3300046519 Ga0495632_0044002 Ga0495632_0044002_256_648 129
61 3300046519 Ga0495632_0077482 Ga0495632_0077482_806_1204 129
62 3300046519 Ga0495632_0528018 Ga0495632_0528018_20_412 129
63 3300046520 Ga0495637_0000003 Ga0495637_0000003_84780_85172 129
64 3300046520 Ga0495637_0003191 Ga0495637_0003191_2305_2697 129
65 3300046520 Ga0495637_0083976 Ga0495637_0083976_483_881 129
66 3300046522 Ga0495643_0029169 Ga0495643_0029169_687_1121 129
67 3300046522 Ga0495643_0325966 Ga0495643_0325966_149_541 129
68 3300046523 Ga0495644_0016511 Ga0495644_0016511_1661_2053 129
69 3300046523 Ga0495644_0024312 Ga0495644_0024312_467_865 129
70 3300046524 Ga0495648_0013551 Ga0495648_0013551_566_958 129
71 3300046524 Ga0495648_0232854 Ga0495648_0232854_143_541 129
72 3300046528 Ga0495642_0055698 Ga0495642_0055698_449_841 129
73 3300046528 Ga0495642_0155441 Ga0495642_0155441_342_740 129
74 3300046528 Ga0495642_0424447 Ga0495642_0424447_11_403 129
75 3300046538 Ga0495609_0014498 Ga0495609_0014498_1150_1548 129
76 3300046542 Ga0495597_0010850 Ga0495597_0010850_226_714 129
77 3300046558 Ga0495633_0002876 Ga0495633_0002876_365_757 129
78 3300046616 Ga0495668_0031011 Ga0495668_0031011_350_748 129
79 3300046648 Ga0495611_0080004 Ga0495611_0080004_476_874 129
80 3300046660 Ga0495625_0627817 Ga0495625_0627817_214_612 129
81 3300046665 Ga0495661_0035387 Ga0495661_0035387_461_853 129
82 3300046665 Ga0495661_0100139 Ga0495661_0100139_303_695 129
83 3300046684 Ga0495669_0016111 Ga0495669_0016111_411_809 129
84 3300046684 Ga0495669_0201189 Ga0495669_0201189_309_701 129
85 3300046691 Ga0495670_0085368 Ga0495670_0085368_846_1244 129
86 3300046692 Ga0495671_0135428 Ga0495671_0135428_651_1049 129
87 3300046694 Ga0495649_0000088 Ga0495649_0000088_19811_20203 129
88 3300046694 Ga0495649_0403202 Ga0495649_0403202_180_659 129
89 3300046794 Ga0495589_0152604 Ga0495589_0152604_448_840 129
90 3300046794 Ga0495589_0220681 Ga0495589_0220681_410_808 129
91 3300046810 Ga0495660_0014259 Ga0495660_0014259_3343_3741 129
92 3300046810 Ga0495660_0062836 Ga0495660_0062836_389_781 129
93 3300046810 Ga0495660_0197822 Ga0495660_0197822_311_703 129
94 3300047320 Ga0495672_0000319 Ga0495672_0000319_5320_5712 129
95 3300047323 Ga0495683_0000136 Ga0495683_0000136_60993_61385 129
96 3300047323 Ga0495683_0076319 Ga0495683_0076319_935_1333 129
97 3300047445 Ga0495677_0000552 Ga0495677_0000552_13317_13709 129
98 3300047445 Ga0495677_0011276 Ga0495677_0011276_532_930 129
99 3300047446 Ga0495679_008554 Ga0495679_008554_1748_2140 129
100 3300047446 Ga0495679_012882 Ga0495679_012882_721_1119 129
101 3300047447 Ga0495685_019469 Ga0495685_019469_429_827 129
102 3300047470 Ga0495681_0025770 Ga0495681_0025770_687_1079 129
103 3300047470 Ga0495681_0090172 Ga0495681_0090172_900_1298 129
104 3300047472 Ga0495686_0063005 Ga0495686_0063005_1294_1686 129
105 3300048091 Ga0495626_0013406 Ga0495626_0013406_3758_4150 129
106 3300048091 Ga0495626_0019611 Ga0495626_0019611_2672_3070 129
107 3300048091 Ga0495626_0042874 Ga0495626_0042874_223_615 129
108 3300048091 Ga0495626_0330621 Ga0495626_0330621_169_561 129
109 3300048925 Ga0496122_0147389 Ga0496122_0147389_407_805 129
110 3300048927 Ga0496124_0448536 Ga0496124_0448536_84_482 129
111 3300049459 Ga0495678_000139 Ga0495678_000139_54538_54972 129
112 3300049459 Ga0495678_000256 Ga0495678_000256_34312_34704 129
113 3300049459 Ga0495678_020280 Ga0495678_020280_468_866 129
114 3300002704 JGI25155J39150_1000058 JGI25155J39150_100005850 130
115 3300002705 JGI25156J39149_1000080 JGI25156J39149_100008050 130
116 3300002737 JGI25162J39368_1002591 JGI25162J39368_10025915 130
117 3300002738 JGI25154J39366_1000253 JGI25154J39366_100025331 130
118 3300002741 JGI25157J39369_1000101 JGI25157J39369_100010131 130
119 3300003214 JGI25165J46597_1001762 JGI25165J46597_10017626 130
120 3300003214 JGI25165J46597_1014770 JGI25165J46597_10147702 130
121 3300003856 Ga0058692_1000136 Ga0058692_100013617 130
122 3300003856 Ga0058692_1002723 Ga0058692_10027233 130
123 3300005334 Ga0068869_100925840 Ga0068869_1009258401 130
124 3300005340 Ga0070689_100479525 Ga0070689_1004795251 130
125 3300005347 Ga0070668_101049384 Ga0070668_1010493841 130
126 3300005354 Ga0070675_101058598 Ga0070675_1010585982 130
127 3300005355 Ga0070671_100287128 Ga0070671_1002871282 130
128 3300005364 Ga0070673_100021003 Ga0070673_1000210033 130
129 3300005364 Ga0070673_100806264 Ga0070673_1008062642 130
130 3300005365 Ga0070688_100494976 Ga0070688_1004949762 130
131 3300005367 Ga0070667_100566110 Ga0070667_1005661101 130
132 3300005367 Ga0070667_101680133 Ga0070667_1016801331 130
133 3300005441 Ga0070700_100218111 Ga0070700_1002181112 130
134 3300005444 Ga0070694_100462859 Ga0070694_1004628591 130
135 3300005466 Ga0070685_10031744 Ga0070685_100317442 130
136 3300005543 Ga0070672_100196000 Ga0070672_1001960002 130
137 3300005543 Ga0070672_100199472 Ga0070672_1001994722 130
138 3300005548 Ga0070665_100145816 Ga0070665_1001458163 130
139 3300005563 Ga0068855_100025837 Ga0068855_1000258378 130
140 3300005578 Ga0068854_100085096 Ga0068854_1000850962 130
141 3300005614 Ga0068856_100156873 Ga0068856_1001568732 130
142 3300005615 Ga0070702_100428047 Ga0070702_1004280471 130
143 3300005616 Ga0068852_100479193 Ga0068852_1004791932 130
144 3300005842 Ga0068858_100474933 Ga0068858_1004749332 130
145 3300005842 Ga0068858_101870388 Ga0068858_1018703881 130
146 3300005843 Ga0068860_102461404 Ga0068860_1024614041 130
147 3300005844 Ga0068862_100293463 Ga0068862_1002934632 130
148 3300006195 Ga0075366_10104642 Ga0075366_101046422 130
149 3300006237 Ga0097621_101946054 Ga0097621_1019460541 130
150 3300006353 Ga0075370_10010359 Ga0075370_100103593 130
151 3300006844 Ga0075428_100043810 Ga0075428_1000438105 130
152 3300006847 Ga0075431_100078096 Ga0075431_1000780962 130
153 3300009011 Ga0105251_10036030 Ga0105251_100360304 130
154 3300009036 Ga0105244_10465990 Ga0105244_104659901 130
155 3300009093 Ga0105240_10000005 Ga0105240_10000005452 130
156 3300009147 Ga0114129_10280639 Ga0114129_102806392 130
157 3300009177 Ga0105248_11266424 Ga0105248_112664242 130
158 3300009545 Ga0105237_10001344 Ga0105237_100013444 130
159 3300009551 Ga0105238_10146957 Ga0105238_101469572 130
160 3300010375 Ga0105239_10020469 Ga0105239_100204694 130
161 3300013104 Ga0157370_10000948 Ga0157370_1000094832 130
162 3300013307 Ga0157372_10021841 Ga0157372_100218416 130
163 3300013307 Ga0157372_11112665 Ga0157372_111126651 130
164 3300015262 Ga0182007_10007629 Ga0182007_100076295 130
165 3300015265 Ga0182005_1008077 Ga0182005_10080772 130
166 3300022467 Ga0224712_10000092 Ga0224712_1000009214 130
167 3300025206 Ga0209435_100045 Ga0209435_10004573 130
168 3300025233 Ga0209437_100122 Ga0209437_10012250 130
169 3300025233 Ga0209437_127610 Ga0209437_1276101 130
170 3300025246 Ga0209646_1000154 Ga0209646_100015473 130
171 3300025250 Ga0209026_1000177 Ga0209026_100017773 130
172 3300025253 Ga0209677_100440 Ga0209677_1004403 130
173 3300025253 Ga0209677_101638 Ga0209677_1016382 130
174 3300025256 Ga0209759_1000274 Ga0209759_100027447 130
175 3300025261 Ga0209233_1000170 Ga0209233_100017050 130
176 3300025261 Ga0209233_1000297 Ga0209233_100029751 130
177 3300025728 Ga0207655_1037529 Ga0207655_10375293 130
178 3300025913 Ga0207695_10000011 Ga0207695_10000011465 130
179 3300025913 Ga0207695_11172706 Ga0207695_111727061 130
180 3300025914 Ga0207671_10010390 Ga0207671_100103907 130
181 3300025919 Ga0207657_11108462 Ga0207657_111084622 130
182 3300025923 Ga0207681_10309285 Ga0207681_103092851 130
183 3300025924 Ga0207694_10339399 Ga0207694_103393992 130
184 3300025933 Ga0207706_11626400 Ga0207706_116264001 130
185 3300025936 Ga0207670_10404875 Ga0207670_104048751 130
186 3300025936 Ga0207670_11070363 Ga0207670_110703631 130
187 3300025940 Ga0207691_10150595 Ga0207691_101505952 130
188 3300025940 Ga0207691_10167603 Ga0207691_101676032 130
189 3300025941 Ga0207711_11505607 Ga0207711_115056071 130
190 3300025960 Ga0207651_10025380 Ga0207651_100253802 130
191 3300025972 Ga0207668_10399945 Ga0207668_103999451 130
192 3300025981 Ga0207640_10076258 Ga0207640_100762582 130
193 3300025986 Ga0207658_10331018 Ga0207658_103310182 130
194 3300025986 Ga0207658_10733197 Ga0207658_107331971 130
195 3300026067 Ga0207678_10378761 Ga0207678_103787611 130
196 3300026075 Ga0207708_10097999 Ga0207708_100979993 130
197 3300026078 Ga0207702_10072042 Ga0207702_100720424 130
198 3300027111 Ga0209281_1003642 Ga0209281_10036422 130
199 3300027312 Ga0209371_1000017 Ga0209371_1000017352 130
200 3300027312 Ga0209371_1000134 Ga0209371_100013419 130
201 3300027312 Ga0209371_1000453 Ga0209371_100045329 130
202 3300028379 Ga0268266_10668459 Ga0268266_106684592 130
203 3300028380 Ga0268265_10257031 Ga0268265_102570312 130
204 3300028381 Ga0268264_12176460 Ga0268264_121764602 130
205 3300030500 Ga0268256_1000116 Ga0268256_1000116108 130
206 3300030500 Ga0268256_1000208 Ga0268256_100020842 130
207 3300030500 Ga0268256_1000461 Ga0268256_10004612 130
208 3300030500 Ga0268256_1000629 Ga0268256_100062921 130
209 3300030742 Ga0316183_1185279 Ga0316183_11852793 130
210 3300030745 Ga0316182_1067637 Ga0316182_10676371 130
211 3300030745 Ga0316182_1375135 Ga0316182_13751352 130
212 3300031456 Ga0307513_10241651 Ga0307513_102416512 130
213 3300031548 Ga0307408_100014912 Ga0307408_1000149126 130
214 3300031649 Ga0307514_10001271 Ga0307514_1000127120 130
215 3300031728 Ga0316578_10011911 Ga0316578_100119115 130
216 3300031731 Ga0307405_10000826 Ga0307405_100008266 130
217 3300031733 Ga0316577_10000784 Ga0316577_100007846 130
218 3300031824 Ga0307413_10051285 Ga0307413_100512853 130
219 3300031901 Ga0307406_10017199 Ga0307406_100171993 130
220 3300031911 Ga0307412_10000128 Ga0307412_1000012843 130
221 3300031911 Ga0307412_10538681 Ga0307412_105386811 130
222 3300031995 Ga0307409_100018187 Ga0307409_1000181876 130
223 3300032002 Ga0307416_100121111 Ga0307416_1001211112 130
224 3300032004 Ga0307414_10014547 Ga0307414_100145476 130
225 3300032005 Ga0307411_10003901 Ga0307411_100039019 130
226 3300032139 Ga0316580_10023000 Ga0316580_100230003 130
227 3300035114 Ga0373939_0056279 Ga0373939_0056279_52_465 130
228 3300035398 Ga0316574_0000334 Ga0316574_0000334_14199_14615 130
229 3300036712 Ga0316584_0005949 Ga0316584_0005949_3514_3930 130
230 3300041405 Ga0439438_077475 Ga0439438_077475_314_748 130
231 3300041407 Ga0439447_000213 Ga0439447_000213_7527_7961 130
232 3300041411 Ga0439466_0007397 Ga0439466_0007397_315_749 130
233 3300041413 Ga0439465_0000286 Ga0439465_0000286_13648_14073 130
234 3300041997 Ga0439431_0003633 Ga0439431_0003633_2229_2666 130
235 3300042000 Ga0439437_001828 Ga0439437_001828_734_1171 130
236 3300042003 Ga0439443_086237 Ga0439443_086237_43_480 130
237 3300042004 Ga0439445_0001991 Ga0439445_0001991_489_914 130
238 3300042007 Ga0439449_0000350 Ga0439449_0000350_837_1262 130
239 3300042012 Ga0439455_0116240 Ga0439455_0116240_228_665 130
240 3300042016 Ga0439463_006757 Ga0439463_006757_1270_1704 130
241 3300042115 Ga0450911_000001 Ga0450911_000001_154897_155334 130
242 3300042137 Ga0450902_004878 Ga0450902_004878_72_506 130
243 3300042139 Ga0450904_000116 Ga0450904_000116_1143_1580 130
244 3300042142 Ga0450905_029997 Ga0450905_029997_85_522 130
245 3300042156 Ga0439446_0005319 Ga0439446_0005319_2672_3109 130
246 3300042436 Ga0439435_0100084 Ga0439435_0100084_357_794 130
247 3300042530 Ga0450916_032148 Ga0450916_032148_113_550 130
248 3300042532 Ga0450893_0003909 Ga0450893_0003909_1241_1678 130
249 3300046452 Ga0495617_010626 Ga0495617_010626_128_598 130
250 3300046453 Ga0495627_004443 Ga0495627_004443_1882_2355 130
251 3300046462 Ga0495651_0309425 Ga0495651_0309425_350_784 130
252 3300046471 Ga0495650_0015804 Ga0495650_0015804_2342_2815 130
253 3300046474 Ga0495605_0000008 Ga0495605_0000008_186163_186636 130
254 3300046491 Ga0495584_0099375 Ga0495584_0099375_208_606 130
255 3300046492 Ga0495585_0173237 Ga0495585_0173237_366_767 130
256 3300046499 Ga0495594_0002037 Ga0495594_0002037_5300_5773 130
257 3300046501 Ga0495607_0022384 Ga0495607_0022384_3046_3456 130
258 3300046506 Ga0495583_0000039 Ga0495583_0000039_158940_159413 130
259 3300046507 Ga0495606_0001356 Ga0495606_0001356_2383_2823 130
260 3300046512 Ga0495610_0009840 Ga0495610_0009840_1750_2223 130
261 3300046515 Ga0495620_0000031 Ga0495620_0000031_56429_56902 130
262 3300046515 Ga0495620_0000155 Ga0495620_0000155_52265_52705 130
263 3300046518 Ga0495631_0005562 Ga0495631_0005562_4700_5173 130
264 3300046520 Ga0495637_0037919 Ga0495637_0037919_74_547 130
265 3300046522 Ga0495643_0000049 Ga0495643_0000049_82590_83030 130
266 3300046522 Ga0495643_0087757 Ga0495643_0087757_450_890 130
267 3300046524 Ga0495648_0000862 Ga0495648_0000862_26869_27342 130
268 3300046530 Ga0495654_0005800 Ga0495654_0005800_1893_2366 130
269 3300046530 Ga0495654_0013732 Ga0495654_0013732_2043_2483 130
270 3300046538 Ga0495609_0000031 Ga0495609_0000031_139522_139995 130
271 3300046542 Ga0495597_0004022 Ga0495597_0004022_4378_4851 130
272 3300046558 Ga0495633_0000011 Ga0495633_0000011_115105_115578 130
273 3300046615 Ga0495656_0304449 Ga0495656_0304449_103_513 130
274 3300046616 Ga0495668_0000364 Ga0495668_0000364_12144_12620 130
275 3300046648 Ga0495611_0000645 Ga0495611_0000645_15732_16205 130
276 3300046660 Ga0495625_0028790 Ga0495625_0028790_1880_2320 130
277 3300046660 Ga0495625_0029520 Ga0495625_0029520_688_1128 130
278 3300046665 Ga0495661_0144624 Ga0495661_0144624_393_833 130
279 3300046665 Ga0495661_0413307 Ga0495661_0413307_167_568 130
280 3300046678 Ga0495599_0047214 Ga0495599_0047214_1281_1715 130
281 3300046679 Ga0495623_0005480 Ga0495623_0005480_3645_4079 130
282 3300046691 Ga0495670_0001750 Ga0495670_0001750_4610_5083 130
283 3300046692 Ga0495671_0006439 Ga0495671_0006439_6130_6603 130
284 3300046692 Ga0495671_0012301 Ga0495671_0012301_3063_3491 130
285 3300046692 Ga0495671_0139152 Ga0495671_0139152_542_982 130
286 3300046694 Ga0495649_0009130 Ga0495649_0009130_2034_2474 130
287 3300046794 Ga0495589_0002989 Ga0495589_0002989_4089_4562 130
288 3300046810 Ga0495660_0002193 Ga0495660_0002193_7418_7891 130
289 3300046810 Ga0495660_0286006 Ga0495660_0286006_283_714 130
290 3300047317 Ga0495604_0000745 Ga0495604_0000745_2412_2846 130
291 3300047322 Ga0495680_0062297 Ga0495680_0062297_85_519 130
292 3300047323 Ga0495683_0000008 Ga0495683_0000008_91100_91573 130
293 3300047446 Ga0495679_000920 Ga0495679_000920_3814_4254 130
294 3300047446 Ga0495679_001481 Ga0495679_001481_8141_8614 130
295 3300047469 Ga0495673_0000012 Ga0495673_0000012_195031_195501 130
296 3300047469 Ga0495673_0009328 Ga0495673_0009328_3329_3802 130
297 3300047469 Ga0495673_0180252 Ga0495673_0180252_255_665 130
298 3300047470 Ga0495681_0008051 Ga0495681_0008051_5893_6366 130
299 3300047470 Ga0495681_0043870 Ga0495681_0043870_177_617 130
300 3300048088 Ga0495602_0012684 Ga0495602_0012684_5351_5785 130
301 3300048903 Ga0496100_0061082 Ga0496100_0061082_963_1355 130
302 3300048904 Ga0496101_0166513 Ga0496101_0166513_192_584 130
303 3300048905 Ga0496102_0101371 Ga0496102_0101371_914_1306 130
304 3300048906 Ga0496103_0066404 Ga0496103_0066404_1091_1483 130
305 3300048909 Ga0496106_0631971 Ga0496106_0631971_49_441 130
306 3300048919 Ga0496116_0066620 Ga0496116_0066620_1388_1780 130
307 3300048920 Ga0496117_0003941 Ga0496117_0003941_6975_7367 130
308 3300048921 Ga0496118_0002145 Ga0496118_0002145_20825_21217 130
309 3300048922 Ga0496119_0017024 Ga0496119_0017024_3822_4214 130
310 3300048923 Ga0496120_0014751 Ga0496120_0014751_2636_3028 130
311 3300048924 Ga0496121_0002644 Ga0496121_0002644_6308_6700 130
312 3300048924 Ga0496121_0005121 Ga0496121_0005121_10457_10972 130
313 3300048924 Ga0496121_0142307 Ga0496121_0142307_558_1022 130
314 3300048925 Ga0496122_0045401 Ga0496122_0045401_1179_1652 130
315 3300048925 Ga0496122_0052549 Ga0496122_0052549_1101_1493 130
316 3300048926 Ga0496123_0022455 Ga0496123_0022455_2754_3227 130
317 3300048926 Ga0496123_0027336 Ga0496123_0027336_1370_1762 130
318 3300048927 Ga0496124_0026574 Ga0496124_0026574_1538_1930 130
319 3300048927 Ga0496124_0233972 Ga0496124_0233972_691_1155 130
320 3300048928 Ga0496125_0073953 Ga0496125_0073953_867_1259 130
321 3300048929 Ga0496126_0023041 Ga0496126_0023041_2663_3154 130
322 3300048929 Ga0496126_0288198 Ga0496126_0288198_62_454 130
323 3300048929 Ga0496126_0919076 Ga0496126_0919076_118_588 130
324 3300048929 Ga0496126_1068193 Ga0496126_1068193_62_454 130
325 3300049459 Ga0495678_000018 Ga0495678_000018_117711_118184 130
326 3300049459 Ga0495678_008689 Ga0495678_008689_2587_3027 130
327 3300049758 Ga0501241_001144 Ga0501241_001144_4508_4936 130
328 3300049853 Ga0501226_000003 Ga0501226_000003_355505_355942 130
329 3300050496 nmdc:mga07m45_142702_c1 nmdc:mga07m45_142702_c1_287_721 130
330 3300050510 nmdc:mga06r32_225689_c1 nmdc:mga06r32_225689_c1_900_1313 130
331 3300053125 Ga0500618_011462 Ga0500618_011462_733_1197 130
332 3300053125 Ga0500618_092420 Ga0500618_092420_135_608 130
333 3300053160 Ga0500633_0182911 Ga0500633_0182911_305_775 130
334 3300053177 Ga0500636_0215986 Ga0500636_0215986_293_688 130
335 3300053730 Ga0500645_004133 Ga0500645_004133_3998_4432 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

61

156

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o3w-assembly2.cif.gz_D crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9635 12 123
3o3w-assembly2.cif.gz_F crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9603 9 128
3nhv-assembly1.cif.gz_C crystal structure of bh2092 protein from bacillus halodurans, northeast structural genomics consortium target bhr228f 0.959 10 130
3o3w-assembly2.cif.gz_F crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9447 9 128
3o3w-assembly2.cif.gz_D crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9391 12 123
ID Description Score Start End Superfamily
3o3wI00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9246 10 123 3.40.250.10
af_O08446_114_219_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8948 26 130 3.40.250.10
3o3wI00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8933 10 123 3.40.250.10
3ilmD00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8914 27 129 3.40.250.10
2kl3A01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8889 26 128 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A437MWV7-F1-model_v4 Rhodanese-like domain-containing protein 0.9959 25 130 GO:0004792
AF-A0A7K3M4L0-F1-model_v4 Rhodanese-like domain-containing protein 0.9919 41 129 GO:0004792
AF-A0A1I4RX74-F1-model_v4 Rhodanese-related sulfurtransferase 0.9915 18 129 GO:0004792
AF-A0A2W5MDJ9-F1-model_v4 deleted 0.9902 16 130
AF-A0A5E4VS51-F1-model_v4 Rhodanese 0.9868 44 116 GO:0004792

Feature Viewer

pLDDT pTM Quality
96.4 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map