F412234

General Info

Members Datasets Scaffolds Average Seq Length
335 197 670 208

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10227445|Ga0105239_102274453
Length 252
Sequence VTNVGVLGASGRMGREVCRAVDVADDLTLVAAVDPHHEGAELGNLVVVGSPEAFEGVDVAVDFTTPGSVIENARWCLRRGVHMVIGTTGIGADGLEEIRRLTGSANANAIVAPNFAIGAALMMRFAEQAARYFDAAEVIELHHDRKVDAPSGTAITTAQRIGAARAGAWEAPGGDGSHPGARGADVDGIRVHXXXLPGLLAHQEVIFGSPGQTLTVRHDTIDRSAFIPGVLLAIRSVADRPGLTIGLDALLD

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.76
Rhizosphere 92.24
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10227445 3300010375 Bacteria 2093
2 Ga0070676_10149514 3300005328 Bacteria 1494
3 Ga0070683_100007102 3300005329 Bacteria 9437
4 Ga0070683_100007974 3300005329 Bacteria 8984
5 Ga0070683_100389494 3300005329 Bacteria 1329
6 Ga0070670_100050880 3300005331 Bacteria 3559
7 Ga0070670_100118470 3300005331 Bacteria 2283
8 Ga0070680_100247274 3300005336 Bacteria 1508
9 Ga0068868_100148189 3300005338 Bacteria 1931
10 Ga0070660_100023791 3300005339 Bacteria 4540
11 Ga0070661_100219300 3300005344 Bacteria 1459
12 Ga0070668_100018145 3300005347 Bacteria 5279
13 Ga0070669_100321429 3300005353 Bacteria 1250
14 Ga0070675_100153828 3300005354 Bacteria 1973
15 Ga0070674_100008242 3300005356 Bacteria 6193
16 Ga0070659_100268859 3300005366 Bacteria 1416
17 Ga0070703_10000006 3300005406 Bacteria 112467
18 Ga0070705_100108525 3300005440 Bacteria 1768
19 Ga0070705_100481656 3300005440 Unclassified 938
20 Ga0070694_100172756 3300005444 Bacteria 1593
21 Ga0070694_100274211 3300005444 Bacteria 1284
22 Ga0070708_100006371 3300005445 Bacteria 9398
23 Ga0070678_100648202 3300005456 Bacteria 947
24 Ga0070662_100197884 3300005457 Bacteria 1593
25 Ga0070681_10014422 3300005458 Bacteria 7865
26 Ga0070681_10026888 3300005458 Bacteria 5785
27 Ga0070681_10029974 3300005458 Bacteria 5460
28 Ga0068867_100318861 3300005459 Bacteria 1287
29 Ga0070685_10508493 3300005466 Bacteria 853
30 Ga0070706_100001317 3300005467 Bacteria 26389
31 Ga0070707_100162443 3300005468 Bacteria 2176
32 Ga0070698_100008429 3300005471 Bacteria 11141
33 Ga0070698_100035438 3300005471 Bacteria 5161
34 Ga0070679_100154649 3300005530 Bacteria 2269
35 Ga0070679_100227116 3300005530 Bacteria 1827
36 Ga0070684_100045573 3300005535 Bacteria 3797
37 Ga0070686_100087205 3300005544 Bacteria 2080
38 Ga0070686_100539941 3300005544 Bacteria 910
39 Ga0070695_100038190 3300005545 Unclassified 3028
40 Ga0070695_100101556 3300005545 Bacteria 1938
41 Ga0070696_100003641 3300005546 Bacteria 10269
42 Ga0068855_100037442 3300005563 Bacteria 5768
43 Ga0070702_100011399 3300005615 Bacteria 4421
44 Ga0070702_100113418 3300005615 Bacteria 1685
45 Ga0070702_100454463 3300005615 Bacteria 930
46 Ga0070702_100532577 3300005615 Bacteria 869
47 Ga0068866_10014586 3300005718 Bacteria 3474
48 Ga0068866_10025377 3300005718 Bacteria 2786
49 Ga0068861_100006721 3300005719 Bacteria 7857
50 Ga0068870_10023361 3300005840 Bacteria 3048
51 Ga0068870_10040308 3300005840 Bacteria 2421
52 Ga0068862_100497455 3300005844 Bacteria 1157
53 Ga0081455_10000939 3300005937 Bacteria 37256
54 Ga0081455_10001217 3300005937 Bacteria 32259
55 Ga0081455_10002382 3300005937 Bacteria 22442
56 Ga0081455_10138496 3300005937 Bacteria 1893
57 Ga0075432_10081103 3300006058 Bacteria 1176
58 Ga0075428_100024494 3300006844 Bacteria 6679
59 Ga0075428_100042066 3300006844 Bacteria 5025
60 Ga0075433_10180678 3300006852 Bacteria 1877
61 Ga0075433_10202748 3300006852 Bacteria 1763
62 Ga0075434_100051288 3300006871 Bacteria 4100
63 Ga0075434_100124457 3300006871 Bacteria 2595
64 Ga0075435_100483825 3300007076 Bacteria 1069
65 Ga0105240_10235004 3300009093 Bacteria 2128
66 Ga0105240_10347531 3300009093 Bacteria 1683
67 Ga0111539_10462904 3300009094 Bacteria 1477
68 Ga0111539_10621362 3300009094 Bacteria 1258
69 Ga0111539_11192583 3300009094 Bacteria 884
70 Ga0105245_10039538 3300009098 Bacteria 4198
71 Ga0105245_10186566 3300009098 Bacteria 1984
72 Ga0105245_10624671 3300009098 Bacteria 1106
73 Ga0114129_10005523 3300009147 Bacteria 17884
74 Ga0114129_10123946 3300009147 Bacteria 3554
75 Ga0114129_10291785 3300009147 Bacteria 2176
76 Ga0114129_11549927 3300009147 Bacteria 813
77 Ga0105243_10006217 3300009148 Bacteria 9232
78 Ga0105243_10063451 3300009148 Bacteria 2960
79 Ga0105243_10157567 3300009148 Bacteria 1954
80 Ga0105242_10011463 3300009176 Bacteria 6816
81 Ga0105242_10102531 3300009176 Bacteria 2427
82 Ga0105242_10246746 3300009176 Bacteria 1607
83 Ga0105242_10678817 3300009176 Bacteria 1005
84 Ga0105249_10093955 3300009553 Bacteria 2810
85 Ga0105249_10188446 3300009553 Bacteria 2012
86 Ga0105239_10229639 3300010375 Bacteria 2082
87 Ga0105246_10124577 3300011119 Bacteria 1915
88 Ga0105246_10332264 3300011119 Bacteria 1239
89 Ga0157378_10007891 3300013297 Bacteria 9292
90 Ga0157378_10915108 3300013297 Unclassified 908
91 Ga0163162_10117899 3300013306 Bacteria 2756
92 Ga0157372_10049987 3300013307 Bacteria 4651
93 Ga0157372_10507213 3300013307 Bacteria 1406
94 Ga0157375_10007198 3300013308 Bacteria 9726
95 Ga0157380_10576795 3300014326 Bacteria 1108
96 Ga0157380_10668051 3300014326 Bacteria 1039
97 Ga0182008_10001322 3300014497 Bacteria 16890
98 Ga0182007_10045654 3300015262 Bacteria 1452
99 Ga0163161_10030060 3300017792 Bacteria 3864
100 Ga0206353_10133853 3300020082 Bacteria 3472
101 Ga0207653_10000059 3300025885 Bacteria 85313
102 Ga0207642_10100285 3300025899 Bacteria 1452
103 Ga0207688_10036459 3300025901 Bacteria 2725
104 Ga0207643_10021635 3300025908 Bacteria 3536
105 Ga0207643_10185399 3300025908 Bacteria 1261
106 Ga0207684_10000865 3300025910 Bacteria 34576
107 Ga0207707_10027306 3300025912 Bacteria 4992
108 Ga0207693_10124793 3300025915 Bacteria 2023
109 Ga0207660_10055145 3300025917 Bacteria 2839
110 Ga0207657_10002639 3300025919 Bacteria 19358
111 Ga0207652_10076332 3300025921 Bacteria 2922
112 Ga0207652_10304626 3300025921 Bacteria 1438
113 Ga0207646_10029646 3300025922 Bacteria 4969
114 Ga0207646_10038543 3300025922 Bacteria 4304
115 Ga0207650_10138807 3300025925 Bacteria 1909
116 Ga0207659_10108455 3300025926 Bacteria 2106
117 Ga0207687_10048974 3300025927 Bacteria 2936
118 Ga0207664_10087977 3300025929 Bacteria 2541
119 Ga0207706_10042989 3300025933 Bacteria 4005
120 Ga0207706_10154210 3300025933 Bacteria 2021
121 Ga0207686_10006152 3300025934 Bacteria 6449
122 Ga0207686_10467710 3300025934 Bacteria 973
123 Ga0207709_10078107 3300025935 Bacteria 2124
124 Ga0207709_10277775 3300025935 Bacteria 1236
125 Ga0207691_10263247 3300025940 Bacteria 1486
126 Ga0207661_10048862 3300025944 Bacteria 3364
127 Ga0207661_10626916 3300025944 Unclassified 988
128 Ga0207661_10900064 3300025944 Bacteria 815
129 Ga0207667_10834631 3300025949 Bacteria 916
130 Ga0207712_10035460 3300025961 Bacteria 3390
131 Ga0207712_10226422 3300025961 Bacteria 1498
132 Ga0207668_10131570 3300025972 Bacteria 1911
133 Ga0207677_10253952 3300026023 Bacteria 1429
134 Ga0207703_10151986 3300026035 Bacteria 2020
135 Ga0207708_10004014 3300026075 Bacteria 10826
136 Ga0207708_10321946 3300026075 Bacteria 1262
137 Ga0207676_10072733 3300026095 Bacteria 2765
138 Ga0207675_100015394 3300026118 Bacteria 7134
139 Ga0207675_100292008 3300026118 Bacteria 1586
140 Ga0207675_101282679 3300026118 Bacteria 753
141 Ga0207683_10027280 3300026121 Bacteria 4935
142 Ga0207428_10003682 3300027907 Bacteria 14749
143 Ga0268266_10081251 3300028379 Bacteria 2826
144 Ga0268265_10138573 3300028380 Bacteria 2034
145 Ga0265326_10013665 3300028558 Bacteria 2372
146 Ga0265334_10044582 3300028573 Bacteria 1721
147 Ga0265318_10000065 3300028577 Bacteria 102014
148 Ga0265322_10092065 3300028654 Bacteria 861
149 Ga0265338_10003947 3300028800 Bacteria 20441
150 Ga0265338_10066194 3300028800 Bacteria 3129
151 Ga0265338_10085927 3300028800 Bacteria 2620
152 Ga0265324_10012701 3300029957 Bacteria 3167
153 Ga0265332_10006048 3300031238 Bacteria 5527
154 Ga0265328_10006266 3300031239 Bacteria 5051
155 Ga0265325_10001733 3300031241 Bacteria 15141
156 Ga0265329_10027376 3300031242 Bacteria 1873
157 Ga0265340_10003106 3300031247 Bacteria 9418
158 Ga0265331_10014500 3300031250 Bacteria 4196
159 Ga0265327_10042130 3300031251 Bacteria 2453
160 Ga0265316_10130093 3300031344 Bacteria 1896
161 Ga0307410_10043939 3300031852 Bacteria 2964
162 Ga0307416_100039978 3300032002 Bacteria 3637
163 Ga0307414_10043019 3300032004 Bacteria 3074
164 Ga0307415_100018665 3300032126 Bacteria 4194
165 Ga0373960_0027969 3300035121 Archaea 1553
166 Ga0373933_0035550 3300035724 Bacteria 2910
167 Ga0373933_0207351 3300035724 Bacteria 1255
168 Ga0373937_0549497 3300036401 Bacteria 1097
169 Ga0395899_0020743 3300037312 Bacteria 4983
170 Ga0395899_0048636 3300037312 Bacteria 3155
171 Ga0395899_0151527 3300037312 Bacteria 1643
172 Ga0395899_0281820 3300037312 Bacteria 1130
173 Ga0395900_0002097 3300037418 Bacteria 22353
174 Ga0395900_0006650 3300037418 Bacteria 12019
175 Ga0395900_0012240 3300037418 Bacteria 8771
176 Ga0395900_0016155 3300037418 Bacteria 7604
177 Ga0395900_0034634 3300037418 Bacteria 5201
178 Ga0395900_0068025 3300037418 Bacteria 3660
179 Ga0395900_0323490 3300037418 Bacteria 1522
180 Ga0395900_0764220 3300037418 Bacteria 896
181 Ga0395898_0002877 3300037466 Bacteria 19647
182 Ga0395898_0003008 3300037466 Bacteria 19112
183 Ga0395898_0047011 3300037466 Bacteria 4237
184 Ga0395898_0061510 3300037466 Bacteria 3648
185 Ga0395898_1072520 3300037466 Bacteria 740
186 Ga0395905_0000636 3300037471 Bacteria 46887
187 Ga0395905_0007029 3300037471 Bacteria 11246
188 Ga0395905_0009466 3300037471 Bacteria 9518
189 Ga0395905_0010922 3300037471 Bacteria 8788
190 Ga0395901_0000760 3300038443 Bacteria 36166
191 Ga0395901_0001778 3300038443 Bacteria 22243
192 Ga0395901_0032301 3300038443 Bacteria 5401
193 Ga0395901_0114308 3300038443 Bacteria 2835
194 Ga0395901_0267153 3300038443 Bacteria 1780
195 Ga0395901_0416533 3300038443 Bacteria 1378
196 Ga0395901_0740486 3300038443 Bacteria 977
197 Ga0439463_058900 3300042016 Bacteria 982
198 Ga0466969_0003103 3300044656 Bacteria 8853
199 Ga0466966_0215880 3300044684 Bacteria 1159
200 Ga0466966_0217575 3300044684 Bacteria 1154
201 Ga0466966_0257475 3300044684 Unclassified 1051
202 Ga0466963_0012152 3300044694 Bacteria 5263
203 Ga0466963_0074863 3300044694 Bacteria 2284
204 Ga0466963_0081220 3300044694 Bacteria 2195
205 Ga0466964_0024378 3300044706 Bacteria 2358
206 Ga0466964_0103099 3300044706 Bacteria 1261
207 Ga0466957_0029509 3300044842 Bacteria 3271
208 Ga0466957_0151747 3300044842 Bacteria 1499
209 Ga0466959_0009430 3300045049 Bacteria 6943
210 Ga0466958_0001955 3300045836 Bacteria 10119
211 Ga0466958_0030612 3300045836 Bacteria 3198
212 Ga0466967_0003132 3300045976 Bacteria 10651
213 Ga0466967_0003404 3300045976 Bacteria 10369
214 Ga0466967_0072961 3300045976 Bacteria 3078
215 Ga0466967_0086903 3300045976 Bacteria 2834
216 Ga0466967_0104144 3300045976 Bacteria 2597
217 Ga0466967_0292606 3300045976 Bacteria 1565
218 Ga0466967_0518312 3300045976 Bacteria 1171
219 Ga0495603_0004393 3300046455 Bacteria 8403
220 Ga0495651_0020185 3300046462 Bacteria 5172
221 Ga0495651_0288443 3300046462 Bacteria 1106
222 Ga0495584_0182723 3300046491 Bacteria 1066
223 Ga0495584_0245786 3300046491 Bacteria 910
224 Ga0495594_0193434 3300046499 Bacteria 1159
225 Ga0495608_0067883 3300046511 Bacteria 2332
226 Ga0495628_0574314 3300046516 Bacteria 807
227 Ga0495630_0147268 3300046517 Bacteria 1791
228 Ga0495656_0030130 3300046615 Bacteria 2191
229 Ga0495668_0178944 3300046616 Bacteria 1162
230 Ga0495657_0044288 3300046675 Bacteria 3028
231 Ga0495646_0040781 3300046680 Bacteria 2857
232 Ga0495658_0248692 3300046683 Unclassified 1118
233 Ga0495670_0282432 3300046691 Bacteria 888
234 Ga0495589_0282755 3300046794 Bacteria 771
235 Ga0495600_0057989 3300046809 Bacteria 2529
236 Ga0495674_0082458 3300047319 Bacteria 2757
237 Ga0495680_0036412 3300047322 Bacteria 3950
238 Ga0495675_0171387 3300047444 Bacteria 1333
239 Ga0495684_0011738 3300047471 Bacteria 6762
240 Ga0495684_0046048 3300047471 Bacteria 3337
241 Ga0495684_0239391 3300047471 Bacteria 1324
242 Ga0496101_0025478 3300048904 Bacteria 4105
243 Ga0496104_0019512 3300048907 Bacteria 6205
244 Ga0496104_0025861 3300048907 Bacteria 5413
245 Ga0496104_0232987 3300048907 Bacteria 1753
246 Ga0496104_0924086 3300048907 Bacteria 777
247 Ga0496105_0001176 3300048908 Bacteria 18219
248 Ga0496105_0005309 3300048908 Bacteria 9768
249 Ga0496105_0729599 3300048908 Bacteria 758
250 Ga0496106_0030677 3300048909 Bacteria 4007
251 Ga0496107_0035506 3300048910 Bacteria 3573
252 Ga0496108_0012460 3300048911 Bacteria 6923
253 Ga0496108_0190935 3300048911 Bacteria 1775
254 Ga0496108_0224418 3300048911 Bacteria 1633
255 Ga0496108_0225357 3300048911 Bacteria 1629
256 Ga0496108_0277619 3300048911 Bacteria 1459
257 Ga0496108_0818819 3300048911 Bacteria 803
258 Ga0496109_0003799 3300048912 Bacteria 12605
259 Ga0496109_0011427 3300048912 Bacteria 7632
260 Ga0496109_0358183 3300048912 Bacteria 1378
261 Ga0496110_0285428 3300048913 Bacteria 1503
262 Ga0496111_0435510 3300048914 Bacteria 968
263 Ga0496112_0079376 3300048915 Bacteria 3246
264 Ga0496113_0137788 3300048916 Bacteria 1919
265 Ga0496113_0307356 3300048916 Bacteria 1270
266 Ga0496113_0331815 3300048916 Bacteria 1220
267 Ga0496114_0262144 3300048917 Bacteria 1522
268 Ga0501031_0013278 3300049568 Bacteria 5375
269 Ga0501033_0014533 3300049570 Bacteria 5977
270 Ga0501034_0018101 3300049571 Bacteria 7230
271 Ga0501036_0141098 3300049572 Bacteria 2033
272 Ga0501037_0083005 3300049573 Bacteria 2321
273 Ga0501038_0081128 3300049574 Bacteria 2733
274 Ga0501039_0012817 3300049575 Bacteria 6409
275 Ga0501040_0003335 3300049576 Bacteria 10380
276 Ga0501042_0008186 3300049578 Bacteria 6888
277 Ga0501042_0221445 3300049578 Bacteria 1365
278 Ga0501043_0106911 3300049579 Bacteria 2197
279 Ga0501047_0484719 3300049581 Bacteria 1064
280 Ga0501048_0005655 3300049582 Bacteria 9510
281 Ga0501048_0324422 3300049582 Bacteria 1097
282 Ga0501067_0100053 3300049583 Bacteria 1610
283 Ga0501067_0157678 3300049583 Bacteria 1264
284 Ga0501068_0152105 3300049584 Bacteria 1455
285 Ga0501068_0527509 3300049584 Bacteria 767
286 Ga0501069_0031129 3300049585 Bacteria 2933
287 Ga0501070_0010919 3300049586 Bacteria 7672
288 Ga0501070_0029240 3300049586 Bacteria 4622
289 Ga0501070_0087558 3300049586 Bacteria 2578
290 Ga0501071_0019002 3300049587 Bacteria 4767
291 Ga0501071_0073706 3300049587 Bacteria 2491
292 Ga0501072_0002909 3300049588 Bacteria 12886
293 Ga0501072_0065031 3300049588 Bacteria 2876
294 Ga0501073_0011172 3300049589 Bacteria 6566
295 Ga0501073_0039535 3300049589 Bacteria 3341
296 Ga0501074_0022915 3300049590 Bacteria 4541
297 Ga0501074_0025312 3300049590 Bacteria 4311
298 Ga0501074_0165783 3300049590 Bacteria 1577
299 Ga0501075_0015429 3300049591 Bacteria 5483
300 Ga0501075_0094479 3300049591 Bacteria 2270
301 Ga0501076_0021773 3300049592 Bacteria 4920
302 Ga0501076_0699042 3300049592 Bacteria 837
303 Ga0501077_0004462 3300049593 Bacteria 8501
304 Ga0501079_0007976 3300049741 Bacteria 8023
305 Ga0501080_0006255 3300049742 Bacteria 10685
306 Ga0501080_0008354 3300049742 Bacteria 9374
307 Ga0501080_0186788 3300049742 Bacteria 1905
308 Ga0501081_0035415 3300049743 Bacteria 3397
309 Ga0501081_0154050 3300049743 Bacteria 1653
310 Ga0501081_0243448 3300049743 Bacteria 1312
311 Ga0501083_0000383 3300049744 Bacteria 28055
312 Ga0501083_0082438 3300049744 Bacteria 2131
313 Ga0501035_0030874 3300049822 Bacteria 4881
314 Ga0501045_0029942 3300049824 Bacteria 3937
315 nmdc:mga05p37_14996_c1 3300050507 Bacteria 9303
316 nmdc:mga05p37_6114_c1 3300050507 Bacteria 14180
317 nmdc:mga05p37_817308_c1 3300050507 Bacteria 1017
318 nmdc:mga09592_383462_c1 3300050508 Bacteria 1215
319 nmdc:mga08y16_190936_c1 3300050511 Bacteria 2125
320 nmdc:mga08y16_343863_c1 3300050511 Bacteria 1533
321 nmdc:mga08y16_34463_c1 3300050511 Bacteria 5318
322 nmdc:mga0n895_124422_c1 3300050512 Bacteria 2602
323 nmdc:mga0rr50_141728_c1 3300050513 Bacteria 1934
324 nmdc:mga0rr50_337872_c1 3300050513 Bacteria 1265
325 nmdc:mga0rr50_425572_c1 3300050513 Bacteria 1124
326 nmdc:mga0rr50_6675_c1 3300050513 Bacteria 7057
327 nmdc:mga0a205_144380_c1 3300050515 Bacteria 2280
328 nmdc:mga0a205_62429_c1 3300050515 Bacteria 3600
329 Ga0495595_0114992 3300053084 Unclassified 1307
330 Ga0495619_0084018 3300053085 Bacteria 2148
331 Ga0501084_0013488 3300054114 Bacteria 6763
332 Ga0501082_0014777 3300060353 Bacteria 6722
333 Ga0501082_0166807 3300060353 Bacteria 1914
334 Ga0501082_0504229 3300060353 Bacteria 1058
335 Ga0530510_0010895 3300061734 Bacteria 6378
336 Ga0105239_10227445
337 Ga0070676_10149514
338 Ga0070683_100007102
339 Ga0070683_100007974
340 Ga0070683_100389494
341 Ga0070670_100050880
342 Ga0070670_100118470
343 Ga0070680_100247274
344 Ga0068868_100148189
345 Ga0070660_100023791
346 Ga0070661_100219300
347 Ga0070668_100018145
348 Ga0070669_100321429
349 Ga0070675_100153828
350 Ga0070674_100008242
351 Ga0070659_100268859
352 Ga0070703_10000006
353 Ga0070705_100108525
354 Ga0070705_100481656
355 Ga0070694_100172756
356 Ga0070694_100274211
357 Ga0070708_100006371
358 Ga0070678_100648202
359 Ga0070662_100197884
360 Ga0070681_10014422
361 Ga0070681_10026888
362 Ga0070681_10029974
363 Ga0068867_100318861
364 Ga0070685_10508493
365 Ga0070706_100001317
366 Ga0070707_100162443
367 Ga0070698_100008429
368 Ga0070698_100035438
369 Ga0070679_100154649
370 Ga0070679_100227116
371 Ga0070684_100045573
372 Ga0070686_100087205
373 Ga0070686_100539941
374 Ga0070695_100038190
375 Ga0070695_100101556
376 Ga0070696_100003641
377 Ga0068855_100037442
378 Ga0070702_100011399
379 Ga0070702_100113418
380 Ga0070702_100454463
381 Ga0070702_100532577
382 Ga0068866_10014586
383 Ga0068866_10025377
384 Ga0068861_100006721
385 Ga0068870_10023361
386 Ga0068870_10040308
387 Ga0068862_100497455
388 Ga0081455_10000939
389 Ga0081455_10001217
390 Ga0081455_10002382
391 Ga0081455_10138496
392 Ga0075432_10081103
393 Ga0075428_100024494
394 Ga0075428_100042066
395 Ga0075433_10180678
396 Ga0075433_10202748
397 Ga0075434_100051288
398 Ga0075434_100124457
399 Ga0075435_100483825
400 Ga0105240_10235004
401 Ga0105240_10347531
402 Ga0111539_10462904
403 Ga0111539_10621362
404 Ga0111539_11192583
405 Ga0105245_10039538
406 Ga0105245_10186566
407 Ga0105245_10624671
408 Ga0114129_10005523
409 Ga0114129_10123946
410 Ga0114129_10291785
411 Ga0114129_11549927
412 Ga0105243_10006217
413 Ga0105243_10063451
414 Ga0105243_10157567
415 Ga0105242_10011463
416 Ga0105242_10102531
417 Ga0105242_10246746
418 Ga0105242_10678817
419 Ga0105249_10093955
420 Ga0105249_10188446
421 Ga0105239_10229639
422 Ga0105246_10124577
423 Ga0105246_10332264
424 Ga0157378_10007891
425 Ga0157378_10915108
426 Ga0163162_10117899
427 Ga0157372_10049987
428 Ga0157372_10507213
429 Ga0157375_10007198
430 Ga0157380_10576795
431 Ga0157380_10668051
432 Ga0182008_10001322
433 Ga0182007_10045654
434 Ga0163161_10030060
435 Ga0206353_10133853
436 Ga0207653_10000059
437 Ga0207642_10100285
438 Ga0207688_10036459
439 Ga0207643_10021635
440 Ga0207643_10185399
441 Ga0207684_10000865
442 Ga0207707_10027306
443 Ga0207693_10124793
444 Ga0207660_10055145
445 Ga0207657_10002639
446 Ga0207652_10076332
447 Ga0207652_10304626
448 Ga0207646_10029646
449 Ga0207646_10038543
450 Ga0207650_10138807
451 Ga0207659_10108455
452 Ga0207687_10048974
453 Ga0207664_10087977
454 Ga0207706_10042989
455 Ga0207706_10154210
456 Ga0207686_10006152
457 Ga0207686_10467710
458 Ga0207709_10078107
459 Ga0207709_10277775
460 Ga0207691_10263247
461 Ga0207661_10048862
462 Ga0207661_10626916
463 Ga0207661_10900064
464 Ga0207667_10834631
465 Ga0207712_10035460
466 Ga0207712_10226422
467 Ga0207668_10131570
468 Ga0207677_10253952
469 Ga0207703_10151986
470 Ga0207708_10004014
471 Ga0207708_10321946
472 Ga0207676_10072733
473 Ga0207675_100015394
474 Ga0207675_100292008
475 Ga0207675_101282679
476 Ga0207683_10027280
477 Ga0207428_10003682
478 Ga0268266_10081251
479 Ga0268265_10138573
480 Ga0265326_10013665
481 Ga0265334_10044582
482 Ga0265318_10000065
483 Ga0265322_10092065
484 Ga0265338_10003947
485 Ga0265338_10066194
486 Ga0265338_10085927
487 Ga0265324_10012701
488 Ga0265332_10006048
489 Ga0265328_10006266
490 Ga0265325_10001733
491 Ga0265329_10027376
492 Ga0265340_10003106
493 Ga0265331_10014500
494 Ga0265327_10042130
495 Ga0265316_10130093
496 Ga0307410_10043939
497 Ga0307416_100039978
498 Ga0307414_10043019
499 Ga0307415_100018665
500 Ga0373960_0027969
501 Ga0373933_0035550
502 Ga0373933_0207351
503 Ga0373937_0549497
504 Ga0395899_0020743
505 Ga0395899_0048636
506 Ga0395899_0151527
507 Ga0395899_0281820
508 Ga0395900_0002097
509 Ga0395900_0006650
510 Ga0395900_0012240
511 Ga0395900_0016155
512 Ga0395900_0034634
513 Ga0395900_0068025
514 Ga0395900_0323490
515 Ga0395900_0764220
516 Ga0395898_0002877
517 Ga0395898_0003008
518 Ga0395898_0047011
519 Ga0395898_0061510
520 Ga0395898_1072520
521 Ga0395905_0000636
522 Ga0395905_0007029
523 Ga0395905_0009466
524 Ga0395905_0010922
525 Ga0395901_0000760
526 Ga0395901_0001778
527 Ga0395901_0032301
528 Ga0395901_0114308
529 Ga0395901_0267153
530 Ga0395901_0416533
531 Ga0395901_0740486
532 Ga0439463_058900
533 Ga0466969_0003103
534 Ga0466966_0215880
535 Ga0466966_0217575
536 Ga0466966_0257475
537 Ga0466963_0012152
538 Ga0466963_0074863
539 Ga0466963_0081220
540 Ga0466964_0024378
541 Ga0466964_0103099
542 Ga0466957_0029509
543 Ga0466957_0151747
544 Ga0466959_0009430
545 Ga0466958_0001955
546 Ga0466958_0030612
547 Ga0466967_0003132
548 Ga0466967_0003404
549 Ga0466967_0072961
550 Ga0466967_0086903
551 Ga0466967_0104144
552 Ga0466967_0292606
553 Ga0466967_0518312
554 Ga0495603_0004393
555 Ga0495651_0020185
556 Ga0495651_0288443
557 Ga0495584_0182723
558 Ga0495584_0245786
559 Ga0495594_0193434
560 Ga0495608_0067883
561 Ga0495628_0574314
562 Ga0495630_0147268
563 Ga0495656_0030130
564 Ga0495668_0178944
565 Ga0495657_0044288
566 Ga0495646_0040781
567 Ga0495658_0248692
568 Ga0495670_0282432
569 Ga0495589_0282755
570 Ga0495600_0057989
571 Ga0495674_0082458
572 Ga0495680_0036412
573 Ga0495675_0171387
574 Ga0495684_0011738
575 Ga0495684_0046048
576 Ga0495684_0239391
577 Ga0496101_0025478
578 Ga0496104_0019512
579 Ga0496104_0025861
580 Ga0496104_0232987
581 Ga0496104_0924086
582 Ga0496105_0001176
583 Ga0496105_0005309
584 Ga0496105_0729599
585 Ga0496106_0030677
586 Ga0496107_0035506
587 Ga0496108_0012460
588 Ga0496108_0190935
589 Ga0496108_0224418
590 Ga0496108_0225357
591 Ga0496108_0277619
592 Ga0496108_0818819
593 Ga0496109_0003799
594 Ga0496109_0011427
595 Ga0496109_0358183
596 Ga0496110_0285428
597 Ga0496111_0435510
598 Ga0496112_0079376
599 Ga0496113_0137788
600 Ga0496113_0307356
601 Ga0496113_0331815
602 Ga0496114_0262144
603 Ga0501031_0013278
604 Ga0501033_0014533
605 Ga0501034_0018101
606 Ga0501036_0141098
607 Ga0501037_0083005
608 Ga0501038_0081128
609 Ga0501039_0012817
610 Ga0501040_0003335
611 Ga0501042_0008186
612 Ga0501042_0221445
613 Ga0501043_0106911
614 Ga0501047_0484719
615 Ga0501048_0005655
616 Ga0501048_0324422
617 Ga0501067_0100053
618 Ga0501067_0157678
619 Ga0501068_0152105
620 Ga0501068_0527509
621 Ga0501069_0031129
622 Ga0501070_0010919
623 Ga0501070_0029240
624 Ga0501070_0087558
625 Ga0501071_0019002
626 Ga0501071_0073706
627 Ga0501072_0002909
628 Ga0501072_0065031
629 Ga0501073_0011172
630 Ga0501073_0039535
631 Ga0501074_0022915
632 Ga0501074_0025312
633 Ga0501074_0165783
634 Ga0501075_0015429
635 Ga0501075_0094479
636 Ga0501076_0021773
637 Ga0501076_0699042
638 Ga0501077_0004462
639 Ga0501079_0007976
640 Ga0501080_0006255
641 Ga0501080_0008354
642 Ga0501080_0186788
643 Ga0501081_0035415
644 Ga0501081_0154050
645 Ga0501081_0243448
646 Ga0501083_0000383
647 Ga0501083_0082438
648 Ga0501035_0030874
649 Ga0501045_0029942
650 nmdc:mga05p37_14996_c1
651 nmdc:mga05p37_6114_c1
652 nmdc:mga05p37_817308_c1
653 nmdc:mga09592_383462_c1
654 nmdc:mga08y16_190936_c1
655 nmdc:mga08y16_343863_c1
656 nmdc:mga08y16_34463_c1
657 nmdc:mga0n895_124422_c1
658 nmdc:mga0rr50_141728_c1
659 nmdc:mga0rr50_337872_c1
660 nmdc:mga0rr50_425572_c1
661 nmdc:mga0rr50_6675_c1
662 nmdc:mga0a205_144380_c1
663 nmdc:mga0a205_62429_c1
664 Ga0495595_0114992
665 Ga0495619_0084018
666 Ga0501084_0013488
667 Ga0501082_0014777
668 Ga0501082_0166807
669 Ga0501082_0504229
670 Ga0530510_0010895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

2

115

0.9

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

118

251

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c3v-assembly1.cif.gz_A dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc 0.9187 1 206
1c3v-assembly1.cif.gz_A dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc 0.9144 1 206
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.8987 1 206
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.8947 1 206
5tej-assembly1.cif.gz_A structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh 0.8438 2 205
ID Description Score Start End Superfamily
1c3vA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9672 96 174 3.30.360.10
1vm6D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9301 96 174 3.30.360.10
3qy9A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9076 96 174 3.30.360.10
1vm6D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.878 96 174 3.30.360.10
6bdxA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8744 96 174 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A661FX19-F1-model_v4 Dihydrodipicolinate reductase C-terminal domain-containing protein 0.9816 87 205 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A6J7TID5-F1-model_v4 Unannotated protein 0.9716 90 205 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A7W0TR92-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) 0.9616 1 168 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A7V9I5Y5-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) 0.9561 2 206 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A538MAL1-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) 0.9539 42 206 GO:0005829
GO:0008839
GO:0009089
GO:0019877

Map