F412211

General Info

Members Datasets Scaffolds Average Seq Length
335 221 326 250

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10007346|Ga0105240_100073463
Length 287
Sequence MDAHSPIADFAFPPCRHADKAGSGNCVLRLVFARNREKDQNMLQGKTALITGGSSGIGLTTAKLFKQNGARVAITGTDPAKLERARTEIGGDTVAIRADVQSIADLTRMAEETKAAFGHLDIFFANAGAAAASPLGGTDEAVYTRLMDINVKGVFFSVQAVVPLMGKGGSIILNSSWLDLRGVAGRGILSASKAAVRSFARTFAAELAPKGIRVNAVSPGSIITPLHRGGRSDEDFNAYAEATAKIIPAGRMGQPEDIANAVLFLASDKSSYVLGAEIIVDGGRAEL

Samples

Sample ID Description Type Environment
1 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
4 2818991452 Burkholderia cepacia 561 Isolate Unclassified
5 2928170801 Burkholderia sp. 572 Isolate Unclassified
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
152 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
219 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
220 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
221 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0
Rhizoplane 3.58
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 6.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10048043 3300001990 Bacteria 1300
2 JGI24737J22298_10097318 3300001990 Unclassified 872
3 JGI24735J21928_10004511 3300002067 Bacteria 4682
4 JGI25165J46597_1000210 3300003214 Bacteria 83572
5 rootH2_10127295 3300003320 Bacteria 1325
6 rootL2_10121414 3300003322 Bacteria 1370
7 Ga0055532_1000095 3300003758 Bacteria 99346
8 Ga0055532_1001537 3300003758 Bacteria 6230
9 Ga0055527_1000874 3300003760 Bacteria 7787
10 Ga0055542_1003170 3300003762 Bacteria 4659
11 Ga0070658_10000195 3300005327 Bacteria 53384
12 Ga0070658_10012411 3300005327 Bacteria 6836
13 Ga0070658_10035161 3300005327 Bacteria 4035
14 Ga0070658_10263170 3300005327 Bacteria 1465
15 Ga0070676_10000055 3300005328 Bacteria 36943
16 Ga0070676_10127721 3300005328 Bacteria 1604
17 Ga0068869_100002763 3300005334 Bacteria 10632
18 Ga0070666_10128747 3300005335 Bacteria 1758
19 Ga0070680_100010111 3300005336 Bacteria 7274
20 Ga0068868_100000880 3300005338 Bacteria 20394
21 Ga0070660_100000417 3300005339 Bacteria 28356
22 Ga0070660_100024816 3300005339 Bacteria 4452
23 Ga0070660_100123040 3300005339 Bacteria 2071
24 Ga0070689_100464455 3300005340 Bacteria 1079
25 Ga0070661_100202845 3300005344 Bacteria 1516
26 Ga0070675_100006424 3300005354 Bacteria 9022
27 Ga0070671_100025419 3300005355 Bacteria 4859
28 Ga0070671_100058454 3300005355 Bacteria 3210
29 Ga0070671_100204276 3300005355 Bacteria 1676
30 Ga0070674_100015987 3300005356 Bacteria 4697
31 Ga0070674_100036449 3300005356 Bacteria 3302
32 Ga0070673_100000014 3300005364 Bacteria 135250
33 Ga0070673_100473703 3300005364 Bacteria 1129
34 Ga0070688_100450466 3300005365 Bacteria 962
35 Ga0070659_100073580 3300005366 Bacteria 2720
36 Ga0070659_100263524 3300005366 Bacteria 1430
37 Ga0070667_100322636 3300005367 Bacteria 1394
38 Ga0070711_100019037 3300005439 Bacteria 4396
39 Ga0070708_100013832 3300005445 Bacteria 6625
40 Ga0070663_100000321 3300005455 Bacteria 24844
41 Ga0070678_100022998 3300005456 Bacteria 4145
42 Ga0070678_100063364 3300005456 Bacteria 2735
43 Ga0070662_100051712 3300005457 Bacteria 2968
44 Ga0070662_100139356 3300005457 Bacteria 1878
45 Ga0068867_100000002 3300005459 Bacteria 247206
46 Ga0070698_100632930 3300005471 Bacteria 1011
47 Ga0070679_100173049 3300005530 Bacteria 2132
48 Ga0068853_100006045 3300005539 Bacteria 9577
49 Ga0068853_100038960 3300005539 Bacteria 4051
50 Ga0068853_100410425 3300005539 Bacteria 1269
51 Ga0070672_100149245 3300005543 Bacteria 1933
52 Ga0070696_100107327 3300005546 Bacteria 2008
53 Ga0070665_100161434 3300005548 Bacteria 2243
54 Ga0068855_100000117 3300005563 Bacteria 99215
55 Ga0068855_100099503 3300005563 Bacteria 3349
56 Ga0068855_100302378 3300005563 Bacteria 1771
57 Ga0070664_100028181 3300005564 Bacteria 4671
58 Ga0068857_100033850 3300005577 Bacteria 4520
59 Ga0068854_100003771 3300005578 Bacteria 9475
60 Ga0068854_100319164 3300005578 Unclassified 1262
61 Ga0068856_100118727 3300005614 Bacteria 2645
62 Ga0070702_100174720 3300005615 Bacteria 1400
63 Ga0068852_100256298 3300005616 Bacteria 1678
64 Ga0068851_10087242 3300005834 Bacteria 1638
65 Ga0070717_10306652 3300006028 Unclassified 1412
66 Ga0075365_10043003 3300006038 Bacteria 2956
67 Ga0075362_10043691 3300006177 Bacteria 1985
68 Ga0075367_10002673 3300006178 Bacteria 8217
69 Ga0075366_10006172 3300006195 Bacteria 6541
70 Ga0075366_10053281 3300006195 Bacteria 2403
71 Ga0097621_100011863 3300006237 Bacteria 6442
72 Ga0097621_100041509 3300006237 Bacteria 3704
73 Ga0068871_100010301 3300006358 Bacteria 6814
74 Ga0068871_100142595 3300006358 Bacteria 2038
75 Ga0068871_100190770 3300006358 Bacteria 1765
76 Ga0075433_10087465 3300006852 Bacteria 2752
77 Ga0075434_100091837 3300006871 Bacteria 3038
78 Ga0068865_100000016 3300006881 Bacteria 121076
79 Ga0068865_100050945 3300006881 Bacteria 2863
80 Ga0075435_100635397 3300007076 Bacteria 926
81 Ga0099794_10223575 3300007265 Bacteria 967
82 Ga0105240_10007346 3300009093 Bacteria 16029
83 Ga0105240_10016911 3300009093 Bacteria 9858
84 Ga0105240_10021703 3300009093 Bacteria 8535
85 Ga0105240_10096985 3300009093 Bacteria 3592
86 Ga0105240_10120451 3300009093 Bacteria 3160
87 Ga0105240_10213933 3300009093 Bacteria 2250
88 Ga0105240_10226059 3300009093 Bacteria 2178
89 Ga0105240_10336959 3300009093 Bacteria 1714
90 Ga0105240_10495619 3300009093 Bacteria 1359
91 Ga0105247_10025407 3300009101 Bacteria 3573
92 Ga0114129_10003415 3300009147 Bacteria 22327
93 Ga0105243_10000153 3300009148 Bacteria 79345
94 Ga0105241_10089696 3300009174 Bacteria 2423
95 Ga0105241_10119381 3300009174 Bacteria 2121
96 Ga0105242_10000576 3300009176 Bacteria 29054
97 Ga0105242_10081276 3300009176 Bacteria 2710
98 Ga0105248_10022161 3300009177 Bacteria 7041
99 Ga0105248_10043559 3300009177 Bacteria 5032
100 Ga0105237_10048635 3300009545 Bacteria 4262
101 Ga0105237_10302065 3300009545 Bacteria 1604
102 Ga0105237_10351040 3300009545 Bacteria 1479
103 Ga0105238_10010614 3300009551 Bacteria 9248
104 Ga0105238_10262528 3300009551 Bacteria 1706
105 Ga0105249_10141784 3300009553 Bacteria 2305
106 Ga0105239_10004808 3300010375 Bacteria 16027
107 Ga0105239_10005847 3300010375 Bacteria 14338
108 Ga0105239_10028213 3300010375 Bacteria 6174
109 Ga0105239_10090024 3300010375 Bacteria 3385
110 Ga0105246_10006210 3300011119 Bacteria 7293
111 Ga0157373_10052698 3300013100 Bacteria 2894
112 Ga0157373_10062185 3300013100 Bacteria 2644
113 Ga0157370_10001451 3300013104 Bacteria 29348
114 Ga0157370_10350437 3300013104 Bacteria 1361
115 Ga0157370_10479802 3300013104 Bacteria 1143
116 Ga0157369_10002083 3300013105 Bacteria 24186
117 Ga0157369_10085693 3300013105 Bacteria 3366
118 Ga0157374_10002131 3300013296 Bacteria 16669
119 Ga0157374_10104947 3300013296 Bacteria 2713
120 Ga0157378_10001055 3300013297 Bacteria 25232
121 Ga0157378_10008353 3300013297 Bacteria 9018
122 Ga0157378_10037671 3300013297 Bacteria 4285
123 Ga0163162_10174188 3300013306 Bacteria 2276
124 Ga0157372_10020880 3300013307 Bacteria 7070
125 Ga0157372_10024714 3300013307 Bacteria 6530
126 Ga0157372_10273052 3300013307 Bacteria 1965
127 Ga0157375_10003669 3300013308 Bacteria 13323
128 Ga0157375_10149842 3300013308 Bacteria 2467
129 Ga0157377_10005322 3300014745 Bacteria 6037
130 Ga0157377_10269694 3300014745 Bacteria 1111
131 Ga0157379_10023319 3300014968 Bacteria 5492
132 Ga0157376_10000063 3300014969 Bacteria 87227
133 Ga0157376_10020551 3300014969 Bacteria 5110
134 Ga0157376_10031847 3300014969 Bacteria 4228
135 Ga0157376_10117877 3300014969 Bacteria 2348
136 Ga0157376_10664250 3300014969 Bacteria 1044
137 Ga0163161_10039133 3300017792 Bacteria 3403
138 Ga0209148_1000146 3300025254 Bacteria 160734
139 Ga0209148_1000494 3300025254 Bacteria 40351
140 Ga0209233_1000003 3300025261 Bacteria 1607366
141 Ga0209455_1001627 3300025272 Bacteria 9809
142 Ga0209455_1011983 3300025272 Bacteria 2101
143 Ga0209025_1049507 3300025294 Bacteria 1690
144 Ga0209758_1005346 3300025297 Bacteria 9968
145 Ga0207680_10035655 3300025903 Bacteria 2858
146 Ga0207647_10083962 3300025904 Bacteria 1907
147 Ga0207645_10000235 3300025907 Bacteria 45958
148 Ga0207705_10000025 3300025909 Bacteria 259826
149 Ga0207705_10000700 3300025909 Bacteria 27676
150 Ga0207705_10003748 3300025909 Bacteria 11581
151 Ga0207705_10087665 3300025909 Bacteria 2276
152 Ga0207705_10093376 3300025909 Bacteria 2206
153 Ga0207654_10067244 3300025911 Bacteria 2116
154 Ga0207707_10027804 3300025912 Bacteria 4944
155 Ga0207695_10003426 3300025913 Bacteria 22378
156 Ga0207695_10004762 3300025913 Bacteria 18353
157 Ga0207695_10015070 3300025913 Bacteria 9119
158 Ga0207695_10041317 3300025913 Bacteria 4936
159 Ga0207695_10095796 3300025913 Bacteria 2971
160 Ga0207695_10239410 3300025913 Bacteria 1716
161 Ga0207671_10247428 3300025914 Bacteria 1401
162 Ga0207663_10148410 3300025916 Bacteria 1642
163 Ga0207657_10001398 3300025919 Bacteria 25716
164 Ga0207657_10034829 3300025919 Bacteria 4521
165 Ga0207657_10079084 3300025919 Bacteria 2767
166 Ga0207657_10213073 3300025919 Bacteria 1550
167 Ga0207649_10053661 3300025920 Bacteria 2506
168 Ga0207649_10256180 3300025920 Bacteria 1263
169 Ga0207652_10078564 3300025921 Bacteria 2882
170 Ga0207694_10008468 3300025924 Bacteria 7764
171 Ga0207694_10057653 3300025924 Bacteria 3019
172 Ga0207694_10153508 3300025924 Bacteria 1856
173 Ga0207687_10002157 3300025927 Bacteria 13418
174 Ga0207687_10004851 3300025927 Bacteria 8939
175 Ga0207644_10016390 3300025931 Bacteria 4984
176 Ga0207644_10147223 3300025931 Bacteria 1819
177 Ga0207690_10157987 3300025932 Bacteria 1687
178 Ga0207690_10337717 3300025932 Bacteria 1188
179 Ga0207706_10323625 3300025933 Bacteria 1342
180 Ga0207706_10653460 3300025933 Bacteria 900
181 Ga0207686_10000453 3300025934 Bacteria 27261
182 Ga0207686_10007584 3300025934 Bacteria 5844
183 Ga0207709_10000221 3300025935 Bacteria 72262
184 Ga0207669_10226431 3300025937 Bacteria 1376
185 Ga0207704_10057726 3300025938 Bacteria 2386
186 Ga0207691_10216951 3300025940 Bacteria 1660
187 Ga0207711_10004712 3300025941 Bacteria 11591
188 Ga0207711_10012337 3300025941 Bacteria 7103
189 Ga0207689_10000704 3300025942 Bacteria 32031
190 Ga0207667_10000017 3300025949 Bacteria 390654
191 Ga0207667_10155159 3300025949 Bacteria 2356
192 Ga0207667_10219755 3300025949 Bacteria 1947
193 Ga0207651_10000004 3300025960 Bacteria 290191
194 Ga0207640_10000388 3300025981 Bacteria 28091
195 Ga0207677_10000335 3300026023 Bacteria 33894
196 Ga0207639_10003292 3300026041 Bacteria 10871
197 Ga0207639_10032093 3300026041 Bacteria 3864
198 Ga0207639_10032435 3300026041 Bacteria 3845
199 Ga0207678_10000993 3300026067 Bacteria 25834
200 Ga0207678_10023906 3300026067 Bacteria 5343
201 Ga0207702_10014998 3300026078 Bacteria 6427
202 Ga0207702_10201610 3300026078 Bacteria 1845
203 Ga0207648_10000003 3300026089 Bacteria 289983
204 Ga0207674_10033508 3300026116 Bacteria 5377
205 Ga0207683_10152948 3300026121 Bacteria 2083
206 Ga0207683_10219937 3300026121 Bacteria 1730
207 Ga0207698_10214407 3300026142 Bacteria 1735
208 Ga0268266_10115868 3300028379 Bacteria 2379
209 Ga0268264_10200750 3300028381 Bacteria 1824
210 Ga0265338_10003758 3300028800 Bacteria 21091
211 Ga0265338_10012131 3300028800 Bacteria 9846
212 Ga0265331_10180544 3300031250 Bacteria 953
213 Ga0265316_10060102 3300031344 Bacteria 2954
214 Ga0265316_10109786 3300031344 Bacteria 2090
215 Ga0265314_10043406 3300031711 Bacteria 3197
216 Ga0265314_10043676 3300031711 Bacteria 3184
217 Ga0265342_10063382 3300031712 Bacteria 2173
218 Ga0307409_101094432 3300031995 Bacteria 818
219 Ga0307416_100710969 3300032002 Bacteria 1095
220 Ga0307414_10223405 3300032004 Bacteria 1548
221 Ga0373934_0122798 3300035086 Bacteria 1057
222 Ga0373956_0088125 3300035119 Bacteria 1430
223 Ga0373947_0050806 3300035725 Bacteria 2493
224 Ga0373937_0242960 3300036401 Bacteria 1696
225 Ga0373925_0084485 3300037068 Bacteria 2419
226 Ga0395899_0015855 3300037312 Bacteria 5746
227 Ga0395899_0059210 3300037312 Bacteria 2823
228 Ga0395900_0021152 3300037418 Bacteria 6649
229 Ga0395900_0060460 3300037418 Bacteria 3899
230 Ga0395900_0114222 3300037418 Bacteria 2771
231 Ga0395900_0326149 3300037418 Bacteria 1514
232 Ga0395898_0007559 3300037466 Bacteria 11538
233 Ga0395905_0021148 3300037471 Bacteria 6159
234 Ga0395905_0037266 3300037471 Bacteria 4566
235 Ga0395901_0038057 3300038443 Bacteria 4975
236 Ga0395901_0074695 3300038443 Bacteria 3536
237 Ga0395901_0187020 3300038443 Bacteria 2172
238 Ga0395901_0558236 3300038443 Bacteria 1160
239 Ga0436365_0984038 3300039437 Bacteria 20730
240 Ga0436362_0443248 3300039453 Bacteria 11291
241 Ga0439448_0006801 3300042005 Bacteria 3297
242 Ga0439448_0144774 3300042005 Bacteria 823
243 Ga0439455_0004960 3300042012 Bacteria 2674
244 Ga0439458_0002303 3300042157 Bacteria 4687
245 Ga0439458_0024129 3300042157 Bacteria 1420
246 Ga0450901_001994 3300042533 Bacteria 2263
247 Ga0466986_0161673 3300044650 Bacteria 1503
248 Ga0466965_0243197 3300044683 Bacteria 964
249 Ga0466966_0019665 3300044684 Bacteria 4442
250 Ga0466970_0279903 3300044765 Bacteria 938
251 Ga0495629_0118048 3300046459 Bacteria 1848
252 Ga0495651_0022821 3300046462 Bacteria 4865
253 Ga0495653_0053068 3300046463 Bacteria 3103
254 Ga0495580_0098178 3300046472 Bacteria 2037
255 Ga0495582_0009344 3300046473 Bacteria 5402
256 Ga0495607_0036428 3300046501 Bacteria 2964
257 Ga0495608_0046197 3300046511 Bacteria 2899
258 Ga0495663_0000447 3300046525 Bacteria 15080
259 Ga0495652_0324153 3300046529 Unclassified 1112
260 Ga0495587_0236858 3300046536 Bacteria 1027
261 Ga0495645_0020632 3300046543 Bacteria 4758
262 Ga0495633_0000513 3300046558 Bacteria 38945
263 Ga0495634_0080836 3300046642 Bacteria 2126
264 Ga0495634_0102335 3300046642 Bacteria 1850
265 Ga0495635_0039153 3300046663 Bacteria 3281
266 Ga0495657_0080033 3300046675 Bacteria 2115
267 Ga0495599_0186079 3300046678 Bacteria 1279
268 Ga0495658_0000599 3300046683 Bacteria 19756
269 Ga0495613_0140854 3300046689 Bacteria 1723
270 Ga0495649_0048764 3300046694 Bacteria 2302
271 Ga0495600_0054173 3300046809 Bacteria 2620
272 Ga0495604_0130064 3300047317 Bacteria 1811
273 Ga0495674_0203034 3300047319 Bacteria 1644
274 Ga0495680_0003189 3300047322 Bacteria 16321
275 Ga0495687_020209 3300047443 Bacteria 3250
276 Ga0495675_0076361 3300047444 Bacteria 2112
277 Ga0495684_0034555 3300047471 Bacteria 3879
278 Ga0495602_0086652 3300048088 Bacteria 2614
279 Ga0495602_0447989 3300048088 Bacteria 912
280 Ga0496100_0015629 3300048903 Bacteria 4435
281 Ga0496101_0002331 3300048904 Bacteria 11630
282 Ga0496101_0207662 3300048904 Bacteria 1516
283 Ga0496104_0206928 3300048907 Bacteria 1874
284 Ga0496106_0036201 3300048909 Bacteria 3692
285 Ga0496107_0018644 3300048910 Bacteria 4889
286 Ga0496107_0315805 3300048910 Bacteria 1163
287 Ga0496108_0349672 3300048911 Bacteria 1290
288 Ga0496110_0657738 3300048913 Bacteria 948
289 Ga0496114_0004932 3300048917 Bacteria 10399
290 Ga0496115_0000760 3300048918 Bacteria 23744
291 Ga0496117_0000428 3300048920 Bacteria 70517
292 Ga0496117_0004830 3300048920 Bacteria 14570
293 Ga0496117_0069796 3300048920 Bacteria 2364
294 Ga0496118_0002945 3300048921 Bacteria 22119
295 Ga0496118_0007195 3300048921 Bacteria 11897
296 Ga0496118_0016507 3300048921 Bacteria 6773
297 Ga0496118_0126762 3300048921 Bacteria 1649
298 Ga0496119_0038051 3300048922 Bacteria 3114
299 Ga0496121_0012102 3300048924 Bacteria 9479
300 Ga0496121_0037395 3300048924 Bacteria 4312
301 Ga0496122_0007811 3300048925 Bacteria 11753
302 Ga0496122_0012489 3300048925 Bacteria 8445
303 Ga0496123_0009369 3300048926 Bacteria 8827
304 Ga0496124_0011426 3300048927 Bacteria 8879
305 Ga0496124_0294463 3300048927 Bacteria 1176
306 Ga0496126_0000306 3300048929 Bacteria 104116
307 Ga0501033_0004557 3300049570 Bacteria 11095
308 Ga0501033_0245465 3300049570 Bacteria 1270
309 Ga0501034_0612974 3300049571 Bacteria 993
310 Ga0501043_0087536 3300049579 Bacteria 2448
311 Ga0501080_0178385 3300049742 Bacteria 1956
312 Ga0501035_0031899 3300049822 Bacteria 4798
313 Ga0501044_0147023 3300049823 Bacteria 2341
314 Ga0501044_0331556 3300049823 Bacteria 1444
315 nmdc:mga03683_16494_c1 3300050489 Bacteria 2776
316 nmdc:mga0yw44_249899_c1 3300050492 Bacteria 1180
317 nmdc:mga0k408_101220_c1 3300050493 Bacteria 1699
318 nmdc:mga06z11_14646_c1 3300050494 Bacteria 3480
319 nmdc:mga05p37_273_c1 3300050507 Bacteria 53725
320 nmdc:mga0n895_193282_c1 3300050512 Bacteria 2066
321 nmdc:mga0a205_208534_c1 3300050515 Bacteria 1843
322 Ga0495595_0014059 3300053084 Bacteria 3390
323 Ga0495619_0245729 3300053085 Bacteria 1240
324 Ga0500595_062045 3300053119 Bacteria 1126
325 Ga0500568_0025612 3300053139 Bacteria 2486
326 Ga0500616_0059433 3300053153 Bacteria 1985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100013832 Ga0070708_1000138322 214
2 3300009147 Ga0114129_10003415 Ga0114129_100034159 214
3 3300025934 Ga0207686_10007584 Ga0207686_100075842 214
4 3300050507 nmdc:mga05p37_273_c1 nmdc:mga05p37_273_c1_8255_8920 214
5 3300046472 Ga0495580_0098178 Ga0495580_0098178_21_701 215
6 3300007265 Ga0099794_10223575 Ga0099794_102235752 219
7 3300048088 Ga0495602_0447989 Ga0495602_0447989_105_896 219
8 3300038443 Ga0395901_0187020 Ga0395901_0187020_1400_2158 222
9 3300007076 Ga0075435_100635397 Ga0075435_1006353971 223
10 3300006871 Ga0075434_100091837 Ga0075434_1000918373 224
11 3300050512 nmdc:mga0n895_193282_c1 nmdc:mga0n895_193282_c1_1085_1843 224
12 iso_pu_bacteria 2599185239 2599739094 224
13 iso_pu_bacteria 2818991452 2819636179 224
14 iso_pu_bacteria 2928170801 2928176384 224
15 iso_pu_bacteria 8018845410 8018845486 224
16 iso_pu_bacteria 8021120328 8021125915 224
17 3300003758 Ga0055532_1001537 Ga0055532_10015372 227
18 3300003760 Ga0055527_1000874 Ga0055527_10008741 227
19 3300044650 Ga0466986_0161673 Ga0466986_0161673_294_1016 227
20 3300044684 Ga0466966_0019665 Ga0466966_0019665_2950_3672 227
21 3300003758 Ga0055532_1000095 Ga0055532_100009515 228
22 3300037312 Ga0395899_0059210 Ga0395899_0059210_1122_1880 228
23 3300037418 Ga0395900_0114222 Ga0395900_0114222_1706_2464 228
24 3300037471 Ga0395905_0037266 Ga0395905_0037266_2965_3723 228
25 3300038443 Ga0395901_0038057 Ga0395901_0038057_2915_3673 228
26 3300049570 Ga0501033_0004557 Ga0501033_0004557_4335_5075 228
27 3300049571 Ga0501034_0612974 Ga0501034_0612974_158_970 228
28 3300049579 Ga0501043_0087536 Ga0501043_0087536_1438_2178 228
29 3300049742 Ga0501080_0178385 Ga0501080_0178385_718_1458 228
30 3300049822 Ga0501035_0031899 Ga0501035_0031899_1927_2667 228
31 3300049823 Ga0501044_0147023 Ga0501044_0147023_1417_2157 228
32 3300025294 Ga0209025_1049507 Ga0209025_10495072 229
33 3300042005 Ga0439448_0144774 Ga0439448_0144774_22_780 229
34 3300037418 Ga0395900_0060460 Ga0395900_0060460_477_1199 231
35 3300048921 Ga0496118_0007195 Ga0496118_0007195_314_1063 231
36 3300031250 Ga0265331_10180544 Ga0265331_101805441 232
37 3300031344 Ga0265316_10109786 Ga0265316_101097863 232
38 3300031712 Ga0265342_10063382 Ga0265342_100633822 232
39 3300048913 Ga0496110_0657738 Ga0496110_0657738_179_913 232
40 3300039437 Ga0436365_0984038 Ga0436365_0984038_17285_18040 233
41 3300013104 Ga0157370_10479802 Ga0157370_104798022 235
42 3300046501 Ga0495607_0036428 Ga0495607_0036428_326_1075 235
43 iso_pu_bacteria 2582581280 2585153200 236
44 iso_pu_bacteria 2582581293 2585196890 236
45 3300039453 Ga0436362_0443248 Ga0436362_0443248_10294_11049 237
46 3300005344 Ga0070661_100202845 Ga0070661_1002028451 238
47 3300005355 Ga0070671_100058454 Ga0070671_1000584543 238
48 3300005616 Ga0068852_100256298 Ga0068852_1002562983 238
49 3300006237 Ga0097621_100041509 Ga0097621_1000415092 238
50 3300006358 Ga0068871_100010301 Ga0068871_1000103017 238
51 3300009093 Ga0105240_10021703 Ga0105240_100217037 238
52 3300009174 Ga0105241_10119381 Ga0105241_101193811 238
53 3300009177 Ga0105248_10043559 Ga0105248_100435595 238
54 3300009545 Ga0105237_10302065 Ga0105237_103020652 238
55 3300009551 Ga0105238_10010614 Ga0105238_100106145 238
56 3300010375 Ga0105239_10005847 Ga0105239_1000584711 238
57 3300013297 Ga0157378_10037671 Ga0157378_100376712 238
58 3300014969 Ga0157376_10031847 Ga0157376_100318473 238
59 3300025913 Ga0207695_10004762 Ga0207695_1000476213 238
60 3300025920 Ga0207649_10256180 Ga0207649_102561801 238
61 3300025924 Ga0207694_10008468 Ga0207694_100084686 238
62 3300025927 Ga0207687_10004851 Ga0207687_100048514 238
63 3300025941 Ga0207711_10004712 Ga0207711_1000471210 238
64 3300026067 Ga0207678_10023906 Ga0207678_100239065 238
65 3300026142 Ga0207698_10214407 Ga0207698_102144071 238
66 3300028800 Ga0265338_10003758 Ga0265338_1000375820 238
67 3300031344 Ga0265316_10060102 Ga0265316_100601022 238
68 3300031711 Ga0265314_10043406 Ga0265314_100434062 238
69 3300031711 Ga0265314_10043676 Ga0265314_100436762 238
70 iso_pu_bacteria 8025478263 8025483340 238
71 3300005327 Ga0070658_10000195 Ga0070658_1000019545 239
72 3300025909 Ga0207705_10000700 Ga0207705_1000070012 239
73 3300047443 Ga0495687_020209 Ga0495687_020209_553_1302 239
74 3300025297 Ga0209758_1005346 Ga0209758_10053466 240
75 3300042533 Ga0450901_001994 Ga0450901_001994_219_980 240
76 3300046525 Ga0495663_0000447 Ga0495663_0000447_8210_8971 240
77 3300046558 Ga0495633_0000513 Ga0495633_0000513_8194_8955 240
78 3300028800 Ga0265338_10012131 Ga0265338_100121318 241
79 3300046529 Ga0495652_0324153 Ga0495652_0324153_165_920 241
80 3300046694 Ga0495649_0048764 Ga0495649_0048764_826_1575 241
81 3300053139 Ga0500568_0025612 Ga0500568_0025612_706_1464 241
82 iso_pu_bacteria 8056447290 8056450814 241
83 3300001990 JGI24737J22298_10097318 JGI24737J22298_100973181 242
84 3300005327 Ga0070658_10035161 Ga0070658_100351613 242
85 3300005336 Ga0070680_100010111 Ga0070680_1000101119 242
86 3300005340 Ga0070689_100464455 Ga0070689_1004644551 242
87 3300005365 Ga0070688_100450466 Ga0070688_1004504662 242
88 3300005367 Ga0070667_100322636 Ga0070667_1003226362 242
89 3300005456 Ga0070678_100022998 Ga0070678_1000229982 242
90 3300005530 Ga0070679_100173049 Ga0070679_1001730492 242
91 3300005539 Ga0068853_100038960 Ga0068853_1000389604 242
92 3300005546 Ga0070696_100107327 Ga0070696_1001073272 242
93 3300005548 Ga0070665_100161434 Ga0070665_1001614342 242
94 3300005563 Ga0068855_100302378 Ga0068855_1003023782 242
95 3300005577 Ga0068857_100033850 Ga0068857_1000338504 242
96 3300005578 Ga0068854_100319164 Ga0068854_1003191642 242
97 3300005614 Ga0068856_100118727 Ga0068856_1001187272 242
98 3300005615 Ga0070702_100174720 Ga0070702_1001747202 242
99 3300006038 Ga0075365_10043003 Ga0075365_100430032 242
100 3300006177 Ga0075362_10043691 Ga0075362_100436912 242
101 3300006178 Ga0075367_10002673 Ga0075367_100026734 242
102 3300006195 Ga0075366_10006172 Ga0075366_100061728 242
103 3300006195 Ga0075366_10053281 Ga0075366_100532812 242
104 3300006881 Ga0068865_100050945 Ga0068865_1000509453 242
105 3300009093 Ga0105240_10007346 Ga0105240_100073463 242
106 3300009093 Ga0105240_10016911 Ga0105240_100169118 242
107 3300009093 Ga0105240_10096985 Ga0105240_100969853 242
108 3300009093 Ga0105240_10120451 Ga0105240_101204511 242
109 3300009093 Ga0105240_10226059 Ga0105240_102260591 242
110 3300009093 Ga0105240_10495619 Ga0105240_104956192 242
111 3300009101 Ga0105247_10025407 Ga0105247_100254072 242
112 3300009177 Ga0105248_10022161 Ga0105248_100221619 242
113 3300009545 Ga0105237_10048635 Ga0105237_100486352 242
114 3300009545 Ga0105237_10351040 Ga0105237_103510402 242
115 3300009551 Ga0105238_10262528 Ga0105238_102625282 242
116 3300010375 Ga0105239_10004808 Ga0105239_100048088 242
117 3300013297 Ga0157378_10008353 Ga0157378_100083538 242
118 3300013308 Ga0157375_10149842 Ga0157375_101498423 242
119 3300014745 Ga0157377_10269694 Ga0157377_102696942 242
120 3300014968 Ga0157379_10023319 Ga0157379_100233193 242
121 3300014969 Ga0157376_10020551 Ga0157376_100205514 242
122 3300014969 Ga0157376_10117877 Ga0157376_101178773 242
123 3300025904 Ga0207647_10083962 Ga0207647_100839622 242
124 3300025909 Ga0207705_10093376 Ga0207705_100933762 242
125 3300025912 Ga0207707_10027804 Ga0207707_100278043 242
126 3300025913 Ga0207695_10003426 Ga0207695_100034266 242
127 3300025913 Ga0207695_10015070 Ga0207695_100150703 242
128 3300025913 Ga0207695_10095796 Ga0207695_100957962 242
129 3300025914 Ga0207671_10247428 Ga0207671_102474282 242
130 3300025919 Ga0207657_10079084 Ga0207657_100790842 242
131 3300025921 Ga0207652_10078564 Ga0207652_100785644 242
132 3300025924 Ga0207694_10153508 Ga0207694_101535082 242
133 3300025938 Ga0207704_10057726 Ga0207704_100577263 242
134 3300025941 Ga0207711_10012337 Ga0207711_100123375 242
135 3300025949 Ga0207667_10155159 Ga0207667_101551592 242
136 3300026078 Ga0207702_10201610 Ga0207702_102016102 242
137 3300026116 Ga0207674_10033508 Ga0207674_100335085 242
138 3300026121 Ga0207683_10152948 Ga0207683_101529482 242
139 3300028379 Ga0268266_10115868 Ga0268266_101158682 242
140 3300028381 Ga0268264_10200750 Ga0268264_102007502 242
141 3300031995 Ga0307409_101094432 Ga0307409_1010944321 242
142 3300032002 Ga0307416_100710969 Ga0307416_1007109692 242
143 3300032004 Ga0307414_10223405 Ga0307414_102234052 242
144 3300037418 Ga0395900_0021152 Ga0395900_0021152_3100_3840 242
145 3300037466 Ga0395898_0007559 Ga0395898_0007559_3153_3893 242
146 3300038443 Ga0395901_0074695 Ga0395901_0074695_1143_1883 242
147 3300046642 Ga0495634_0102335 Ga0495634_0102335_130_885 242
148 3300046678 Ga0495599_0186079 Ga0495599_0186079_98_841 242
149 3300047317 Ga0495604_0130064 Ga0495604_0130064_388_1131 242
150 3300047319 Ga0495674_0203034 Ga0495674_0203034_401_1144 242
151 3300048904 Ga0496101_0207662 Ga0496101_0207662_689_1444 242
152 3300048907 Ga0496104_0206928 Ga0496104_0206928_904_1668 242
153 3300048910 Ga0496107_0315805 Ga0496107_0315805_397_1152 242
154 3300048911 Ga0496108_0349672 Ga0496108_0349672_462_1226 242
155 3300048917 Ga0496114_0004932 Ga0496114_0004932_873_1628 242
156 3300048918 Ga0496115_0000760 Ga0496115_0000760_20288_21043 242
157 3300050489 nmdc:mga03683_16494_c1 nmdc:mga03683_16494_c1_1105_1923 242
158 3300050492 nmdc:mga0yw44_249899_c1 nmdc:mga0yw44_249899_c1_363_1109 242
159 3300050493 nmdc:mga0k408_101220_c1 nmdc:mga0k408_101220_c1_821_1564 242
160 3300050494 nmdc:mga06z11_14646_c1 nmdc:mga06z11_14646_c1_516_1334 242
161 3300053119 Ga0500595_062045 Ga0500595_062045_295_1038 242
162 3300003320 rootH2_10127295 rootH2_101272952 243
163 3300005471 Ga0070698_100632930 Ga0070698_1006329302 243
164 3300006358 Ga0068871_100142595 Ga0068871_1001425951 243
165 3300006852 Ga0075433_10087465 Ga0075433_100874652 243
166 3300026121 Ga0207683_10219937 Ga0207683_102199373 243
167 3300035086 Ga0373934_0122798 Ga0373934_0122798_115_873 243
168 3300035119 Ga0373956_0088125 Ga0373956_0088125_589_1347 243
169 3300036401 Ga0373937_0242960 Ga0373937_0242960_517_1275 243
170 3300046462 Ga0495651_0022821 Ga0495651_0022821_2714_3472 243
171 3300046463 Ga0495653_0053068 Ga0495653_0053068_1790_2548 243
172 3300046511 Ga0495608_0046197 Ga0495608_0046197_757_1515 243
173 3300046536 Ga0495587_0236858 Ga0495587_0236858_72_830 243
174 3300046642 Ga0495634_0080836 Ga0495634_0080836_671_1429 243
175 3300046663 Ga0495635_0039153 Ga0495635_0039153_1661_2419 243
176 3300046675 Ga0495657_0080033 Ga0495657_0080033_228_986 243
177 3300046809 Ga0495600_0054173 Ga0495600_0054173_1013_1771 243
178 3300047322 Ga0495680_0003189 Ga0495680_0003189_886_1644 243
179 3300047444 Ga0495675_0076361 Ga0495675_0076361_387_1145 243
180 3300048088 Ga0495602_0086652 Ga0495602_0086652_525_1283 243
181 3300048903 Ga0496100_0015629 Ga0496100_0015629_841_1599 243
182 3300048904 Ga0496101_0002331 Ga0496101_0002331_8425_9183 243
183 3300048909 Ga0496106_0036201 Ga0496106_0036201_2270_3028 243
184 3300048910 Ga0496107_0018644 Ga0496107_0018644_1868_2626 243
185 3300050515 nmdc:mga0a205_208534_c1 nmdc:mga0a205_208534_c1_731_1489 243
186 3300053084 Ga0495595_0014059 Ga0495595_0014059_2595_3353 243
187 3300053085 Ga0495619_0245729 Ga0495619_0245729_385_1143 243
188 3300006028 Ga0070717_10306652 Ga0070717_103066522 245
189 3300009176 Ga0105242_10081276 Ga0105242_100812762 245
190 3300005366 Ga0070659_100263524 Ga0070659_1002635242 246
191 3300005456 Ga0070678_100063364 Ga0070678_1000633642 246
192 3300005563 Ga0068855_100099503 Ga0068855_1000995035 246
193 3300013105 Ga0157369_10002083 Ga0157369_1000208315 246
194 3300013307 Ga0157372_10024714 Ga0157372_100247145 246
195 3300014969 Ga0157376_10664250 Ga0157376_106642501 246
196 3300025932 Ga0207690_10337717 Ga0207690_103377171 246
197 3300025949 Ga0207667_10219755 Ga0207667_102197553 246
198 3300046543 Ga0495645_0020632 Ga0495645_0020632_1754_2512 246
199 3300005439 Ga0070711_100019037 Ga0070711_1000190374 247
200 3300025916 Ga0207663_10148410 Ga0207663_101484102 247
201 3300035725 Ga0373947_0050806 Ga0373947_0050806_176_958 247
202 3300037068 Ga0373925_0084485 Ga0373925_0084485_1203_1985 247
203 3300046459 Ga0495629_0118048 Ga0495629_0118048_971_1753 247
204 3300046473 Ga0495582_0009344 Ga0495582_0009344_1307_2089 247
205 3300046683 Ga0495658_0000599 Ga0495658_0000599_2867_3649 247
206 3300046689 Ga0495613_0140854 Ga0495613_0140854_637_1419 247
207 3300047471 Ga0495684_0034555 Ga0495684_0034555_420_1202 247
208 3300001990 JGI24737J22298_10048043 JGI24737J22298_100480432 249
209 3300002067 JGI24735J21928_10004511 JGI24735J21928_100045112 249
210 3300003214 JGI25165J46597_1000210 JGI25165J46597_100021075 249
211 3300003322 rootL2_10121414 rootL2_101214142 249
212 3300003762 Ga0055542_1003170 Ga0055542_10031703 249
213 3300005327 Ga0070658_10012411 Ga0070658_100124114 249
214 3300005327 Ga0070658_10263170 Ga0070658_102631702 249
215 3300005328 Ga0070676_10000055 Ga0070676_1000005531 249
216 3300005328 Ga0070676_10127721 Ga0070676_101277212 249
217 3300005334 Ga0068869_100002763 Ga0068869_1000027632 249
218 3300005335 Ga0070666_10128747 Ga0070666_101287472 249
219 3300005338 Ga0068868_100000880 Ga0068868_1000008803 249
220 3300005339 Ga0070660_100000417 Ga0070660_1000004175 249
221 3300005339 Ga0070660_100024816 Ga0070660_1000248164 249
222 3300005339 Ga0070660_100123040 Ga0070660_1001230402 249
223 3300005354 Ga0070675_100006424 Ga0070675_1000064242 249
224 3300005355 Ga0070671_100025419 Ga0070671_1000254194 249
225 3300005355 Ga0070671_100204276 Ga0070671_1002042762 249
226 3300005356 Ga0070674_100015987 Ga0070674_1000159874 249
227 3300005356 Ga0070674_100036449 Ga0070674_1000364492 249
228 3300005364 Ga0070673_100000014 Ga0070673_10000001466 249
229 3300005364 Ga0070673_100473703 Ga0070673_1004737032 249
230 3300005366 Ga0070659_100073580 Ga0070659_1000735802 249
231 3300005455 Ga0070663_100000321 Ga0070663_10000032115 249
232 3300005457 Ga0070662_100051712 Ga0070662_1000517123 249
233 3300005457 Ga0070662_100139356 Ga0070662_1001393562 249
234 3300005459 Ga0068867_100000002 Ga0068867_10000000270 249
235 3300005539 Ga0068853_100006045 Ga0068853_1000060453 249
236 3300005539 Ga0068853_100410425 Ga0068853_1004104252 249
237 3300005543 Ga0070672_100149245 Ga0070672_1001492452 249
238 3300005563 Ga0068855_100000117 Ga0068855_10000011778 249
239 3300005564 Ga0070664_100028181 Ga0070664_1000281814 249
240 3300005578 Ga0068854_100003771 Ga0068854_1000037712 249
241 3300005834 Ga0068851_10087242 Ga0068851_100872421 249
242 3300006237 Ga0097621_100011863 Ga0097621_1000118632 249
243 3300006358 Ga0068871_100190770 Ga0068871_1001907702 249
244 3300006881 Ga0068865_100000016 Ga0068865_10000001656 249
245 3300009093 Ga0105240_10213933 Ga0105240_102139332 249
246 3300009093 Ga0105240_10336959 Ga0105240_103369592 249
247 3300009148 Ga0105243_10000153 Ga0105243_1000015328 249
248 3300009174 Ga0105241_10089696 Ga0105241_100896962 249
249 3300009176 Ga0105242_10000576 Ga0105242_1000057624 249
250 3300009553 Ga0105249_10141784 Ga0105249_101417842 249
251 3300010375 Ga0105239_10028213 Ga0105239_100282132 249
252 3300010375 Ga0105239_10090024 Ga0105239_100900242 249
253 3300011119 Ga0105246_10006210 Ga0105246_100062105 249
254 3300013100 Ga0157373_10052698 Ga0157373_100526982 249
255 3300013100 Ga0157373_10062185 Ga0157373_100621852 249
256 3300013104 Ga0157370_10001451 Ga0157370_1000145113 249
257 3300013104 Ga0157370_10350437 Ga0157370_103504371 249
258 3300013105 Ga0157369_10085693 Ga0157369_100856932 249
259 3300013296 Ga0157374_10002131 Ga0157374_100021318 249
260 3300013296 Ga0157374_10104947 Ga0157374_101049472 249
261 3300013297 Ga0157378_10001055 Ga0157378_1000105513 249
262 3300013306 Ga0163162_10174188 Ga0163162_101741882 249
263 3300013307 Ga0157372_10020880 Ga0157372_100208803 249
264 3300013307 Ga0157372_10273052 Ga0157372_102730522 249
265 3300013308 Ga0157375_10003669 Ga0157375_100036694 249
266 3300014745 Ga0157377_10005322 Ga0157377_100053224 249
267 3300014969 Ga0157376_10000063 Ga0157376_1000006351 249
268 3300017792 Ga0163161_10039133 Ga0163161_100391332 249
269 3300025254 Ga0209148_1000146 Ga0209148_100014689 249
270 3300025254 Ga0209148_1000494 Ga0209148_100049437 249
271 3300025261 Ga0209233_1000003 Ga0209233_1000003166 249
272 3300025272 Ga0209455_1001627 Ga0209455_10016273 249
273 3300025272 Ga0209455_1011983 Ga0209455_10119831 249
274 3300025903 Ga0207680_10035655 Ga0207680_100356552 249
275 3300025907 Ga0207645_10000235 Ga0207645_1000023513 249
276 3300025909 Ga0207705_10000025 Ga0207705_10000025191 249
277 3300025909 Ga0207705_10003748 Ga0207705_100037482 249
278 3300025909 Ga0207705_10087665 Ga0207705_100876652 249
279 3300025911 Ga0207654_10067244 Ga0207654_100672442 249
280 3300025913 Ga0207695_10041317 Ga0207695_100413173 249
281 3300025913 Ga0207695_10239410 Ga0207695_102394102 249
282 3300025919 Ga0207657_10001398 Ga0207657_1000139814 249
283 3300025919 Ga0207657_10034829 Ga0207657_100348291 249
284 3300025919 Ga0207657_10213073 Ga0207657_102130732 249
285 3300025920 Ga0207649_10053661 Ga0207649_100536611 249
286 3300025924 Ga0207694_10057653 Ga0207694_100576532 249
287 3300025927 Ga0207687_10002157 Ga0207687_1000215712 249
288 3300025931 Ga0207644_10016390 Ga0207644_100163902 249
289 3300025931 Ga0207644_10147223 Ga0207644_101472232 249
290 3300025932 Ga0207690_10157987 Ga0207690_101579872 249
291 3300025933 Ga0207706_10323625 Ga0207706_103236251 249
292 3300025933 Ga0207706_10653460 Ga0207706_106534601 249
293 3300025934 Ga0207686_10000453 Ga0207686_100004532 249
294 3300025935 Ga0207709_10000221 Ga0207709_100002218 249
295 3300025937 Ga0207669_10226431 Ga0207669_102264312 249
296 3300025940 Ga0207691_10216951 Ga0207691_102169512 249
297 3300025942 Ga0207689_10000704 Ga0207689_1000070424 249
298 3300025949 Ga0207667_10000017 Ga0207667_1000001764 249
299 3300025960 Ga0207651_10000004 Ga0207651_1000000470 249
300 3300025981 Ga0207640_10000388 Ga0207640_100003889 249
301 3300026023 Ga0207677_10000335 Ga0207677_1000033525 249
302 3300026041 Ga0207639_10003292 Ga0207639_100032928 249
303 3300026041 Ga0207639_10032093 Ga0207639_100320932 249
304 3300026041 Ga0207639_10032435 Ga0207639_100324354 249
305 3300026067 Ga0207678_10000993 Ga0207678_100009936 249
306 3300026078 Ga0207702_10014998 Ga0207702_100149985 249
307 3300026089 Ga0207648_10000003 Ga0207648_10000003219 249
308 3300037312 Ga0395899_0015855 Ga0395899_0015855_2574_3323 249
309 3300037418 Ga0395900_0326149 Ga0395900_0326149_663_1412 249
310 3300037471 Ga0395905_0021148 Ga0395905_0021148_5308_6057 249
311 3300038443 Ga0395901_0558236 Ga0395901_0558236_159_908 249
312 3300042005 Ga0439448_0006801 Ga0439448_0006801_927_1676 249
313 3300042012 Ga0439455_0004960 Ga0439455_0004960_537_1286 249
314 3300042157 Ga0439458_0002303 Ga0439458_0002303_3395_4144 249
315 3300042157 Ga0439458_0024129 Ga0439458_0024129_636_1385 249
316 3300044683 Ga0466965_0243197 Ga0466965_0243197_66_815 249
317 3300044765 Ga0466970_0279903 Ga0466970_0279903_157_906 249
318 3300048920 Ga0496117_0000428 Ga0496117_0000428_68141_68890 249
319 3300048920 Ga0496117_0004830 Ga0496117_0004830_8935_9684 249
320 3300048920 Ga0496117_0069796 Ga0496117_0069796_1573_2322 249
321 3300048921 Ga0496118_0002945 Ga0496118_0002945_1180_1929 249
322 3300048921 Ga0496118_0016507 Ga0496118_0016507_890_1639 249
323 3300048921 Ga0496118_0126762 Ga0496118_0126762_696_1445 249
324 3300048922 Ga0496119_0038051 Ga0496119_0038051_2345_3094 249
325 3300048924 Ga0496121_0012102 Ga0496121_0012102_1815_2564 249
326 3300048924 Ga0496121_0037395 Ga0496121_0037395_2173_2922 249
327 3300048925 Ga0496122_0007811 Ga0496122_0007811_6554_7303 249
328 3300048925 Ga0496122_0012489 Ga0496122_0012489_4372_5121 249
329 3300048926 Ga0496123_0009369 Ga0496123_0009369_6552_7301 249
330 3300048927 Ga0496124_0011426 Ga0496124_0011426_6678_7427 249
331 3300048927 Ga0496124_0294463 Ga0496124_0294463_133_882 249
332 3300048929 Ga0496126_0000306 Ga0496126_0000306_101909_102658 249
333 3300049570 Ga0501033_0245465 Ga0501033_0245465_288_1037 249
334 3300049823 Ga0501044_0331556 Ga0501044_0331556_472_1221 249
335 3300053153 Ga0500616_0059433 Ga0500616_0059433_169_918 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

235

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

285

0.95

PF23441

39

287

0.87

PF08659

KR

KR domain

46

220

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9479 1 249
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.946 1 249
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9459 4 249
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9451 1 249
3icc-assembly1.cif.gz_A crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution 0.9416 2 249
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9558 3 195 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 1 249 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 3 162 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9387 3 248 3.40.50.720
af_Q9VWP2_2_241_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9339 1 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537VGQ3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9707 1 201 GO:0016491
AF-A0A1I5NR11-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9614 1 249 GO:0016491
AF-A0A537VGQ3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9612 1 201 GO:0016491
AF-A0A6L3ZYV9-F1-model_v4 deleted 0.9603 4 195
AF-A0A7U4DNI6-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9601 1 248

Feature Viewer

pLDDT pTM Quality
93.13 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map