F412105

General Info

Members Datasets Scaffolds Average Seq Length
335 219 670 69

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100198970|Ga0070668_1001989702
Length 77
Sequence MDEDAFNLSIRKFLKHFGVTAQREIESSVRKAIEEGRLHGDEAIPVHATLVVDGILRDFQIDGTITLSASPDAPAAA

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 1.49
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 20.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100198970 3300005347 Unclassified 1644
2 Ga0065707_10936525 3300005295 Bacteria 556
3 Ga0070658_10397473 3300005327 Bacteria 1184
4 Ga0070683_100145684 3300005329 Unclassified 2244
5 Ga0070690_100150173 3300005330 Bacteria 1589
6 Ga0070690_100275930 3300005330 Unclassified 1198
7 Ga0070670_101266437 3300005331 Bacteria 675
8 Ga0070680_100088495 3300005336 Bacteria 2562
9 Ga0070680_100127258 3300005336 Bacteria 2129
10 Ga0070680_100351388 3300005336 Unclassified 1254
11 Ga0070660_100126961 3300005339 Unclassified 2038
12 Ga0070689_100731636 3300005340 Bacteria 866
13 Ga0070689_100891276 3300005340 Bacteria 787
14 Ga0070661_100024743 3300005344 Bacteria 4308
15 Ga0070692_10140099 3300005345 Bacteria 1368
16 Ga0070668_100445647 3300005347 Bacteria 1112
17 Ga0070675_100351193 3300005354 Bacteria 1308
18 Ga0070675_102244548 3300005354 Bacteria 503
19 Ga0070674_100285381 3300005356 Bacteria 1310
20 Ga0070659_100208783 3300005366 Bacteria 1609
21 Ga0070667_100696446 3300005367 Bacteria 940
22 Ga0070703_10016729 3300005406 Bacteria 2107
23 Ga0070709_10013406 3300005434 Bacteria 4608
24 Ga0070709_10345970 3300005434 Bacteria 1097
25 Ga0070714_100036045 3300005435 Bacteria 4147
26 Ga0070713_100751174 3300005436 Unclassified 933
27 Ga0070701_10924309 3300005438 Bacteria 604
28 Ga0070711_100000065 3300005439 Bacteria 62993
29 Ga0070705_100219220 3300005440 Unclassified 1316
30 Ga0070694_100067386 3300005444 Bacteria 2457
31 Ga0070694_100284437 3300005444 Bacteria 1262
32 Ga0070708_100605194 3300005445 Bacteria 1033
33 Ga0070663_100264103 3300005455 Unclassified 1366
34 Ga0070678_101013554 3300005456 Bacteria 763
35 Ga0070678_101020296 3300005456 Bacteria 761
36 Ga0070678_101272578 3300005456 Unclassified 684
37 Ga0070678_102218545 3300005456 Bacteria 521
38 Ga0070681_10041017 3300005458 Bacteria 4638
39 Ga0070681_10059030 3300005458 Bacteria 3816
40 Ga0070681_10077211 3300005458 Unclassified 3289
41 Ga0070681_10134785 3300005458 Bacteria 2400
42 Ga0070681_10499314 3300005458 Bacteria 1130
43 Ga0068867_100379986 3300005459 Unclassified 1186
44 Ga0070706_101437009 3300005467 Bacteria 631
45 Ga0070706_102109913 3300005467 Bacteria 509
46 Ga0070707_101901389 3300005468 Bacteria 562
47 Ga0070699_100030031 3300005518 Bacteria 4689
48 Ga0070699_100182267 3300005518 Bacteria 1864
49 Ga0070699_100820811 3300005518 Bacteria 851
50 Ga0070679_100009324 3300005530 Bacteria 9279
51 Ga0070679_100024672 3300005530 Bacteria 5893
52 Ga0070679_100087523 3300005530 Bacteria 3102
53 Ga0070679_100093670 3300005530 Unclassified 2991
54 Ga0070679_100595810 3300005530 Bacteria 1048
55 Ga0070679_100986007 3300005530 Unclassified 786
56 Ga0070697_100033281 3300005536 Bacteria 4151
57 Ga0070697_100398952 3300005536 Bacteria 1193
58 Ga0070697_100399261 3300005536 Bacteria 1193
59 Ga0068853_100005190 3300005539 Bacteria 10190
60 Ga0068853_100948902 3300005539 Bacteria 827
61 Ga0070686_100272538 3300005544 Bacteria 1245
62 Ga0070686_101555068 3300005544 Bacteria 559
63 Ga0070695_100009021 3300005545 Bacteria 5929
64 Ga0070695_100050944 3300005545 Bacteria 2655
65 Ga0070696_100039852 3300005546 Bacteria 3243
66 Ga0070693_100000683 3300005547 Bacteria 15038
67 Ga0070693_100253156 3300005547 Unclassified 1168
68 Ga0070665_100113044 3300005548 Unclassified 2718
69 Ga0070665_100574946 3300005548 Bacteria 1140
70 Ga0070665_101410822 3300005548 Bacteria 705
71 Ga0070704_100023754 3300005549 Bacteria 4011
72 Ga0068855_100135011 3300005563 Bacteria 2815
73 Ga0068854_100419870 3300005578 Unclassified 1111
74 Ga0068854_101631379 3300005578 Bacteria 588
75 Ga0068856_100013248 3300005614 Bacteria 7985
76 Ga0068852_100153935 3300005616 Unclassified 2140
77 Ga0068852_101614573 3300005616 Bacteria 671
78 Ga0068859_100360652 3300005617 Bacteria 1548
79 Ga0068864_101609043 3300005618 Bacteria 654
80 Ga0068866_11027462 3300005718 Bacteria 587
81 Ga0068861_102027959 3300005719 Bacteria 574
82 Ga0068858_100234639 3300005842 Bacteria 1739
83 Ga0068858_100693074 3300005842 Bacteria 991
84 Ga0068860_100199354 3300005843 Bacteria 1939
85 Ga0068862_100890399 3300005844 Unclassified 874
86 Ga0068862_101670135 3300005844 Bacteria 645
87 Ga0081455_10702985 3300005937 Bacteria 644
88 Ga0081538_10194888 3300005981 Unclassified 843
89 Ga0075365_10630695 3300006038 Bacteria 758
90 Ga0070715_10257349 3300006163 Unclassified 915
91 Ga0070715_10596785 3300006163 Unclassified 647
92 Ga0070716_100085720 3300006173 Unclassified 1893
93 Ga0070716_101058615 3300006173 Bacteria 645
94 Ga0070712_100705856 3300006175 Unclassified 860
95 Ga0097621_100036771 3300006237 Bacteria 3918
96 Ga0097621_100484312 3300006237 Unclassified 1118
97 Ga0068871_100006961 3300006358 Bacteria 8056
98 Ga0068871_100056088 3300006358 Bacteria 3201
99 Ga0068871_100948905 3300006358 Bacteria 799
100 Ga0075430_100024597 3300006846 Bacteria 5122
101 Ga0075431_100044516 3300006847 Bacteria 4578
102 Ga0075433_10169947 3300006852 Bacteria 1940
103 Ga0075433_10514723 3300006852 Unclassified 1053
104 Ga0075434_100031948 3300006871 Bacteria 5190
105 Ga0075434_100218992 3300006871 Bacteria 1923
106 Ga0075434_101754487 3300006871 Bacteria 628
107 Ga0075436_100014667 3300006914 Bacteria 5372
108 Ga0075436_101039072 3300006914 Bacteria 616
109 Ga0097620_100360650 3300006931 Bacteria 1548
110 Ga0075435_100324043 3300007076 Unclassified 1319
111 Ga0075435_100432154 3300007076 Bacteria 1134
112 Ga0075435_101140876 3300007076 Unclassified 682
113 Ga0105240_10144347 3300009093 Unclassified 2842
114 Ga0111539_11305068 3300009094 Bacteria 842
115 Ga0105245_10064343 3300009098 Bacteria 3314
116 Ga0105245_10554163 3300009098 Bacteria 1172
117 Ga0114129_10598777 3300009147 Bacteria 1428
118 Ga0114129_10799683 3300009147 Bacteria 1203
119 Ga0114129_13418659 3300009147 Bacteria 510
120 Ga0105243_10237422 3300009148 Bacteria 1620
121 Ga0105243_11977083 3300009148 Bacteria 617
122 Ga0105242_10067072 3300009176 Bacteria 2965
123 Ga0105242_10633567 3300009176 Bacteria 1037
124 Ga0105248_10046319 3300009177 Bacteria 4873
125 Ga0105248_10064705 3300009177 Bacteria 4105
126 Ga0105237_12413862 3300009545 Bacteria 536
127 Ga0105238_10045613 3300009551 Bacteria 4428
128 Ga0105238_11170738 3300009551 Unclassified 793
129 Ga0105249_10000341 3300009553 Bacteria 47106
130 Ga0105249_11156320 3300009553 Bacteria 845
131 Ga0099796_10473258 3300010159 Bacteria 559
132 Ga0105246_11063934 3300011119 Bacteria 736
133 Ga0105246_11239466 3300011119 Bacteria 688
134 Ga0157369_10119894 3300013105 Bacteria 2791
135 Ga0157374_10532827 3300013296 Bacteria 1181
136 Ga0157374_10589283 3300013296 Bacteria 1121
137 Ga0157378_10037175 3300013297 Bacteria 4311
138 Ga0157378_10278710 3300013297 Unclassified 1611
139 Ga0157378_13021927 3300013297 Unclassified 522
140 Ga0163162_10290526 3300013306 Bacteria 1767
141 Ga0163162_10294089 3300013306 Bacteria 1756
142 Ga0163162_10435436 3300013306 Bacteria 1443
143 Ga0157372_10006761 3300013307 Bacteria 12191
144 Ga0157375_10014914 3300013308 Bacteria 6947
145 Ga0163163_10459554 3300014325 Bacteria 1333
146 Ga0157380_12316523 3300014326 Bacteria 602
147 Ga0157380_12617508 3300014326 Bacteria 571
148 Ga0157377_10470846 3300014745 Unclassified 872
149 Ga0157379_10190015 3300014968 Bacteria 1856
150 Ga0157376_10007569 3300014969 Bacteria 7767
151 Ga0157376_10082446 3300014969 Bacteria 2763
152 Ga0157376_10525093 3300014969 Bacteria 1167
153 Ga0157376_10705367 3300014969 Bacteria 1014
154 Ga0206353_10589812 3300020082 Bacteria 822
155 Ga0213876_10021544 3300021384 Unclassified 3408
156 Ga0207656_10197545 3300025321 Bacteria 970
157 Ga0207653_10152863 3300025885 Unclassified 850
158 Ga0207680_10563789 3300025903 Bacteria 813
159 Ga0207699_10085088 3300025906 Unclassified 1971
160 Ga0207705_10200012 3300025909 Unclassified 1514
161 Ga0207684_11191560 3300025910 Bacteria 631
162 Ga0207707_10040397 3300025912 Bacteria 4074
163 Ga0207707_10041518 3300025912 Bacteria 4017
164 Ga0207707_10042834 3300025912 Bacteria 3950
165 Ga0207707_10449916 3300025912 Bacteria 1102
166 Ga0207695_10463738 3300025913 Unclassified 1150
167 Ga0207671_11125153 3300025914 Bacteria 616
168 Ga0207693_10766358 3300025915 Unclassified 745
169 Ga0207663_10000028 3300025916 Bacteria 101247
170 Ga0207660_10034742 3300025917 Bacteria 3495
171 Ga0207660_10045453 3300025917 Bacteria 3093
172 Ga0207660_10079982 3300025917 Unclassified 2398
173 Ga0207662_10719285 3300025918 Bacteria 700
174 Ga0207657_10042831 3300025919 Bacteria 3991
175 Ga0207652_10145157 3300025921 Bacteria 2123
176 Ga0207652_10376546 3300025921 Unclassified 1281
177 Ga0207652_10568195 3300025921 Unclassified 1018
178 Ga0207652_11344365 3300025921 Bacteria 617
179 Ga0207681_10089686 3300025923 Bacteria 2193
180 Ga0207694_10058645 3300025924 Bacteria 2994
181 Ga0207694_11474695 3300025924 Unclassified 574
182 Ga0207650_10596319 3300025925 Bacteria 929
183 Ga0207659_10387164 3300025926 Bacteria 1167
184 Ga0207687_10071901 3300025927 Bacteria 2473
185 Ga0207687_10196186 3300025927 Bacteria 1574
186 Ga0207687_10396901 3300025927 Bacteria 1134
187 Ga0207700_10637965 3300025928 Unclassified 949
188 Ga0207664_11114460 3300025929 Bacteria 705
189 Ga0207644_10504964 3300025931 Unclassified 998
190 Ga0207644_11250404 3300025931 Bacteria 624
191 Ga0207690_10248415 3300025932 Unclassified 1373
192 Ga0207706_11119856 3300025933 Unclassified 657
193 Ga0207686_10008384 3300025934 Bacteria 5578
194 Ga0207709_10240196 3300025935 Bacteria 1317
195 Ga0207709_11119961 3300025935 Bacteria 647
196 Ga0207670_10092195 3300025936 Bacteria 2144
197 Ga0207669_10020911 3300025937 Bacteria 3442
198 Ga0207704_10746589 3300025938 Bacteria 814
199 Ga0207704_10893750 3300025938 Bacteria 747
200 Ga0207704_11058440 3300025938 Bacteria 688
201 Ga0207665_10396319 3300025939 Unclassified 1050
202 Ga0207665_10688779 3300025939 Bacteria 803
203 Ga0207711_10080323 3300025941 Bacteria 2848
204 Ga0207667_10375387 3300025949 Bacteria 1449
205 Ga0207712_10000503 3300025961 Bacteria 32380
206 Ga0207668_10049020 3300025972 Bacteria 2901
207 Ga0207668_10301893 3300025972 Bacteria 1322
208 Ga0207640_10123311 3300025981 Unclassified 1861
209 Ga0207640_10198612 3300025981 Bacteria 1518
210 Ga0207658_10478965 3300025986 Bacteria 1106
211 Ga0207658_11876759 3300025986 Unclassified 546
212 Ga0207677_11467915 3300026023 Bacteria 629
213 Ga0207703_10137964 3300026035 Bacteria 2113
214 Ga0207703_10650382 3300026035 Bacteria 1000
215 Ga0207639_10156270 3300026041 Unclassified 1916
216 Ga0207639_10723488 3300026041 Unclassified 924
217 Ga0207678_10187443 3300026067 Unclassified 1767
218 Ga0207702_10067960 3300026078 Unclassified 3060
219 Ga0207641_12537622 3300026088 Bacteria 511
220 Ga0207648_10315440 3300026089 Bacteria 1404
221 Ga0207676_10946521 3300026095 Bacteria 847
222 Ga0207675_101284428 3300026118 Bacteria 752
223 Ga0207683_10428374 3300026121 Bacteria 1219
224 Ga0207683_10442701 3300026121 Bacteria 1197
225 Ga0207683_11581547 3300026121 Bacteria 605
226 Ga0207698_10253379 3300026142 Unclassified 1612
227 Ga0207698_10980512 3300026142 Bacteria 855
228 Ga0268266_10349579 3300028379 Unclassified 1389
229 Ga0268266_10592896 3300028379 Bacteria 1064
230 Ga0268265_10844639 3300028380 Unclassified 895
231 Ga0268264_10280830 3300028381 Bacteria 1560
232 Ga0265318_10022684 3300028577 Bacteria 2507
233 Ga0307408_100008973 3300031548 Bacteria 6607
234 Ga0307408_100083708 3300031548 Bacteria 2391
235 Ga0307408_100199277 3300031548 Bacteria 1619
236 Ga0307408_100815908 3300031548 Bacteria 848
237 Ga0307405_10003631 3300031731 Bacteria 7137
238 Ga0307405_10063468 3300031731 Bacteria 2343
239 Ga0307405_10341386 3300031731 Bacteria 1152
240 Ga0307405_10835510 3300031731 Bacteria 774
241 Ga0307413_10024106 3300031824 Bacteria 3310
242 Ga0307410_10001492 3300031852 Bacteria 10608
243 Ga0307410_10465460 3300031852 Bacteria 1034
244 Ga0307406_10007978 3300031901 Bacteria 5897
245 Ga0307406_10026052 3300031901 Bacteria 3507
246 Ga0307407_10000294 3300031903 Bacteria 14730
247 Ga0307412_10005385 3300031911 Bacteria 7182
248 Ga0307412_10787556 3300031911 Bacteria 824
249 Ga0307409_100065904 3300031995 Bacteria 2852
250 Ga0307416_100001808 3300032002 Bacteria 11881
251 Ga0307416_100077416 3300032002 Bacteria 2793
252 Ga0307416_100150852 3300032002 Bacteria 2131
253 Ga0307416_100567438 3300032002 Unclassified 1210
254 Ga0307414_10003069 3300032004 Bacteria 8862
255 Ga0307411_10000801 3300032005 Bacteria 11716
256 Ga0307411_11358185 3300032005 Unclassified 649
257 Ga0307411_11423530 3300032005 Bacteria 635
258 Ga0307415_100003993 3300032126 Bacteria 7598
259 Ga0373923_0282137 3300035111 Bacteria 783
260 Ga0373953_0277417 3300035117 Bacteria 730
261 Ga0373956_0234506 3300035119 Bacteria 872
262 Ga0373957_0064923 3300035120 Bacteria 1420
263 Ga0373946_0562731 3300035171 Bacteria 589
264 Ga0373955_0380193 3300035172 Bacteria 857
265 Ga0373955_0477160 3300035172 Bacteria 761
266 Ga0316574_0801699 3300035398 Unclassified 573
267 Ga0373924_0060909 3300035410 Bacteria 1579
268 Ga0373931_0572533 3300035691 Bacteria 736
269 Ga0373935_0295262 3300035692 Bacteria 1144
270 Ga0373933_0044189 3300035724 Bacteria 2638
271 Ga0373937_0068310 3300036401 Bacteria 3276
272 Ga0373937_0664630 3300036401 Bacteria 988
273 Ga0373925_0541824 3300037068 Bacteria 957
274 Ga0436364_0282028 3300037853 Unclassified 697
275 Ga0436365_0714445 3300039437 Bacteria 7977
276 Ga0436361_0781021 3300039447 Bacteria 14877
277 Ga0436362_0098660 3300039453 Bacteria 3230
278 Ga0451789_0580627 3300041443 Bacteria 754
279 Ga0451804_1021359 3300041463 Bacteria 561
280 Ga0439462_0237598 3300042015 Unclassified 523
281 Ga0439446_0076761 3300042156 Unclassified 1029
282 Ga0439434_0115152 3300042435 Unclassified 873
283 Ga0451577_1852704 3300042876 Unclassified 529
284 Ga0453683_1189341 3300044673 Unclassified 510
285 Ga0453684_0482495 3300044712 Bacteria 1375
286 Ga0466968_0483758 3300044735 Bacteria 615
287 Ga0495592_0063377 3300046454 Bacteria 2712
288 Ga0495638_0240582 3300046460 Bacteria 1002
289 Ga0495653_0024145 3300046463 Bacteria 4904
290 Ga0495608_0017745 3300046511 Bacteria 4921
291 Ga0495628_0123612 3300046516 Bacteria 1983
292 Ga0495652_0075712 3300046529 Bacteria 2794
293 Ga0495665_0532637 3300046531 Unclassified 590
294 Ga0495587_0039605 3300046536 Bacteria 2819
295 Ga0495598_0083798 3300046537 Bacteria 1028
296 Ga0495645_0002830 3300046543 Bacteria 11768
297 Ga0495645_0163738 3300046543 Bacteria 1536
298 Ga0495667_0060132 3300046559 Bacteria 2492
299 Ga0495635_0088152 3300046663 Bacteria 2123
300 Ga0495657_0465788 3300046675 Bacteria 739
301 Ga0495599_0007117 3300046678 Bacteria 6772
302 Ga0495623_0168775 3300046679 Bacteria 1280
303 Ga0495623_0352556 3300046679 Bacteria 801
304 Ga0495600_0129113 3300046809 Bacteria 1643
305 Ga0495604_0142488 3300047317 Bacteria 1711
306 Ga0495680_0373268 3300047322 Bacteria 989
307 Ga0495684_0080968 3300047471 Bacteria 2465
308 Ga0495602_0133187 3300048088 Bacteria 1979
309 Ga0496102_0135553 3300048905 Bacteria 2307
310 Ga0496103_0313944 3300048906 Bacteria 1008
311 Ga0496106_1389596 3300048909 Bacteria 543
312 Ga0501071_0738028 3300049587 Unclassified 759
313 Ga0501071_0875357 3300049587 Bacteria 693
314 Ga0501076_0632628 3300049592 Bacteria 883
315 Ga0501076_0978430 3300049592 Bacteria 697
316 Ga0501225_0301288 3300049705 Unclassified 542
317 nmdc:mga06z11_813272_c1 3300050494 Bacteria 569
318 nmdc:mga0qj67_29845_c1 3300050509 Bacteria 4238
319 nmdc:mga06r32_29388_c1 3300050510 Bacteria 5150
320 nmdc:mga0n895_1008777_c1 3300050512 Bacteria 813
321 nmdc:mga0n895_1418_c1 3300050512 Bacteria 17912
322 nmdc:mga0n895_1483995_c1 3300050512 Bacteria 645
323 nmdc:mga0rr50_1048976_c1 3300050513 Bacteria 694
324 nmdc:mga0rr50_160126_c1 3300050513 Unclassified 1826
325 nmdc:mga0rr50_905965_c1 3300050513 Bacteria 752
326 nmdc:mga08x19_1566_c1 3300050514 Bacteria 14190
327 nmdc:mga08x19_157787_c1 3300050514 Bacteria 1540
328 nmdc:mga08x19_973557_c1 3300050514 Bacteria 603
329 nmdc:mga0a205_202506_c1 3300050515 Bacteria 1008
330 nmdc:mga0a205_87911_c1 3300050515 Bacteria 3003
331 Ga0495601_0053921 3300053077 Bacteria 2542
332 Ga0495595_0165024 3300053084 Bacteria 1094
333 Ga0495619_0050173 3300053085 Bacteria 2754
334 Ga0500641_0065352 3300053096 Bacteria 1521
335 Ga0500604_0033949 3300053151 Bacteria 1511
336 Ga0070668_100198970
337 Ga0065707_10936525
338 Ga0070658_10397473
339 Ga0070683_100145684
340 Ga0070690_100150173
341 Ga0070690_100275930
342 Ga0070670_101266437
343 Ga0070680_100088495
344 Ga0070680_100127258
345 Ga0070680_100351388
346 Ga0070660_100126961
347 Ga0070689_100731636
348 Ga0070689_100891276
349 Ga0070661_100024743
350 Ga0070692_10140099
351 Ga0070668_100445647
352 Ga0070675_100351193
353 Ga0070675_102244548
354 Ga0070674_100285381
355 Ga0070659_100208783
356 Ga0070667_100696446
357 Ga0070703_10016729
358 Ga0070709_10013406
359 Ga0070709_10345970
360 Ga0070714_100036045
361 Ga0070713_100751174
362 Ga0070701_10924309
363 Ga0070711_100000065
364 Ga0070705_100219220
365 Ga0070694_100067386
366 Ga0070694_100284437
367 Ga0070708_100605194
368 Ga0070663_100264103
369 Ga0070678_101013554
370 Ga0070678_101020296
371 Ga0070678_101272578
372 Ga0070678_102218545
373 Ga0070681_10041017
374 Ga0070681_10059030
375 Ga0070681_10077211
376 Ga0070681_10134785
377 Ga0070681_10499314
378 Ga0068867_100379986
379 Ga0070706_101437009
380 Ga0070706_102109913
381 Ga0070707_101901389
382 Ga0070699_100030031
383 Ga0070699_100182267
384 Ga0070699_100820811
385 Ga0070679_100009324
386 Ga0070679_100024672
387 Ga0070679_100087523
388 Ga0070679_100093670
389 Ga0070679_100595810
390 Ga0070679_100986007
391 Ga0070697_100033281
392 Ga0070697_100398952
393 Ga0070697_100399261
394 Ga0068853_100005190
395 Ga0068853_100948902
396 Ga0070686_100272538
397 Ga0070686_101555068
398 Ga0070695_100009021
399 Ga0070695_100050944
400 Ga0070696_100039852
401 Ga0070693_100000683
402 Ga0070693_100253156
403 Ga0070665_100113044
404 Ga0070665_100574946
405 Ga0070665_101410822
406 Ga0070704_100023754
407 Ga0068855_100135011
408 Ga0068854_100419870
409 Ga0068854_101631379
410 Ga0068856_100013248
411 Ga0068852_100153935
412 Ga0068852_101614573
413 Ga0068859_100360652
414 Ga0068864_101609043
415 Ga0068866_11027462
416 Ga0068861_102027959
417 Ga0068858_100234639
418 Ga0068858_100693074
419 Ga0068860_100199354
420 Ga0068862_100890399
421 Ga0068862_101670135
422 Ga0081455_10702985
423 Ga0081538_10194888
424 Ga0075365_10630695
425 Ga0070715_10257349
426 Ga0070715_10596785
427 Ga0070716_100085720
428 Ga0070716_101058615
429 Ga0070712_100705856
430 Ga0097621_100036771
431 Ga0097621_100484312
432 Ga0068871_100006961
433 Ga0068871_100056088
434 Ga0068871_100948905
435 Ga0075430_100024597
436 Ga0075431_100044516
437 Ga0075433_10169947
438 Ga0075433_10514723
439 Ga0075434_100031948
440 Ga0075434_100218992
441 Ga0075434_101754487
442 Ga0075436_100014667
443 Ga0075436_101039072
444 Ga0097620_100360650
445 Ga0075435_100324043
446 Ga0075435_100432154
447 Ga0075435_101140876
448 Ga0105240_10144347
449 Ga0111539_11305068
450 Ga0105245_10064343
451 Ga0105245_10554163
452 Ga0114129_10598777
453 Ga0114129_10799683
454 Ga0114129_13418659
455 Ga0105243_10237422
456 Ga0105243_11977083
457 Ga0105242_10067072
458 Ga0105242_10633567
459 Ga0105248_10046319
460 Ga0105248_10064705
461 Ga0105237_12413862
462 Ga0105238_10045613
463 Ga0105238_11170738
464 Ga0105249_10000341
465 Ga0105249_11156320
466 Ga0099796_10473258
467 Ga0105246_11063934
468 Ga0105246_11239466
469 Ga0157369_10119894
470 Ga0157374_10532827
471 Ga0157374_10589283
472 Ga0157378_10037175
473 Ga0157378_10278710
474 Ga0157378_13021927
475 Ga0163162_10290526
476 Ga0163162_10294089
477 Ga0163162_10435436
478 Ga0157372_10006761
479 Ga0157375_10014914
480 Ga0163163_10459554
481 Ga0157380_12316523
482 Ga0157380_12617508
483 Ga0157377_10470846
484 Ga0157379_10190015
485 Ga0157376_10007569
486 Ga0157376_10082446
487 Ga0157376_10525093
488 Ga0157376_10705367
489 Ga0206353_10589812
490 Ga0213876_10021544
491 Ga0207656_10197545
492 Ga0207653_10152863
493 Ga0207680_10563789
494 Ga0207699_10085088
495 Ga0207705_10200012
496 Ga0207684_11191560
497 Ga0207707_10040397
498 Ga0207707_10041518
499 Ga0207707_10042834
500 Ga0207707_10449916
501 Ga0207695_10463738
502 Ga0207671_11125153
503 Ga0207693_10766358
504 Ga0207663_10000028
505 Ga0207660_10034742
506 Ga0207660_10045453
507 Ga0207660_10079982
508 Ga0207662_10719285
509 Ga0207657_10042831
510 Ga0207652_10145157
511 Ga0207652_10376546
512 Ga0207652_10568195
513 Ga0207652_11344365
514 Ga0207681_10089686
515 Ga0207694_10058645
516 Ga0207694_11474695
517 Ga0207650_10596319
518 Ga0207659_10387164
519 Ga0207687_10071901
520 Ga0207687_10196186
521 Ga0207687_10396901
522 Ga0207700_10637965
523 Ga0207664_11114460
524 Ga0207644_10504964
525 Ga0207644_11250404
526 Ga0207690_10248415
527 Ga0207706_11119856
528 Ga0207686_10008384
529 Ga0207709_10240196
530 Ga0207709_11119961
531 Ga0207670_10092195
532 Ga0207669_10020911
533 Ga0207704_10746589
534 Ga0207704_10893750
535 Ga0207704_11058440
536 Ga0207665_10396319
537 Ga0207665_10688779
538 Ga0207711_10080323
539 Ga0207667_10375387
540 Ga0207712_10000503
541 Ga0207668_10049020
542 Ga0207668_10301893
543 Ga0207640_10123311
544 Ga0207640_10198612
545 Ga0207658_10478965
546 Ga0207658_11876759
547 Ga0207677_11467915
548 Ga0207703_10137964
549 Ga0207703_10650382
550 Ga0207639_10156270
551 Ga0207639_10723488
552 Ga0207678_10187443
553 Ga0207702_10067960
554 Ga0207641_12537622
555 Ga0207648_10315440
556 Ga0207676_10946521
557 Ga0207675_101284428
558 Ga0207683_10428374
559 Ga0207683_10442701
560 Ga0207683_11581547
561 Ga0207698_10253379
562 Ga0207698_10980512
563 Ga0268266_10349579
564 Ga0268266_10592896
565 Ga0268265_10844639
566 Ga0268264_10280830
567 Ga0265318_10022684
568 Ga0307408_100008973
569 Ga0307408_100083708
570 Ga0307408_100199277
571 Ga0307408_100815908
572 Ga0307405_10003631
573 Ga0307405_10063468
574 Ga0307405_10341386
575 Ga0307405_10835510
576 Ga0307413_10024106
577 Ga0307410_10001492
578 Ga0307410_10465460
579 Ga0307406_10007978
580 Ga0307406_10026052
581 Ga0307407_10000294
582 Ga0307412_10005385
583 Ga0307412_10787556
584 Ga0307409_100065904
585 Ga0307416_100001808
586 Ga0307416_100077416
587 Ga0307416_100150852
588 Ga0307416_100567438
589 Ga0307414_10003069
590 Ga0307411_10000801
591 Ga0307411_11358185
592 Ga0307411_11423530
593 Ga0307415_100003993
594 Ga0373923_0282137
595 Ga0373953_0277417
596 Ga0373956_0234506
597 Ga0373957_0064923
598 Ga0373946_0562731
599 Ga0373955_0380193
600 Ga0373955_0477160
601 Ga0316574_0801699
602 Ga0373924_0060909
603 Ga0373931_0572533
604 Ga0373935_0295262
605 Ga0373933_0044189
606 Ga0373937_0068310
607 Ga0373937_0664630
608 Ga0373925_0541824
609 Ga0436364_0282028
610 Ga0436365_0714445
611 Ga0436361_0781021
612 Ga0436362_0098660
613 Ga0451789_0580627
614 Ga0451804_1021359
615 Ga0439462_0237598
616 Ga0439446_0076761
617 Ga0439434_0115152
618 Ga0451577_1852704
619 Ga0453683_1189341
620 Ga0453684_0482495
621 Ga0466968_0483758
622 Ga0495592_0063377
623 Ga0495638_0240582
624 Ga0495653_0024145
625 Ga0495608_0017745
626 Ga0495628_0123612
627 Ga0495652_0075712
628 Ga0495665_0532637
629 Ga0495587_0039605
630 Ga0495598_0083798
631 Ga0495645_0002830
632 Ga0495645_0163738
633 Ga0495667_0060132
634 Ga0495635_0088152
635 Ga0495657_0465788
636 Ga0495599_0007117
637 Ga0495623_0168775
638 Ga0495623_0352556
639 Ga0495600_0129113
640 Ga0495604_0142488
641 Ga0495680_0373268
642 Ga0495684_0080968
643 Ga0495602_0133187
644 Ga0496102_0135553
645 Ga0496103_0313944
646 Ga0496106_1389596
647 Ga0501071_0738028
648 Ga0501071_0875357
649 Ga0501076_0632628
650 Ga0501076_0978430
651 Ga0501225_0301288
652 nmdc:mga06z11_813272_c1
653 nmdc:mga0qj67_29845_c1
654 nmdc:mga06r32_29388_c1
655 nmdc:mga0n895_1008777_c1
656 nmdc:mga0n895_1418_c1
657 nmdc:mga0n895_1483995_c1
658 nmdc:mga0rr50_1048976_c1
659 nmdc:mga0rr50_160126_c1
660 nmdc:mga0rr50_905965_c1
661 nmdc:mga08x19_1566_c1
662 nmdc:mga08x19_157787_c1
663 nmdc:mga08x19_973557_c1
664 nmdc:mga0a205_202506_c1
665 nmdc:mga0a205_87911_c1
666 Ga0495601_0053921
667 Ga0495595_0165024
668 Ga0495619_0050173
669 Ga0500641_0065352
670 Ga0500604_0033949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20104

DUF6494

Family of unknown function (DUF6494)

1

68

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a18-assembly1.cif.gz_O 50s deinococcus radiodurans ribosome bounded with mycinamicin iv 0.6578 38 63
2z2r-assembly1.cif.gz_B nucleosome assembly proteins i (nap-1, 74-365) 0.637 42 65
2f8v-assembly2.cif.gz_Y structure of full length telethonin in complex with the n-terminus of titin 0.6203 38 63
4v8c-assembly1.cif.gz_CT crystal structure analysis of ribosomal decoding (near-cognate trna-leu complex with paromomycin). 0.6198 38 63
7un6-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6134 39 65
ID Description Score Start End Superfamily
af_Q86I15_64_202_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.8836 42 65 3.10.110.10
af_A0A0G2K4S7_175_436_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7745 42 65 3.90.70.10
af_Q9W4C3_300_548_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7512 42 64 3.90.70.10
af_A8HAL1_203_469_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7455 42 64 3.90.70.10
af_Q54PQ7_387_619_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7143 42 67 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A6L7XLQ0-F1-model_v4 Uncharacterized protein 0.9693 1 67
AF-A0A3D9HS07-F1-model_v4 Uncharacterized protein 0.9682 1 67
AF-I1YE44-F1-model_v4 Uncharacterized protein 0.9533 1 65
AF-A0A2E5DRJ3-F1-model_v4 RNA-binding S4 domain-containing protein 0.941 1 67
AF-A0A537S8P0-F1-model_v4 Uncharacterized protein 0.9407 1 67

Map