F412021

General Info

Members Datasets Scaffolds Average Seq Length
334 209 668 169

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862507626|2862511948
Length 204
Sequence ENPENAVLREMRWWDIEPVLQVERELFPEDAWSRGMFWSELAHARGPAATRRYVVAEEGDRLVGYAGLTAAGAQPDGDGASGDGTSGGDAAGVADVQTIAVTRDHWGTGLGSRLLTELLRAATAFECAEVFLECRIDNVRAQKLYERFGFESIGVRKGYYQPGNVDALVMRLTDPATSVHPANPMSATNPTNPANGVEGTEIHG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
7 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
8 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
9 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
10 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
15 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
18 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
26 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
27 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
30 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
31 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
32 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
33 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
34 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
35 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
36 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
37 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
41 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
42 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
43 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
44 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
45 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
184 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
185 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
186 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
187 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
188 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
189 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
190 2808606448 Streptomyces sp. 193411 Isolate Unclassified
191 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
192 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
193 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
194 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
195 2862574272 Streptomyces sp. AcE210 Isolate Nodule
196 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
197 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
198 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
199 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
200 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
201 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
202 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
203 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
204 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
205 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
206 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
207 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
208 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
209 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.42
Metatranscriptomes 1.5
Isolates 8.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0.3
Rhizoplane 2.4
Rhizosphere 88.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10015009 3300001990 Bacteria 2509
2 JGI25153J46596_10049352 3300003215 Bacteria 1222
3 rootH2_10054010 3300003320 Bacteria 1331
4 rootL2_10016940 3300003322 Bacteria 9794
5 Ga0006562J51391_1042199 3300003578 Bacteria 4450
6 Ga0006562J51391_1042200 3300003578 Bacteria 5920
7 Ga0105244_10043905 3300009036 Bacteria 2304
8 Ga0105247_10679134 3300009101 Bacteria 773
9 Ga0105248_10313921 3300009177 Bacteria 1765
10 Ga0105238_10662026 3300009551 Bacteria 1055
11 Ga0105249_11848170 3300009553 Bacteria 677
12 Ga0105246_10004697 3300011119 Bacteria 8314
13 Ga0157369_10043199 3300013105 Bacteria 4914
14 Ga0157372_10061617 3300013307 Bacteria 4201
15 Ga0182008_10000155 3300014497 Bacteria 54054
16 Ga0182006_1027772 3300015261 Bacteria 2307
17 Ga0182007_10000136 3300015262 Bacteria 51316
18 Ga0209758_1052213 3300025297 Bacteria 1416
19 Ga0207656_10430471 3300025321 Bacteria 665
20 Ga0207711_11220875 3300025941 Bacteria 693
21 Ga0207679_10527463 3300025945 Bacteria 1057
22 Ga0207712_11283582 3300025961 Bacteria 654
23 Ga0268266_10215206 3300028379 Bacteria 1764
24 Ga0307515_10120301 3300028794 Bacteria 2980
25 Ga0307511_10018953 3300030521 Bacteria 6560
26 Ga0307512_10039696 3300030522 Bacteria 3940
27 Ga0307513_10006635 3300031456 Bacteria 15108
28 Ga0307413_10025977 3300031824 Bacteria 3221
29 Ga0307410_10068664 3300031852 Bacteria 2449
30 Ga0307416_101387537 3300032002 Bacteria 808
31 Ga0395899_0542404 3300037312 Bacteria 749
32 Ga0395898_0020144 3300037466 Bacteria 6776
33 Ga0395898_0244153 3300037466 Bacteria 1713
34 Ga0395905_0074172 3300037471 Bacteria 3189
35 Ga0439436_0009791 3300041404 Bacteria 2934
36 Ga0439439_0000588 3300041406 Bacteria 6382
37 Ga0439439_0005643 3300041406 Bacteria 2866
38 Ga0451853_2504933 3300041512 Bacteria 1195
39 Ga0451853_3173073 3300041512 Bacteria 1532
40 Ga0439448_0046087 3300042005 Bacteria 1420
41 Ga0439449_0012296 3300042007 Bacteria 3216
42 Ga0439449_0022676 3300042007 Bacteria 2350
43 Ga0439449_0231656 3300042007 Bacteria 693
44 Ga0439457_000871 3300042014 Bacteria 9119
45 Ga0439457_001914 3300042014 Bacteria 6125
46 Ga0439462_0001654 3300042015 Bacteria 5014
47 Ga0450920_020455 3300042122 Bacteria 1275
48 Ga0450894_000225 3300042131 Bacteria 10071
49 Ga0450898_000699 3300042134 Bacteria 4055
50 Ga0450899_000066 3300042135 Bacteria 8539
51 Ga0450906_001045 3300042145 Bacteria 6099
52 Ga0450906_080084 3300042145 Bacteria 589
53 Ga0450908_028077 3300042184 Bacteria 980
54 Ga0466969_0005182 3300044656 Bacteria 6931
55 Ga0466972_0001902 3300044658 Bacteria 10255
56 Ga0466972_0011948 3300044658 Bacteria 4362
57 Ga0466972_0016911 3300044658 Bacteria 3648
58 Ga0466972_0061635 3300044658 Bacteria 1798
59 Ga0466965_0000653 3300044683 Bacteria 12707
60 Ga0466965_0010496 3300044683 Bacteria 4324
61 Ga0466965_0489544 3300044683 Bacteria 689
62 Ga0466966_0011706 3300044684 Bacteria 5815
63 Ga0466961_0000611 3300044693 Bacteria 22503
64 Ga0466961_0006911 3300044693 Bacteria 7218
65 Ga0466961_0047102 3300044693 Bacteria 2757
66 Ga0466963_0004346 3300044694 Bacteria 8223
67 Ga0466963_0007112 3300044694 Bacteria 6667
68 Ga0466971_0000457 3300044719 Bacteria 15967
69 Ga0466971_0010926 3300044719 Bacteria 3971
70 Ga0466971_0196472 3300044719 Bacteria 951
71 Ga0466968_0005561 3300044735 Bacteria 4721
72 Ga0466970_0000694 3300044765 Bacteria 16488
73 Ga0466970_0027680 3300044765 Bacteria 2975
74 Ga0466957_0001205 3300044842 Bacteria 13474
75 Ga0466957_0048658 3300044842 Bacteria 2576
76 Ga0466960_0023560 3300044901 Bacteria 2765
77 Ga0466960_0358662 3300044901 Bacteria 833
78 Ga0466959_0000660 3300045049 Bacteria 20099
79 Ga0466959_0197949 3300045049 Bacteria 1400
80 Ga0466958_0000224 3300045836 Bacteria 21400
81 Ga0466967_0000183 3300045976 Bacteria 26073
82 Ga0466967_0016697 3300045976 Bacteria 5799
83 Ga0466967_1679128 3300045976 Bacteria 633
84 Ga0495627_057040 3300046453 Bacteria 1163
85 Ga0495603_0004232 3300046455 Bacteria 8544
86 Ga0495603_0006902 3300046455 Bacteria 6813
87 Ga0495603_0131592 3300046455 Bacteria 1456
88 Ga0495590_0089354 3300046457 Bacteria 1089
89 Ga0495629_0010066 3300046459 Bacteria 6899
90 Ga0495629_0011002 3300046459 Bacteria 6571
91 Ga0495629_0025785 3300046459 Bacteria 4177
92 Ga0495629_0060063 3300046459 Bacteria 2657
93 Ga0495629_0083693 3300046459 Bacteria 2227
94 Ga0495629_0215246 3300046459 Bacteria 1326
95 Ga0495629_0271207 3300046459 Bacteria 1165
96 Ga0495638_0182957 3300046460 Bacteria 1194
97 Ga0495651_0279588 3300046462 Bacteria 1128
98 Ga0495580_0389634 3300046472 Bacteria 940
99 Ga0495582_0084225 3300046473 Bacteria 1767
100 Ga0495605_0001076 3300046474 Bacteria 18189
101 Ga0495605_0039466 3300046474 Bacteria 2365
102 Ga0495605_0444184 3300046474 Bacteria 535
103 Ga0495639_0010515 3300046475 Bacteria 3985
104 Ga0495662_0050669 3300046476 Bacteria 2004
105 Ga0495662_0121845 3300046476 Bacteria 1280
106 Ga0495662_0309296 3300046476 Bacteria 777
107 Ga0495664_0082649 3300046477 Bacteria 1926
108 Ga0495584_0222984 3300046491 Bacteria 958
109 Ga0495585_0026031 3300046492 Bacteria 3345
110 Ga0495585_0239195 3300046492 Bacteria 909
111 Ga0495585_0341914 3300046492 Bacteria 728
112 Ga0495594_0004202 3300046499 Bacteria 7393
113 Ga0495594_0043530 3300046499 Bacteria 2461
114 Ga0495594_0085214 3300046499 Bacteria 1767
115 Ga0495594_0727027 3300046499 Bacteria 561
116 Ga0495607_0099788 3300046501 Bacteria 1557
117 Ga0495607_0170471 3300046501 Bacteria 1099
118 Ga0495583_0035537 3300046506 Bacteria 2377
119 Ga0495583_0071736 3300046506 Bacteria 1520
120 Ga0495606_0027581 3300046507 Bacteria 4023
121 Ga0495606_0122810 3300046507 Bacteria 1552
122 Ga0495608_0120797 3300046511 Bacteria 1680
123 Ga0495610_0006232 3300046512 Bacteria 8269
124 Ga0495610_0123554 3300046512 Bacteria 1131
125 Ga0495616_0052037 3300046513 Bacteria 2040
126 Ga0495618_0126490 3300046514 Bacteria 1636
127 Ga0495618_0566827 3300046514 Bacteria 678
128 Ga0495620_0009811 3300046515 Bacteria 5078
129 Ga0495630_0129370 3300046517 Bacteria 1917
130 Ga0495631_0114928 3300046518 Bacteria 1157
131 Ga0495631_0202199 3300046518 Bacteria 849
132 Ga0495632_0043332 3300046519 Bacteria 2250
133 Ga0495637_0038757 3300046520 Bacteria 2061
134 Ga0495643_0006355 3300046522 Bacteria 7803
135 Ga0495644_0043322 3300046523 Bacteria 1694
136 Ga0495648_0066057 3300046524 Bacteria 2122
137 Ga0495666_0119896 3300046526 Bacteria 1232
138 Ga0495652_0080911 3300046529 Bacteria 2681
139 Ga0495640_0010427 3300046533 Bacteria 7184
140 Ga0495640_0021020 3300046533 Bacteria 4797
141 Ga0495587_0076716 3300046536 Bacteria 1941
142 Ga0495609_0021133 3300046538 Bacteria 3002
143 Ga0495597_0007958 3300046542 Bacteria 5337
144 Ga0495597_0060603 3300046542 Bacteria 1650
145 Ga0495645_0082021 3300046543 Bacteria 2313
146 Ga0495622_0023051 3300046557 Bacteria 2901
147 Ga0495622_0040163 3300046557 Bacteria 2178
148 Ga0495622_0096238 3300046557 Bacteria 1359
149 Ga0495622_0252692 3300046557 Bacteria 775
150 Ga0495633_0015638 3300046558 Bacteria 3933
151 Ga0495633_0066184 3300046558 Bacteria 1688
152 Ga0495667_0136090 3300046559 Bacteria 1584
153 Ga0495656_0109810 3300046615 Bacteria 1288
154 Ga0495668_0020725 3300046616 Bacteria 3778
155 Ga0495668_0059637 3300046616 Bacteria 2105
156 Ga0495634_0178129 3300046642 Bacteria 1332
157 Ga0495611_0049522 3300046648 Bacteria 1890
158 Ga0495625_0014093 3300046660 Bacteria 6397
159 Ga0495635_0032118 3300046663 Bacteria 3643
160 Ga0495635_0486843 3300046663 Bacteria 813
161 Ga0495661_0054541 3300046665 Bacteria 2399
162 Ga0495588_0004173 3300046674 Bacteria 6370
163 Ga0495588_0115402 3300046674 Bacteria 1415
164 Ga0495657_0026243 3300046675 Bacteria 4125
165 Ga0495657_0029102 3300046675 Bacteria 3877
166 Ga0495646_0062819 3300046680 Bacteria 2207
167 Ga0495613_0067854 3300046689 Bacteria 2602
168 Ga0495613_0072315 3300046689 Bacteria 2513
169 Ga0495624_0035240 3300046690 Bacteria 3231
170 Ga0495624_0390736 3300046690 Bacteria 835
171 Ga0495649_0075447 3300046694 Bacteria 1805
172 Ga0495649_0076296 3300046694 Bacteria 1794
173 Ga0495589_0003533 3300046794 Bacteria 8454
174 Ga0495589_0021274 3300046794 Bacteria 3314
175 Ga0495589_0054010 3300046794 Bacteria 1981
176 Ga0495589_0067615 3300046794 Bacteria 1748
177 Ga0495600_0093184 3300046809 Bacteria 1964
178 Ga0495660_0020568 3300046810 Bacteria 3783
179 Ga0495581_0476050 3300047315 Bacteria 726
180 Ga0495604_0022391 3300047317 Bacteria 5046
181 Ga0495604_0033560 3300047317 Bacteria 4062
182 Ga0495636_0002227 3300047318 Bacteria 7443
183 Ga0495636_0034852 3300047318 Bacteria 2072
184 Ga0495636_0043686 3300047318 Bacteria 1865
185 Ga0495636_0252182 3300047318 Bacteria 816
186 Ga0495636_0307407 3300047318 Bacteria 742
187 Ga0495672_0065578 3300047320 Bacteria 2075
188 Ga0495676_0058831 3300047321 Bacteria 3021
189 Ga0495676_0348863 3300047321 Bacteria 989
190 Ga0495680_0133455 3300047322 Bacteria 1822
191 Ga0495683_0038161 3300047323 Bacteria 2433
192 Ga0495687_055760 3300047443 Bacteria 1650
193 Ga0495675_0031142 3300047444 Bacteria 3405
194 Ga0495675_0330859 3300047444 Bacteria 900
195 Ga0495677_0080964 3300047445 Bacteria 1217
196 Ga0495679_065907 3300047446 Bacteria 1053
197 Ga0495685_003195 3300047447 Bacteria 5203
198 Ga0495685_128843 3300047447 Bacteria 828
199 Ga0495685_134699 3300047447 Bacteria 806
200 Ga0495673_0035240 3300047469 Bacteria 2308
201 Ga0495681_0041972 3300047470 Bacteria 2217
202 Ga0495684_0165744 3300047471 Bacteria 1646
203 Ga0495686_0060263 3300047472 Bacteria 2359
204 Ga0495614_0008932 3300048089 Bacteria 4445
205 Ga0495614_0040755 3300048089 Bacteria 1993
206 Ga0495626_0004502 3300048091 Bacteria 8531
207 Ga0495626_0104444 3300048091 Bacteria 1232
208 Ga0496100_0356547 3300048903 Bacteria 1106
209 Ga0496101_0682544 3300048904 Bacteria 811
210 Ga0496105_0371588 3300048908 Bacteria 1139
211 Ga0496108_1182469 3300048911 Bacteria 647
212 Ga0496109_0016036 3300048912 Bacteria 6549
213 Ga0496110_0339360 3300048913 Bacteria 1369
214 Ga0496113_0185995 3300048916 Bacteria 1648
215 Ga0496114_1143809 3300048917 Bacteria 664
216 Ga0496119_0431603 3300048922 Bacteria 624
217 Ga0496125_0412704 3300048928 Bacteria 785
218 Ga0496126_0539622 3300048929 Bacteria 927
219 Ga0501306_001812 3300049127 Bacteria 2083
220 Ga0495678_006981 3300049459 Bacteria 5925
221 Ga0501317_020057 3300049533 Bacteria 898
222 Ga0501317_027530 3300049533 Bacteria 808
223 Ga0501031_0002779 3300049568 Bacteria 11149
224 Ga0501031_0145385 3300049568 Bacteria 1549
225 Ga0501031_0236809 3300049568 Bacteria 1187
226 Ga0501032_0015715 3300049569 Bacteria 5336
227 Ga0501032_0210101 3300049569 Bacteria 1269
228 Ga0501033_0004081 3300049570 Bacteria 11782
229 Ga0501033_0021518 3300049570 Bacteria 4865
230 Ga0501033_0053198 3300049570 Bacteria 2998
231 Ga0501033_0072116 3300049570 Bacteria 2536
232 Ga0501033_0144573 3300049570 Bacteria 1718
233 Ga0501034_0003504 3300049571 Bacteria 17819
234 Ga0501034_0012671 3300049571 Bacteria 8700
235 Ga0501034_0394638 3300049571 Bacteria 1307
236 Ga0501036_0000494 3300049572 Bacteria 28194
237 Ga0501036_0008385 3300049572 Bacteria 8468
238 Ga0501036_0027744 3300049572 Bacteria 4786
239 Ga0501036_0029201 3300049572 Bacteria 4661
240 Ga0501036_0061996 3300049572 Bacteria 3167
241 Ga0501037_0022427 3300049573 Bacteria 4670
242 Ga0501037_0026848 3300049573 Bacteria 4253
243 Ga0501037_0360398 3300049573 Bacteria 1002
244 Ga0501038_0005220 3300049574 Bacteria 12090
245 Ga0501038_0027814 3300049574 Bacteria 5025
246 Ga0501038_0090326 3300049574 Bacteria 2567
247 Ga0501038_0101677 3300049574 Bacteria 2392
248 Ga0501038_0609250 3300049574 Bacteria 825
249 Ga0501039_0003935 3300049575 Bacteria 11165
250 Ga0501039_0035280 3300049575 Bacteria 3859
251 Ga0501039_0570842 3300049575 Bacteria 887
252 Ga0501040_0011135 3300049576 Bacteria 5879
253 Ga0501042_0005470 3300049578 Bacteria 8179
254 Ga0501043_0002870 3300049579 Bacteria 14387
255 Ga0501043_0005728 3300049579 Bacteria 10009
256 Ga0501043_0007828 3300049579 Bacteria 8446
257 Ga0501043_0321220 3300049579 Bacteria 1180
258 Ga0501043_0391927 3300049579 Bacteria 1050
259 Ga0501046_0009211 3300049580 Bacteria 8548
260 Ga0501046_0019825 3300049580 Bacteria 5569
261 Ga0501046_0101074 3300049580 Bacteria 2212
262 Ga0501046_0153249 3300049580 Bacteria 1738
263 Ga0501047_0008284 3300049581 Bacteria 9813
264 Ga0501047_0008530 3300049581 Bacteria 9666
265 Ga0501047_0021108 3300049581 Bacteria 6252
266 Ga0501047_0042027 3300049581 Bacteria 4418
267 Ga0501047_0101006 3300049581 Bacteria 2764
268 Ga0501047_0120059 3300049581 Bacteria 2511
269 Ga0501048_0023250 3300049582 Bacteria 4532
270 Ga0501048_0037095 3300049582 Bacteria 3500
271 Ga0501067_0004119 3300049583 Bacteria 8014
272 Ga0501068_0013319 3300049584 Bacteria 4677
273 Ga0501069_0022069 3300049585 Bacteria 3459
274 Ga0501070_0000894 3300049586 Bacteria 27126
275 Ga0501070_0012723 3300049586 Bacteria 7096
276 Ga0501070_0652515 3300049586 Bacteria 835
277 Ga0501071_0016341 3300049587 Bacteria 5102
278 Ga0501072_0004233 3300049588 Bacteria 10884
279 Ga0501073_0031872 3300049589 Bacteria 3760
280 Ga0501074_0186189 3300049590 Bacteria 1480
281 Ga0501076_0046079 3300049592 Bacteria 3444
282 Ga0501077_0025667 3300049593 Bacteria 3740
283 Ga0501079_0021813 3300049741 Bacteria 4902
284 Ga0501080_0018513 3300049742 Bacteria 6442
285 Ga0501083_0002875 3300049744 Bacteria 11919
286 Ga0501035_0002481 3300049822 Bacteria 18028
287 Ga0501035_0005580 3300049822 Bacteria 11888
288 Ga0501035_0032746 3300049822 Bacteria 4727
289 Ga0501035_0082959 3300049822 Bacteria 2828
290 Ga0501035_0106126 3300049822 Bacteria 2463
291 Ga0501035_0157688 3300049822 Bacteria 1966
292 Ga0501044_0001248 3300049823 Bacteria 30179
293 Ga0501044_0013853 3300049823 Bacteria 8716
294 Ga0501044_0016952 3300049823 Bacteria 7815
295 Ga0501044_0029133 3300049823 Bacteria 5822
296 Ga0501044_0080126 3300049823 Bacteria 3307
297 Ga0501044_0172288 3300049823 Bacteria 2135
298 Ga0501044_0317772 3300049823 Bacteria 1482
299 Ga0501044_0827956 3300049823 Bacteria 803
300 Ga0501045_0018133 3300049824 Bacteria 5002
301 Ga0501045_0167589 3300049824 Bacteria 1636
302 nmdc:mga06z11_371513_c1 3300050494 Bacteria 858
303 Ga0501084_0114486 3300054114 Bacteria 2267
304 Ga0501082_0105207 3300060353 Bacteria 2441
305 Ga0466962_0000658 3300061719 Bacteria 15325
306 Ga0466962_0093744 3300061719 Bacteria 1439
307 Ga0530510_0047778 3300061734 Bacteria 3093
308 2862511948 2862507626 Bacteria 9425308
309 2547411333 2547132111 Bacteria 8013147
310 2616696728 2616644814 Bacteria 11555299
311 2768643565 2767802112 Bacteria 6465194
312 2784589794 2784132148 Bacteria 8627943
313 2785341820 2784746763 Bacteria 9783172
314 2793983418 2791355406 Bacteria 11364898
315 2809233464 2808606448 Bacteria 8656184
316 2811845055 2808606982 Bacteria 7791042
317 2812356652 2811994879 Bacteria 9313447
318 2812479368 2811994917 Bacteria 7761064
319 2852642797 2852635781 Bacteria 8251373
320 2862578131 2862574272 Bacteria 10567477
321 2863411511 2863404153 Bacteria 9672205
322 2873154654 2873151551 Bacteria 8625867
323 2912730734 2912723979 Bacteria 8557534
324 2946069216 2946064051 Bacteria 8957905
325 2954004797 2954002825 Bacteria 9173742
326 2954384657 2954380949 Bacteria 10050426
327 2954695513 2954691527 Bacteria 10720516
328 2954710707 2954701450 Bacteria 10834262
329 3006326154 3006321560 Bacteria 8247479
330 3006397784 3006393351 Bacteria 6615579
331 3006490362 3006486233 Bacteria 8157040
332 8023626987 8023623736 Bacteria 8593882
333 8025483239 8025478263 Bacteria 8209203
334 8048413789 8048406513 Bacteria 8936924
335 JGI24737J22298_10015009
336 JGI25153J46596_10049352
337 rootH2_10054010
338 rootL2_10016940
339 Ga0006562J51391_1042199
340 Ga0006562J51391_1042200
341 Ga0105244_10043905
342 Ga0105247_10679134
343 Ga0105248_10313921
344 Ga0105238_10662026
345 Ga0105249_11848170
346 Ga0105246_10004697
347 Ga0157369_10043199
348 Ga0157372_10061617
349 Ga0182008_10000155
350 Ga0182006_1027772
351 Ga0182007_10000136
352 Ga0209758_1052213
353 Ga0207656_10430471
354 Ga0207711_11220875
355 Ga0207679_10527463
356 Ga0207712_11283582
357 Ga0268266_10215206
358 Ga0307515_10120301
359 Ga0307511_10018953
360 Ga0307512_10039696
361 Ga0307513_10006635
362 Ga0307413_10025977
363 Ga0307410_10068664
364 Ga0307416_101387537
365 Ga0395899_0542404
366 Ga0395898_0020144
367 Ga0395898_0244153
368 Ga0395905_0074172
369 Ga0439436_0009791
370 Ga0439439_0000588
371 Ga0439439_0005643
372 Ga0451853_2504933
373 Ga0451853_3173073
374 Ga0439448_0046087
375 Ga0439449_0012296
376 Ga0439449_0022676
377 Ga0439449_0231656
378 Ga0439457_000871
379 Ga0439457_001914
380 Ga0439462_0001654
381 Ga0450920_020455
382 Ga0450894_000225
383 Ga0450898_000699
384 Ga0450899_000066
385 Ga0450906_001045
386 Ga0450906_080084
387 Ga0450908_028077
388 Ga0466969_0005182
389 Ga0466972_0001902
390 Ga0466972_0011948
391 Ga0466972_0016911
392 Ga0466972_0061635
393 Ga0466965_0000653
394 Ga0466965_0010496
395 Ga0466965_0489544
396 Ga0466966_0011706
397 Ga0466961_0000611
398 Ga0466961_0006911
399 Ga0466961_0047102
400 Ga0466963_0004346
401 Ga0466963_0007112
402 Ga0466971_0000457
403 Ga0466971_0010926
404 Ga0466971_0196472
405 Ga0466968_0005561
406 Ga0466970_0000694
407 Ga0466970_0027680
408 Ga0466957_0001205
409 Ga0466957_0048658
410 Ga0466960_0023560
411 Ga0466960_0358662
412 Ga0466959_0000660
413 Ga0466959_0197949
414 Ga0466958_0000224
415 Ga0466967_0000183
416 Ga0466967_0016697
417 Ga0466967_1679128
418 Ga0495627_057040
419 Ga0495603_0004232
420 Ga0495603_0006902
421 Ga0495603_0131592
422 Ga0495590_0089354
423 Ga0495629_0010066
424 Ga0495629_0011002
425 Ga0495629_0025785
426 Ga0495629_0060063
427 Ga0495629_0083693
428 Ga0495629_0215246
429 Ga0495629_0271207
430 Ga0495638_0182957
431 Ga0495651_0279588
432 Ga0495580_0389634
433 Ga0495582_0084225
434 Ga0495605_0001076
435 Ga0495605_0039466
436 Ga0495605_0444184
437 Ga0495639_0010515
438 Ga0495662_0050669
439 Ga0495662_0121845
440 Ga0495662_0309296
441 Ga0495664_0082649
442 Ga0495584_0222984
443 Ga0495585_0026031
444 Ga0495585_0239195
445 Ga0495585_0341914
446 Ga0495594_0004202
447 Ga0495594_0043530
448 Ga0495594_0085214
449 Ga0495594_0727027
450 Ga0495607_0099788
451 Ga0495607_0170471
452 Ga0495583_0035537
453 Ga0495583_0071736
454 Ga0495606_0027581
455 Ga0495606_0122810
456 Ga0495608_0120797
457 Ga0495610_0006232
458 Ga0495610_0123554
459 Ga0495616_0052037
460 Ga0495618_0126490
461 Ga0495618_0566827
462 Ga0495620_0009811
463 Ga0495630_0129370
464 Ga0495631_0114928
465 Ga0495631_0202199
466 Ga0495632_0043332
467 Ga0495637_0038757
468 Ga0495643_0006355
469 Ga0495644_0043322
470 Ga0495648_0066057
471 Ga0495666_0119896
472 Ga0495652_0080911
473 Ga0495640_0010427
474 Ga0495640_0021020
475 Ga0495587_0076716
476 Ga0495609_0021133
477 Ga0495597_0007958
478 Ga0495597_0060603
479 Ga0495645_0082021
480 Ga0495622_0023051
481 Ga0495622_0040163
482 Ga0495622_0096238
483 Ga0495622_0252692
484 Ga0495633_0015638
485 Ga0495633_0066184
486 Ga0495667_0136090
487 Ga0495656_0109810
488 Ga0495668_0020725
489 Ga0495668_0059637
490 Ga0495634_0178129
491 Ga0495611_0049522
492 Ga0495625_0014093
493 Ga0495635_0032118
494 Ga0495635_0486843
495 Ga0495661_0054541
496 Ga0495588_0004173
497 Ga0495588_0115402
498 Ga0495657_0026243
499 Ga0495657_0029102
500 Ga0495646_0062819
501 Ga0495613_0067854
502 Ga0495613_0072315
503 Ga0495624_0035240
504 Ga0495624_0390736
505 Ga0495649_0075447
506 Ga0495649_0076296
507 Ga0495589_0003533
508 Ga0495589_0021274
509 Ga0495589_0054010
510 Ga0495589_0067615
511 Ga0495600_0093184
512 Ga0495660_0020568
513 Ga0495581_0476050
514 Ga0495604_0022391
515 Ga0495604_0033560
516 Ga0495636_0002227
517 Ga0495636_0034852
518 Ga0495636_0043686
519 Ga0495636_0252182
520 Ga0495636_0307407
521 Ga0495672_0065578
522 Ga0495676_0058831
523 Ga0495676_0348863
524 Ga0495680_0133455
525 Ga0495683_0038161
526 Ga0495687_055760
527 Ga0495675_0031142
528 Ga0495675_0330859
529 Ga0495677_0080964
530 Ga0495679_065907
531 Ga0495685_003195
532 Ga0495685_128843
533 Ga0495685_134699
534 Ga0495673_0035240
535 Ga0495681_0041972
536 Ga0495684_0165744
537 Ga0495686_0060263
538 Ga0495614_0008932
539 Ga0495614_0040755
540 Ga0495626_0004502
541 Ga0495626_0104444
542 Ga0496100_0356547
543 Ga0496101_0682544
544 Ga0496105_0371588
545 Ga0496108_1182469
546 Ga0496109_0016036
547 Ga0496110_0339360
548 Ga0496113_0185995
549 Ga0496114_1143809
550 Ga0496119_0431603
551 Ga0496125_0412704
552 Ga0496126_0539622
553 Ga0501306_001812
554 Ga0495678_006981
555 Ga0501317_020057
556 Ga0501317_027530
557 Ga0501031_0002779
558 Ga0501031_0145385
559 Ga0501031_0236809
560 Ga0501032_0015715
561 Ga0501032_0210101
562 Ga0501033_0004081
563 Ga0501033_0021518
564 Ga0501033_0053198
565 Ga0501033_0072116
566 Ga0501033_0144573
567 Ga0501034_0003504
568 Ga0501034_0012671
569 Ga0501034_0394638
570 Ga0501036_0000494
571 Ga0501036_0008385
572 Ga0501036_0027744
573 Ga0501036_0029201
574 Ga0501036_0061996
575 Ga0501037_0022427
576 Ga0501037_0026848
577 Ga0501037_0360398
578 Ga0501038_0005220
579 Ga0501038_0027814
580 Ga0501038_0090326
581 Ga0501038_0101677
582 Ga0501038_0609250
583 Ga0501039_0003935
584 Ga0501039_0035280
585 Ga0501039_0570842
586 Ga0501040_0011135
587 Ga0501042_0005470
588 Ga0501043_0002870
589 Ga0501043_0005728
590 Ga0501043_0007828
591 Ga0501043_0321220
592 Ga0501043_0391927
593 Ga0501046_0009211
594 Ga0501046_0019825
595 Ga0501046_0101074
596 Ga0501046_0153249
597 Ga0501047_0008284
598 Ga0501047_0008530
599 Ga0501047_0021108
600 Ga0501047_0042027
601 Ga0501047_0101006
602 Ga0501047_0120059
603 Ga0501048_0023250
604 Ga0501048_0037095
605 Ga0501067_0004119
606 Ga0501068_0013319
607 Ga0501069_0022069
608 Ga0501070_0000894
609 Ga0501070_0012723
610 Ga0501070_0652515
611 Ga0501071_0016341
612 Ga0501072_0004233
613 Ga0501073_0031872
614 Ga0501074_0186189
615 Ga0501076_0046079
616 Ga0501077_0025667
617 Ga0501079_0021813
618 Ga0501080_0018513
619 Ga0501083_0002875
620 Ga0501035_0002481
621 Ga0501035_0005580
622 Ga0501035_0032746
623 Ga0501035_0082959
624 Ga0501035_0106126
625 Ga0501035_0157688
626 Ga0501044_0001248
627 Ga0501044_0013853
628 Ga0501044_0016952
629 Ga0501044_0029133
630 Ga0501044_0080126
631 Ga0501044_0172288
632 Ga0501044_0317772
633 Ga0501044_0827956
634 Ga0501045_0018133
635 Ga0501045_0167589
636 nmdc:mga06z11_371513_c1
637 Ga0501084_0114486
638 Ga0501082_0105207
639 Ga0466962_0000658
640 Ga0466962_0093744
641 Ga0530510_0047778
642 2862511948
643 2547411333
644 2616696728
645 2768643565
646 2784589794
647 2785341820
648 2793983418
649 2809233464
650 2811845055
651 2812356652
652 2812479368
653 2852642797
654 2862578131
655 2863411511
656 2873154654
657 2912730734
658 2946069216
659 2954004797
660 2954384657
661 2954695513
662 2954710707
663 3006326154
664 3006397784
665 3006490362
666 8023626987
667 8025483239
668 8048413789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

91

160

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

150

0.89

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

36

160

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

49

152

0.83

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

5

151

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.9159 52 157
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.9116 47 156
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8939 47 157
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.8829 52 157
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.8803 112 156
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9447 110 156 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9293 62 104 3.40.630.30
af_Q94AC8_62_254_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9228 63 137 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9199 76 156 3.40.630.30
af_I1KF23_15_150_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9103 17 155 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7Y4ZNP8-F1-model_v4 GNAT family N-acetyltransferase 0.9733 56 138 GO:0016747
AF-A0A357LH61-F1-model_v4 N-acetyltransferase domain-containing protein 0.9641 70 157 GO:0016747
AF-A0A7V2LEI0-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9627 65 161 GO:0005737
GO:0005840
GO:0008080
AF-A0A0U1PBG9-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9468 61 162 GO:0005737
GO:0008999
AF-A0A7C0YQ57-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.9458 54 159 GO:0004596
GO:0031415

Map