F411995

General Info

Members Datasets Scaffolds Average Seq Length
334 171 668 246

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_347138_c1|nmdc:mga09592_347138_c1_274_1017
Length 247
Sequence VIRVRELTKRHGAHEVLRGVSLDVPQGDVAVIIGPSGGGKSTFLRCLNGLERFDGGRVEIDGTTLEPRMPHTLEAQAHRAVRARVGMVFQQFHLFPHKSVLENVVEAPIHVAHEPPDQARARALALLERVGLASKAHARPGVLSGGEQQRVAIARALAMHPEVILFDEPTSSLDPRRTAEVLSVLTDLAAEGQTMVVVTHAMTFARKAAKHVHVFHEGRVIESGPPEQVLEAPHNPTTREFLRLSEE

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
159 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
160 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
161 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
162 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
163 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
164 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
165 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_347138_c1 3300050508 Bacteria 1284
2 SwRhRL3b_contig_3503260 2162886006 Bacteria 886
3 SwRhRL3b_contig_862588 2162886006 Bacteria 894
4 JGI25406J46586_10009504 3300003203 Bacteria 4352
5 Ga0065704_10090725 3300005289 Bacteria 2767
6 Ga0065704_10262628 3300005289 Bacteria 952
7 Ga0065712_10019027 3300005290 Bacteria 2168
8 Ga0065712_10101798 3300005290 Bacteria 2025
9 Ga0065715_10000702 3300005293 Bacteria 9876
10 Ga0065715_10009549 3300005293 Bacteria 2888
11 Ga0065715_10020891 3300005293 Bacteria 2435
12 Ga0065715_10107203 3300005293 Bacteria 2784
13 Ga0065715_10226195 3300005293 Bacteria 1252
14 Ga0065707_10254071 3300005295 Bacteria 1116
15 Ga0070690_100079838 3300005330 Bacteria 2139
16 Ga0070670_100205278 3300005331 Bacteria 1713
17 Ga0070677_10097087 3300005333 Bacteria 1292
18 Ga0068869_100029581 3300005334 Bacteria 3839
19 Ga0068869_100078932 3300005334 Bacteria 2452
20 Ga0070666_10026534 3300005335 Bacteria 3787
21 Ga0070680_100009139 3300005336 Bacteria 7600
22 Ga0070680_100027761 3300005336 Bacteria 4535
23 Ga0070680_100520746 3300005336 Bacteria 1018
24 Ga0070682_100186043 3300005337 Bacteria 1454
25 Ga0068868_100037187 3300005338 Bacteria 3773
26 Ga0068868_100133678 3300005338 Bacteria 2032
27 Ga0070660_100013987 3300005339 Bacteria 5774
28 Ga0070689_100189456 3300005340 Bacteria 1674
29 Ga0070687_100027023 3300005343 Bacteria 2768
30 Ga0070692_10015499 3300005345 Bacteria 3605
31 Ga0070692_10031745 3300005345 Bacteria 2650
32 Ga0070669_100014079 3300005353 Bacteria 5688
33 Ga0070669_100171768 3300005353 Bacteria 1690
34 Ga0070675_100072773 3300005354 Bacteria 2853
35 Ga0070671_100005652 3300005355 Bacteria 9951
36 Ga0070671_100112664 3300005355 Bacteria 2285
37 Ga0070671_100269633 3300005355 Bacteria 1447
38 Ga0070674_100257512 3300005356 Bacteria 1373
39 Ga0070673_100107338 3300005364 Bacteria 2309
40 Ga0070673_100408918 3300005364 Bacteria 1215
41 Ga0070688_100563240 3300005365 Bacteria 868
42 Ga0070659_100005902 3300005366 Bacteria 8821
43 Ga0070703_10000014 3300005406 Bacteria 89131
44 Ga0070709_10087720 3300005434 Bacteria 2045
45 Ga0070701_10076310 3300005438 Bacteria 1804
46 Ga0070701_10166812 3300005438 Bacteria 1280
47 Ga0070705_100212325 3300005440 Bacteria 1335
48 Ga0070700_100008791 3300005441 Bacteria 5516
49 Ga0070700_100069046 3300005441 Bacteria 2249
50 Ga0070700_100431044 3300005441 Bacteria 998
51 Ga0070694_100099045 3300005444 Bacteria 2059
52 Ga0070708_100060170 3300005445 Bacteria 3389
53 Ga0070708_100074528 3300005445 Bacteria 3061
54 Ga0070708_100237358 3300005445 Bacteria 1711
55 Ga0070662_100432365 3300005457 Unclassified 1090
56 Ga0070681_10018209 3300005458 Bacteria 7022
57 Ga0070681_10207587 3300005458 Bacteria 1875
58 Ga0068867_100087039 3300005459 Bacteria 2365
59 Ga0068867_100100252 3300005459 Bacteria 2211
60 Ga0068867_100132490 3300005459 Bacteria 1939
61 Ga0068867_100361102 3300005459 Bacteria 1215
62 Ga0070685_10055205 3300005466 Bacteria 2308
63 Ga0070706_100001194 3300005467 Bacteria 27840
64 Ga0070706_100009351 3300005467 Bacteria 9129
65 Ga0070707_100037857 3300005468 Bacteria 4606
66 Ga0070707_100054879 3300005468 Bacteria 3821
67 Ga0070707_100225546 3300005468 Bacteria 1824
68 Ga0070707_100427631 3300005468 Bacteria 1285
69 Ga0070707_100523507 3300005468 Bacteria 1148
70 Ga0070698_100079667 3300005471 Bacteria 3271
71 Ga0070698_100678646 3300005471 Bacteria 972
72 Ga0070699_100021174 3300005518 Bacteria 5606
73 Ga0070699_100388524 3300005518 Bacteria 1261
74 Ga0070699_100764733 3300005518 Bacteria 884
75 Ga0070679_100000102 3300005530 Bacteria 66094
76 Ga0070679_100014012 3300005530 Bacteria 7686
77 Ga0070684_100225230 3300005535 Unclassified 1711
78 Ga0070697_100019653 3300005536 Bacteria 5336
79 Ga0070697_100347675 3300005536 Bacteria 1280
80 Ga0070697_100356170 3300005536 Bacteria 1264
81 Ga0070697_100589361 3300005536 Bacteria 977
82 Ga0068853_100043384 3300005539 Unclassified 3847
83 Ga0068853_100580882 3300005539 Bacteria 1063
84 Ga0070672_100274015 3300005543 Bacteria 1425
85 Ga0070672_100507367 3300005543 Bacteria 1044
86 Ga0070695_100089936 3300005545 Bacteria 2048
87 Ga0070695_100114408 3300005545 Bacteria 1836
88 Ga0070695_100356054 3300005545 Bacteria 1098
89 Ga0070695_100443865 3300005545 Unclassified 993
90 Ga0070696_100195990 3300005546 Bacteria 1506
91 Ga0070696_100340578 3300005546 Bacteria 1159
92 Ga0070696_100472770 3300005546 Bacteria 993
93 Ga0070696_100522128 3300005546 Bacteria 948
94 Ga0070693_100116228 3300005547 Bacteria 1653
95 Ga0070665_100112905 3300005548 Bacteria 2720
96 Ga0070704_100173135 3300005549 Bacteria 1719
97 Ga0070704_100267997 3300005549 Bacteria 1410
98 Ga0068855_100532276 3300005563 Bacteria 1274
99 Ga0070664_100024915 3300005564 Bacteria 4957
100 Ga0068857_100019528 3300005577 Bacteria 5953
101 Ga0068857_100179330 3300005577 Bacteria 1927
102 Ga0068857_100491333 3300005577 Bacteria 1151
103 Ga0068854_100286254 3300005578 Bacteria 1329
104 Ga0068854_100543517 3300005578 Bacteria 984
105 Ga0068856_100025769 3300005614 Bacteria 5734
106 Ga0070702_100014806 3300005615 Bacteria 3967
107 Ga0070702_100092810 3300005615 Bacteria 1834
108 Ga0068852_100266907 3300005616 Bacteria 1646
109 Ga0068859_100156235 3300005617 Bacteria 2358
110 Ga0068864_100058547 3300005618 Bacteria 3331
111 Ga0068864_100065220 3300005618 Bacteria 3159
112 Ga0068864_100321892 3300005618 Bacteria 1452
113 Ga0068864_100429971 3300005618 Unclassified 1259
114 Ga0068866_10017920 3300005718 Bacteria 3194
115 Ga0068861_100000821 3300005719 Bacteria 18796
116 Ga0068861_100153575 3300005719 Bacteria 1891
117 Ga0068870_10130905 3300005840 Bacteria 1457
118 Ga0068870_10286766 3300005840 Bacteria 1034
119 Ga0068863_100408506 3300005841 Bacteria 1329
120 Ga0068863_100610778 3300005841 Bacteria 1080
121 Ga0068860_100020460 3300005843 Bacteria 6409
122 Ga0068860_100044889 3300005843 Bacteria 4212
123 Ga0068860_100855058 3300005843 Bacteria 924
124 Ga0068862_100026600 3300005844 Bacteria 4863
125 Ga0068862_100132675 3300005844 Bacteria 2205
126 Ga0081539_10000149 3300005985 Bacteria 161420
127 Ga0070715_10000016 3300006163 Bacteria 134692
128 Ga0070716_100000001 3300006173 Bacteria 400668
129 Ga0070716_100024795 3300006173 Bacteria 3195
130 Ga0070716_100084474 3300006173 Bacteria 1904
131 Ga0070716_100123229 3300006173 Bacteria 1626
132 Ga0097621_100024587 3300006237 Bacteria 4705
133 Ga0097621_100027697 3300006237 Bacteria 4459
134 Ga0068871_100007072 3300006358 Bacteria 8000
135 Ga0068871_100018263 3300006358 Bacteria 5327
136 Ga0075428_100666460 3300006844 Bacteria 1109
137 Ga0075433_10013503 3300006852 Bacteria 6642
138 Ga0075433_10015438 3300006852 Bacteria 6264
139 Ga0075433_10099788 3300006852 Bacteria 2570
140 Ga0075433_10106002 3300006852 Bacteria 2491
141 Ga0075433_10142786 3300006852 Bacteria 2128
142 Ga0075433_10742701 3300006852 Bacteria 859
143 Ga0075434_100094068 3300006871 Unclassified 3001
144 Ga0075434_100493904 3300006871 Bacteria 1245
145 Ga0075429_100350257 3300006880 Bacteria 1293
146 Ga0068865_100055405 3300006881 Bacteria 2758
147 Ga0075436_100000051 3300006914 Bacteria 70811
148 Ga0075436_100016102 3300006914 Bacteria 5118
149 Ga0097620_100156219 3300006931 Bacteria 2358
150 Ga0075435_100490263 3300007076 Bacteria 1062
151 Ga0105251_10097562 3300009011 Bacteria 1345
152 Ga0111539_10001370 3300009094 Bacteria 32419
153 Ga0111539_10052426 3300009094 Bacteria 4856
154 Ga0111539_10615497 3300009094 Bacteria 1265
155 Ga0105245_11181118 3300009098 Bacteria 813
156 Ga0114129_10018284 3300009147 Bacteria 9983
157 Ga0114129_10026072 3300009147 Bacteria 8277
158 Ga0114129_10120636 3300009147 Bacteria 3610
159 Ga0114129_10175977 3300009147 Bacteria 2915
160 Ga0114129_10298616 3300009147 Bacteria 2148
161 Ga0114129_10502533 3300009147 Bacteria 1583
162 Ga0114129_11059200 3300009147 Bacteria 1018
163 Ga0105243_10077553 3300009148 Bacteria 2703
164 Ga0105243_10138057 3300009148 Bacteria 2077
165 Ga0105243_10934135 3300009148 Bacteria 865
166 Ga0105241_10041419 3300009174 Bacteria 3480
167 Ga0105241_10076867 3300009174 Bacteria 2604
168 Ga0105241_10652322 3300009174 Bacteria 956
169 Ga0105248_10055764 3300009177 Bacteria 4433
170 Ga0105248_10267164 3300009177 Bacteria 1926
171 Ga0105248_11138373 3300009177 Bacteria 882
172 Ga0105237_10085053 3300009545 Bacteria 3153
173 Ga0105238_10708581 3300009551 Bacteria 1019
174 Ga0105249_10111568 3300009553 Unclassified 2586
175 Ga0105249_10274256 3300009553 Bacteria 1681
176 Ga0105249_10481019 3300009553 Bacteria 1284
177 Ga0105249_10645458 3300009553 Bacteria 1116
178 Ga0105246_10034151 3300011119 Bacteria 3386
179 Ga0157378_10027290 3300013297 Bacteria 5039
180 Ga0157378_10054041 3300013297 Bacteria 3576
181 Ga0157378_10150208 3300013297 Bacteria 2170
182 Ga0163162_10004195 3300013306 Bacteria 13856
183 Ga0163162_10005808 3300013306 Bacteria 11942
184 Ga0157372_10038704 3300013307 Bacteria 5262
185 Ga0157372_11133919 3300013307 Bacteria 904
186 Ga0157375_10091457 3300013308 Bacteria 3104
187 Ga0157375_10116749 3300013308 Bacteria 2773
188 Ga0157375_10163755 3300013308 Bacteria 2368
189 Ga0163163_10001292 3300014325 Bacteria 21162
190 Ga0163163_10005396 3300014325 Bacteria 11049
191 Ga0163163_10034355 3300014325 Bacteria 4909
192 Ga0163163_10038694 3300014325 Bacteria 4649
193 Ga0163163_10060682 3300014325 Bacteria 3746
194 Ga0163163_10079670 3300014325 Bacteria 3274
195 Ga0163163_10090257 3300014325 Bacteria 3077
196 Ga0157380_10016264 3300014326 Bacteria 5482
197 Ga0157380_10425332 3300014326 Bacteria 1268
198 Ga0157377_10135459 3300014745 Bacteria 1508
199 Ga0157376_10995429 3300014969 Bacteria 861
200 Ga0163161_10011832 3300017792 Bacteria 6051
201 Ga0213876_10000142 3300021384 Bacteria 77431
202 Ga0213876_10005410 3300021384 Bacteria 7029
203 Ga0207697_10025263 3300025315 Bacteria 2429
204 Ga0207653_10000054 3300025885 Bacteria 87543
205 Ga0207642_10003939 3300025899 Bacteria 4735
206 Ga0207688_10060249 3300025901 Bacteria 2138
207 Ga0207680_10199297 3300025903 Bacteria 1363
208 Ga0207647_10042116 3300025904 Unclassified 2867
209 Ga0207685_10000045 3300025905 Bacteria 49189
210 Ga0207699_10072228 3300025906 Bacteria 2113
211 Ga0207684_10006039 3300025910 Bacteria 11084
212 Ga0207684_10006459 3300025910 Bacteria 10690
213 Ga0207684_10115755 3300025910 Bacteria 2297
214 Ga0207684_10137554 3300025910 Bacteria 2098
215 Ga0207654_10482969 3300025911 Bacteria 873
216 Ga0207707_10000013 3300025912 Bacteria 264517
217 Ga0207707_10356651 3300025912 Unclassified 1259
218 Ga0207660_10021156 3300025917 Bacteria 4373
219 Ga0207660_10095983 3300025917 Unclassified 2206
220 Ga0207662_10006164 3300025918 Bacteria 6453
221 Ga0207657_10135832 3300025919 Unclassified 2012
222 Ga0207652_10002871 3300025921 Bacteria 14421
223 Ga0207652_10156810 3300025921 Unclassified 2040
224 Ga0207646_10000399 3300025922 Bacteria 58192
225 Ga0207646_10013639 3300025922 Bacteria 7762
226 Ga0207646_10067698 3300025922 Bacteria 3188
227 Ga0207646_10087899 3300025922 Bacteria 2781
228 Ga0207646_10284404 3300025922 Bacteria 1495
229 Ga0207681_10091513 3300025923 Bacteria 2173
230 Ga0207681_10115281 3300025923 Bacteria 1961
231 Ga0207687_10012371 3300025927 Bacteria 5577
232 Ga0207644_10016403 3300025931 Bacteria 4983
233 Ga0207690_10208308 3300025932 Unclassified 1489
234 Ga0207686_10260505 3300025934 Unclassified 1271
235 Ga0207709_10099968 3300025935 Bacteria 1915
236 Ga0207709_10263092 3300025935 Bacteria 1266
237 Ga0207670_10000292 3300025936 Bacteria 30537
238 Ga0207670_10303262 3300025936 Bacteria 1251
239 Ga0207669_10226084 3300025937 Bacteria 1377
240 Ga0207704_10226799 3300025938 Bacteria 1386
241 Ga0207665_10000016 3300025939 Bacteria 132853
242 Ga0207665_10115274 3300025939 Bacteria 1893
243 Ga0207665_10134560 3300025939 Bacteria 1757
244 Ga0207665_10186400 3300025939 Bacteria 1505
245 Ga0207691_10019914 3300025940 Bacteria 6347
246 Ga0207691_10061198 3300025940 Bacteria 3420
247 Ga0207711_10124609 3300025941 Bacteria 2303
248 Ga0207711_10261235 3300025941 Bacteria 1591
249 Ga0207689_10085932 3300025942 Unclassified 2586
250 Ga0207689_10089135 3300025942 Bacteria 2534
251 Ga0207679_10017899 3300025945 Bacteria 4735
252 Ga0207679_10409889 3300025945 Bacteria 1194
253 Ga0207667_10634720 3300025949 Bacteria 1075
254 Ga0207712_10006703 3300025961 Bacteria 7260
255 Ga0207712_10046970 3300025961 Bacteria 2996
256 Ga0207712_10257383 3300025961 Bacteria 1414
257 Ga0207640_10105344 3300025981 Bacteria 1987
258 Ga0207640_10112537 3300025981 Bacteria 1933
259 Ga0207640_10294546 3300025981 Bacteria 1281
260 Ga0207640_10402494 3300025981 Bacteria 1115
261 Ga0207639_10051033 3300026041 Unclassified 3144
262 Ga0207639_10066227 3300026041 Bacteria 2807
263 Ga0207639_10174891 3300026041 Bacteria 1822
264 Ga0207708_10008202 3300026075 Bacteria 7738
265 Ga0207708_10013244 3300026075 Bacteria 6157
266 Ga0207702_10060409 3300026078 Bacteria 3231
267 Ga0207641_10076152 3300026088 Bacteria 2900
268 Ga0207641_10565421 3300026088 Bacteria 1110
269 Ga0207648_10019870 3300026089 Bacteria 6062
270 Ga0207648_10210174 3300026089 Bacteria 1727
271 Ga0207676_10003677 3300026095 Bacteria 10840
272 Ga0207676_10005103 3300026095 Bacteria 9296
273 Ga0207676_10073084 3300026095 Bacteria 2758
274 Ga0207676_10106611 3300026095 Unclassified 2335
275 Ga0207676_10140244 3300026095 Bacteria 2068
276 Ga0207676_10190432 3300026095 Bacteria 1804
277 Ga0207676_10706308 3300026095 Bacteria 977
278 Ga0207674_10000206 3300026116 Bacteria 73345
279 Ga0207674_10084036 3300026116 Bacteria 3182
280 Ga0207674_10112434 3300026116 Bacteria 2697
281 Ga0207674_10171893 3300026116 Bacteria 2120
282 Ga0207674_10826958 3300026116 Bacteria 893
283 Ga0207675_100019800 3300026118 Bacteria 6280
284 Ga0207675_100476379 3300026118 Bacteria 1240
285 Ga0207698_10033053 3300026142 Bacteria 3754
286 Ga0207428_10026754 3300027907 Bacteria 4809
287 Ga0207428_10159884 3300027907 Bacteria 1711
288 Ga0268265_10133884 3300028380 Bacteria 2064
289 Ga0268265_10195041 3300028380 Bacteria 1752
290 Ga0268265_10710749 3300028380 Bacteria 972
291 Ga0268264_10349187 3300028381 Bacteria 1407
292 Ga0268264_10938837 3300028381 Bacteria 870
293 Ga0307408_100548180 3300031548 Bacteria 1020
294 Ga0307406_10269521 3300031901 Bacteria 1293
295 Ga0307414_10348670 3300032004 Bacteria 1270
296 Ga0373951_0000408 3300035091 Bacteria 12718
297 Ga0373937_0010768 3300036401 Bacteria 8004
298 Ga0395900_0771343 3300037418 Unclassified 891
299 Ga0395905_0009795 3300037471 Bacteria 9341
300 Ga0436365_0087353 3300039437 Bacteria 57993
301 Ga0436365_0748119 3300039437 Bacteria 2233
302 Ga0436365_1202918 3300039437 Bacteria 16532
303 Ga0495680_0413650 3300047322 Bacteria 929
304 Ga0495684_0265495 3300047471 Bacteria 1244
305 Ga0496104_0466389 3300048907 Bacteria 1174
306 Ga0496104_0532534 3300048907 Bacteria 1086
307 Ga0496109_0246845 3300048912 Bacteria 1681
308 Ga0501295_043771 3300049518 Bacteria 938
309 Ga0501299_050914 3300049522 Bacteria 856
310 Ga0501224_009569 3300049664 Bacteria 1419
311 Ga0501227_013003 3300049665 Bacteria 1828
312 Ga0501227_045024 3300049665 Bacteria 1100
313 Ga0501260_001657 3300049689 Bacteria 1854
314 Ga0501225_0014069 3300049705 Bacteria 2236
315 Ga0501225_0046070 3300049705 Bacteria 1208
316 Ga0501234_004164 3300049707 Bacteria 2269
317 Ga0501278_008160 3300049774 Bacteria 806
318 nmdc:mga05p37_224292_c1 3300050507 Bacteria 2267
319 nmdc:mga05p37_504037_c1 3300050507 Bacteria 1388
320 nmdc:mga05p37_71505_c1 3300050507 Bacteria 4268
321 nmdc:mga05p37_95107_c1 3300050507 Bacteria 3670
322 nmdc:mga08y16_222455_c1 3300050511 Bacteria 1954
323 nmdc:mga08y16_234392_c1 3300050511 Bacteria 1898
324 nmdc:mga08y16_498672_c1 3300050511 Bacteria 1237
325 nmdc:mga0n895_119179_c1 3300050512 Bacteria 2660
326 nmdc:mga0n895_573033_c1 3300050512 Bacteria 1133
327 nmdc:mga0n895_627521_c1 3300050512 Bacteria 1075
328 nmdc:mga0rr50_328687_c1 3300050513 Unclassified 1283
329 nmdc:mga0rr50_453052_c1 3300050513 Bacteria 1088
330 nmdc:mga08x19_116_c1 3300050514 Bacteria 70950
331 nmdc:mga08x19_13971_c1 3300050514 Bacteria 4864
332 nmdc:mga0a205_111361_c1 3300050515 Bacteria 2636
333 nmdc:mga0a205_198822_c1 3300050515 Bacteria 1895
334 nmdc:mga0a205_24564_c1 3300050515 Bacteria 5732
335 nmdc:mga09592_347138_c1
336 SwRhRL3b_contig_3503260
337 SwRhRL3b_contig_862588
338 JGI25406J46586_10009504
339 Ga0065704_10090725
340 Ga0065704_10262628
341 Ga0065712_10019027
342 Ga0065712_10101798
343 Ga0065715_10000702
344 Ga0065715_10009549
345 Ga0065715_10020891
346 Ga0065715_10107203
347 Ga0065715_10226195
348 Ga0065707_10254071
349 Ga0070690_100079838
350 Ga0070670_100205278
351 Ga0070677_10097087
352 Ga0068869_100029581
353 Ga0068869_100078932
354 Ga0070666_10026534
355 Ga0070680_100009139
356 Ga0070680_100027761
357 Ga0070680_100520746
358 Ga0070682_100186043
359 Ga0068868_100037187
360 Ga0068868_100133678
361 Ga0070660_100013987
362 Ga0070689_100189456
363 Ga0070687_100027023
364 Ga0070692_10015499
365 Ga0070692_10031745
366 Ga0070669_100014079
367 Ga0070669_100171768
368 Ga0070675_100072773
369 Ga0070671_100005652
370 Ga0070671_100112664
371 Ga0070671_100269633
372 Ga0070674_100257512
373 Ga0070673_100107338
374 Ga0070673_100408918
375 Ga0070688_100563240
376 Ga0070659_100005902
377 Ga0070703_10000014
378 Ga0070709_10087720
379 Ga0070701_10076310
380 Ga0070701_10166812
381 Ga0070705_100212325
382 Ga0070700_100008791
383 Ga0070700_100069046
384 Ga0070700_100431044
385 Ga0070694_100099045
386 Ga0070708_100060170
387 Ga0070708_100074528
388 Ga0070708_100237358
389 Ga0070662_100432365
390 Ga0070681_10018209
391 Ga0070681_10207587
392 Ga0068867_100087039
393 Ga0068867_100100252
394 Ga0068867_100132490
395 Ga0068867_100361102
396 Ga0070685_10055205
397 Ga0070706_100001194
398 Ga0070706_100009351
399 Ga0070707_100037857
400 Ga0070707_100054879
401 Ga0070707_100225546
402 Ga0070707_100427631
403 Ga0070707_100523507
404 Ga0070698_100079667
405 Ga0070698_100678646
406 Ga0070699_100021174
407 Ga0070699_100388524
408 Ga0070699_100764733
409 Ga0070679_100000102
410 Ga0070679_100014012
411 Ga0070684_100225230
412 Ga0070697_100019653
413 Ga0070697_100347675
414 Ga0070697_100356170
415 Ga0070697_100589361
416 Ga0068853_100043384
417 Ga0068853_100580882
418 Ga0070672_100274015
419 Ga0070672_100507367
420 Ga0070695_100089936
421 Ga0070695_100114408
422 Ga0070695_100356054
423 Ga0070695_100443865
424 Ga0070696_100195990
425 Ga0070696_100340578
426 Ga0070696_100472770
427 Ga0070696_100522128
428 Ga0070693_100116228
429 Ga0070665_100112905
430 Ga0070704_100173135
431 Ga0070704_100267997
432 Ga0068855_100532276
433 Ga0070664_100024915
434 Ga0068857_100019528
435 Ga0068857_100179330
436 Ga0068857_100491333
437 Ga0068854_100286254
438 Ga0068854_100543517
439 Ga0068856_100025769
440 Ga0070702_100014806
441 Ga0070702_100092810
442 Ga0068852_100266907
443 Ga0068859_100156235
444 Ga0068864_100058547
445 Ga0068864_100065220
446 Ga0068864_100321892
447 Ga0068864_100429971
448 Ga0068866_10017920
449 Ga0068861_100000821
450 Ga0068861_100153575
451 Ga0068870_10130905
452 Ga0068870_10286766
453 Ga0068863_100408506
454 Ga0068863_100610778
455 Ga0068860_100020460
456 Ga0068860_100044889
457 Ga0068860_100855058
458 Ga0068862_100026600
459 Ga0068862_100132675
460 Ga0081539_10000149
461 Ga0070715_10000016
462 Ga0070716_100000001
463 Ga0070716_100024795
464 Ga0070716_100084474
465 Ga0070716_100123229
466 Ga0097621_100024587
467 Ga0097621_100027697
468 Ga0068871_100007072
469 Ga0068871_100018263
470 Ga0075428_100666460
471 Ga0075433_10013503
472 Ga0075433_10015438
473 Ga0075433_10099788
474 Ga0075433_10106002
475 Ga0075433_10142786
476 Ga0075433_10742701
477 Ga0075434_100094068
478 Ga0075434_100493904
479 Ga0075429_100350257
480 Ga0068865_100055405
481 Ga0075436_100000051
482 Ga0075436_100016102
483 Ga0097620_100156219
484 Ga0075435_100490263
485 Ga0105251_10097562
486 Ga0111539_10001370
487 Ga0111539_10052426
488 Ga0111539_10615497
489 Ga0105245_11181118
490 Ga0114129_10018284
491 Ga0114129_10026072
492 Ga0114129_10120636
493 Ga0114129_10175977
494 Ga0114129_10298616
495 Ga0114129_10502533
496 Ga0114129_11059200
497 Ga0105243_10077553
498 Ga0105243_10138057
499 Ga0105243_10934135
500 Ga0105241_10041419
501 Ga0105241_10076867
502 Ga0105241_10652322
503 Ga0105248_10055764
504 Ga0105248_10267164
505 Ga0105248_11138373
506 Ga0105237_10085053
507 Ga0105238_10708581
508 Ga0105249_10111568
509 Ga0105249_10274256
510 Ga0105249_10481019
511 Ga0105249_10645458
512 Ga0105246_10034151
513 Ga0157378_10027290
514 Ga0157378_10054041
515 Ga0157378_10150208
516 Ga0163162_10004195
517 Ga0163162_10005808
518 Ga0157372_10038704
519 Ga0157372_11133919
520 Ga0157375_10091457
521 Ga0157375_10116749
522 Ga0157375_10163755
523 Ga0163163_10001292
524 Ga0163163_10005396
525 Ga0163163_10034355
526 Ga0163163_10038694
527 Ga0163163_10060682
528 Ga0163163_10079670
529 Ga0163163_10090257
530 Ga0157380_10016264
531 Ga0157380_10425332
532 Ga0157377_10135459
533 Ga0157376_10995429
534 Ga0163161_10011832
535 Ga0213876_10000142
536 Ga0213876_10005410
537 Ga0207697_10025263
538 Ga0207653_10000054
539 Ga0207642_10003939
540 Ga0207688_10060249
541 Ga0207680_10199297
542 Ga0207647_10042116
543 Ga0207685_10000045
544 Ga0207699_10072228
545 Ga0207684_10006039
546 Ga0207684_10006459
547 Ga0207684_10115755
548 Ga0207684_10137554
549 Ga0207654_10482969
550 Ga0207707_10000013
551 Ga0207707_10356651
552 Ga0207660_10021156
553 Ga0207660_10095983
554 Ga0207662_10006164
555 Ga0207657_10135832
556 Ga0207652_10002871
557 Ga0207652_10156810
558 Ga0207646_10000399
559 Ga0207646_10013639
560 Ga0207646_10067698
561 Ga0207646_10087899
562 Ga0207646_10284404
563 Ga0207681_10091513
564 Ga0207681_10115281
565 Ga0207687_10012371
566 Ga0207644_10016403
567 Ga0207690_10208308
568 Ga0207686_10260505
569 Ga0207709_10099968
570 Ga0207709_10263092
571 Ga0207670_10000292
572 Ga0207670_10303262
573 Ga0207669_10226084
574 Ga0207704_10226799
575 Ga0207665_10000016
576 Ga0207665_10115274
577 Ga0207665_10134560
578 Ga0207665_10186400
579 Ga0207691_10019914
580 Ga0207691_10061198
581 Ga0207711_10124609
582 Ga0207711_10261235
583 Ga0207689_10085932
584 Ga0207689_10089135
585 Ga0207679_10017899
586 Ga0207679_10409889
587 Ga0207667_10634720
588 Ga0207712_10006703
589 Ga0207712_10046970
590 Ga0207712_10257383
591 Ga0207640_10105344
592 Ga0207640_10112537
593 Ga0207640_10294546
594 Ga0207640_10402494
595 Ga0207639_10051033
596 Ga0207639_10066227
597 Ga0207639_10174891
598 Ga0207708_10008202
599 Ga0207708_10013244
600 Ga0207702_10060409
601 Ga0207641_10076152
602 Ga0207641_10565421
603 Ga0207648_10019870
604 Ga0207648_10210174
605 Ga0207676_10003677
606 Ga0207676_10005103
607 Ga0207676_10073084
608 Ga0207676_10106611
609 Ga0207676_10140244
610 Ga0207676_10190432
611 Ga0207676_10706308
612 Ga0207674_10000206
613 Ga0207674_10084036
614 Ga0207674_10112434
615 Ga0207674_10171893
616 Ga0207674_10826958
617 Ga0207675_100019800
618 Ga0207675_100476379
619 Ga0207698_10033053
620 Ga0207428_10026754
621 Ga0207428_10159884
622 Ga0268265_10133884
623 Ga0268265_10195041
624 Ga0268265_10710749
625 Ga0268264_10349187
626 Ga0268264_10938837
627 Ga0307408_100548180
628 Ga0307406_10269521
629 Ga0307414_10348670
630 Ga0373951_0000408
631 Ga0373937_0010768
632 Ga0395900_0771343
633 Ga0395905_0009795
634 Ga0436365_0087353
635 Ga0436365_0748119
636 Ga0436365_1202918
637 Ga0495680_0413650
638 Ga0495684_0265495
639 Ga0496104_0466389
640 Ga0496104_0532534
641 Ga0496109_0246845
642 Ga0501295_043771
643 Ga0501299_050914
644 Ga0501224_009569
645 Ga0501227_013003
646 Ga0501227_045024
647 Ga0501260_001657
648 Ga0501225_0014069
649 Ga0501225_0046070
650 Ga0501234_004164
651 Ga0501278_008160
652 nmdc:mga05p37_224292_c1
653 nmdc:mga05p37_504037_c1
654 nmdc:mga05p37_71505_c1
655 nmdc:mga05p37_95107_c1
656 nmdc:mga08y16_222455_c1
657 nmdc:mga08y16_234392_c1
658 nmdc:mga08y16_498672_c1
659 nmdc:mga0n895_119179_c1
660 nmdc:mga0n895_573033_c1
661 nmdc:mga0n895_627521_c1
662 nmdc:mga0rr50_328687_c1
663 nmdc:mga0rr50_453052_c1
664 nmdc:mga08x19_116_c1
665 nmdc:mga08x19_13971_c1
666 nmdc:mga0a205_111361_c1
667 nmdc:mga0a205_198822_c1
668 nmdc:mga0a205_24564_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

171

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9532 2 246
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.947 1 246
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9441 1 225
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9435 2 231
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9428 2 231
ID Description Score Start End Superfamily
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9658 2 242 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.95 2 242 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9469 2 245 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9468 2 244 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9414 1 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A086ZEF6-F1-model_v4 Amino acid ABC transporter ATP-binding protein (EC 3.6.3.31) 0.9668 2 244 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A6G9YJ44-F1-model_v4 ATP-binding cassette domain-containing protein 0.9632 2 232 GO:0005524
GO:0012505
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A6J4KDZ7-F1-model_v4 Efflux ABC transporter, ATP-binding protein 0.9614 2 231 GO:0005524
GO:0016020
GO:0016887
GO:0043215
GO:0046677
GO:0140359
GO:1900753
AF-A0A7Y9H5T3-F1-model_v4 Polar amino acid transport system ATP-binding protein 0.9608 2 245 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A7X0VB71-F1-model_v4 Amino acid ABC transporter ATP-binding protein 0.959 1 245 GO:0005524
GO:0005886
GO:0015424
GO:0016887

Map