F411920

General Info

Members Datasets Scaffolds Average Seq Length
334 250 668 377

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0021678|Ga0495603_0021678_1824_3197
Length 457
Sequence MVHFYLTISLIICFVKYKIHPNFVNPRPGFLPITAFTALPRAGLAFGIQYRMSRLLVAAPLATLFVSTLYAATQAPVQLAHDQPLGELELVATFSGAMPTGVTVSHSGRIFLNFPRWGDEVPYTVAELVNGSTVPYPSAEINDWPGRSLPDPTTATDETVNTSHFVSVQSVVVDPADRLWVLDTGSALQKGVVPGGPKLVAIDLATNKVIKTISFSPAIADPTSYLNDVRFDLTKGTATAAGTVHGIAYITDSSGKGPNAIIVVDLATGQAVRRLNNHPSTRPDPGFIGFAEGRPIYRTEPGKPPQRMLVGADGIAISADGSKIFYCPLSSTHLYSVSAAALSEGVAPDNRVAETVQLVTGKGPSDGLESDAAGNIYAGDYSTNSIIRIAPDGTIETILHDPRLLWPDTMSLADDGYLYVTANQLHRQPSMHNGKDLRVKPYALFRIQLNAKPVRLK

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
104 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
141 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
163 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
166 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
190 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
191 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
192 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
193 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
194 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
195 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
196 2643221731 Bacillus sp. Root147 Isolate Unclassified
197 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
198 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
199 2684622632 Bacillus cereus 905 Isolate Unclassified
200 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
201 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
202 2738543017 Bacillus sp. OV186 Isolate Unclassified
203 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
204 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
205 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
206 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
207 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
208 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
209 2842682962 Bacillus sp. R-72492 Isolate Unclassified
210 2842882022 Bacillus sp. R-71893 Isolate Unclassified
211 2849139964 Bacillus sp. R-71875 Isolate Unclassified
212 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
213 2857581216 Bacillus sp. R-71922 Isolate Unclassified
214 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
215 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
216 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
217 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
218 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
219 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
220 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
221 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
222 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
223 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
224 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
225 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
226 2919720352 Priestia megaterium 4340 Isolate Unclassified
227 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
228 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
229 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
230 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
231 2929004312 Priestia megaterium 1104 Isolate Unclassified
232 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
233 2969141011 Bacillus velezensis MH25 Isolate Unclassified
234 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
235 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
236 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
237 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
238 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
239 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
240 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
241 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
242 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
243 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
244 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
245 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
246 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
247 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
248 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
249 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
250 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.04
Metatranscriptomes 2.4
Isolates 18.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 4.79
Rhizosphere 69.46
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0021678 3300046455 Bacteria 3891
2 rootH1_10054011 3300003316 Bacteria 2029
3 rootH2_10034336 3300003320 Bacteria 3340
4 rootH2_10179630 3300003320 Bacteria 1668
5 rootL2_10021895 3300003322 Bacteria 16228
6 rootL2_10385458 3300003322 Unclassified 1412
7 rootH1_10368009 3300003323 Unclassified 1240
8 Ga0055532_1000133 3300003758 Bacteria 73135
9 Ga0055532_1000523 3300003758 Bacteria 16791
10 Ga0055537_1001730 3300003773 Bacteria 8055
11 Ga0055528_1007870 3300003790 Bacteria 4652
12 Ga0070683_100267648 3300005329 Archaea 1625
13 Ga0070689_100120938 3300005340 Bacteria 2091
14 Ga0070689_100204452 3300005340 Archaea 1614
15 Ga0070668_100100864 3300005347 Bacteria 2287
16 Ga0070674_100135361 3300005356 Archaea 1842
17 Ga0070659_100126663 3300005366 Archaea 2072
18 Ga0070709_10013628 3300005434 Archaea 4575
19 Ga0070710_10042096 3300005437 Archaea 2524
20 Ga0070710_10110226 3300005437 Bacteria 1652
21 Ga0070711_100000906 3300005439 Archaea 15605
22 Ga0070711_100001673 3300005439 Archaea 12284
23 Ga0070711_100007273 3300005439 Archaea 6729
24 Ga0070706_100214207 3300005467 Bacteria 1798
25 Ga0070707_100064306 3300005468 Bacteria 3523
26 Ga0070698_100005093 3300005471 Bacteria 14396
27 Ga0070699_100003225 3300005518 Bacteria 14426
28 Ga0070665_100001647 3300005548 Bacteria 25743
29 Ga0070665_100051035 3300005548 Bacteria 4150
30 Ga0068856_100300998 3300005614 Archaea 1621
31 Ga0070702_100043103 3300005615 Archaea 2541
32 Ga0068859_100345730 3300005617 Archaea 1582
33 Ga0081455_10003335 3300005937 Archaea 18514
34 Ga0075365_10124974 3300006038 Bacteria 1777
35 Ga0075368_10000330 3300006042 Bacteria 13869
36 Ga0070716_100000467 3300006173 Archaea 16707
37 Ga0070712_100048163 3300006175 Archaea 2953
38 Ga0075367_10004746 3300006178 Bacteria 6685
39 Ga0097621_100285492 3300006237 Archaea 1454
40 Ga0075428_100002249 3300006844 Archaea 20908
41 Ga0075428_100373541 3300006844 Bacteria 1529
42 Ga0075430_100005764 3300006846 Archaea 10451
43 Ga0075430_100006476 3300006846 Archaea 9869
44 Ga0075430_100091065 3300006846 Archaea 2550
45 Ga0075430_100097565 3300006846 Archaea 2456
46 Ga0075431_100000983 3300006847 Archaea 25362
47 Ga0075431_100394531 3300006847 Archaea 1386
48 Ga0075431_100400988 3300006847 Bacteria 1373
49 Ga0075434_100005082 3300006871 Archaea 11945
50 Ga0075434_100293536 3300006871 Bacteria 1646
51 Ga0075429_100023872 3300006880 Archaea 5307
52 Ga0075429_100041018 3300006880 Archaea 4031
53 Ga0075429_100047027 3300006880 Archaea 3754
54 Ga0075436_100128094 3300006914 Archaea 1779
55 Ga0097620_100345733 3300006931 Archaea 1582
56 Ga0075435_100186494 3300007076 Archaea 1754
57 Ga0111539_10001496 3300009094 Archaea 31214
58 Ga0111539_10037739 3300009094 Bacteria 5832
59 Ga0111539_10096484 3300009094 Archaea 3473
60 Ga0111539_10116800 3300009094 Archaea 3128
61 Ga0111539_10268937 3300009094 Bacteria 1984
62 Ga0114129_10002185 3300009147 Archaea 26938
63 Ga0114129_10027937 3300009147 Archaea 7989
64 Ga0114129_10099607 3300009147 Bacteria 4022
65 Ga0114129_10207484 3300009147 Archaea 2650
66 Ga0114129_10424651 3300009147 Archaea 1748
67 Ga0105241_10077288 3300009174 Archaea 2598
68 Ga0105248_10005601 3300009177 Bacteria 13800
69 Ga0105249_10095463 3300009553 Archaea 2788
70 Ga0105249_10227513 3300009553 Archaea 1838
71 Ga0105249_10261027 3300009553 Bacteria 1721
72 Ga0105239_10023222 3300010375 Archaea 6834
73 Ga0105246_10090039 3300011119 Archaea 2209
74 Ga0157374_10046035 3300013296 Bacteria 4039
75 Ga0157372_10258335 3300013307 Archaea 2023
76 Ga0182008_10023628 3300014497 Archaea 3136
77 Ga0157377_10042971 3300014745 Archaea 2513
78 Ga0183363_1005 3300015690 Bacteria 403020
79 Ga0206356_11237808 3300020070 Archaea 1208
80 Ga0206349_1296590 3300020075 Archaea 1400
81 Ga0206352_10585048 3300020078 Archaea 1370
82 Ga0206353_11915692 3300020082 Archaea 1521
83 Ga0154015_1495710 3300020610 Archaea 1416
84 Ga0213876_10001234 3300021384 Bacteria 16134
85 Ga0213875_10000553 3300021388 Bacteria 30588
86 Ga0209147_100020 3300025229 Bacteria 474055
87 Ga0209147_100304 3300025229 Bacteria 39912
88 Ga0209147_100493 3300025229 Bacteria 23423
89 Ga0209565_1000245 3300025263 Bacteria 58278
90 Ga0209673_1012944 3300025273 Bacteria 3322
91 Ga0209675_1016879 3300025291 Bacteria 2108
92 Ga0209676_1001224 3300025292 Bacteria 27208
93 Ga0209025_1003855 3300025294 Bacteria 13613
94 Ga0209025_1015774 3300025294 Bacteria 4521
95 Ga0209025_1024406 3300025294 Bacteria 3120
96 Ga0209564_1004626 3300025295 Bacteria 8286
97 Ga0209256_1013253 3300025299 Bacteria 3071
98 Ga0207713_1004049 3300025735 Bacteria 9680
99 Ga0207692_10132765 3300025898 Bacteria 1408
100 Ga0207688_10021680 3300025901 Archaea 3513
101 Ga0207685_10004221 3300025905 Archaea 3621
102 Ga0207699_10052747 3300025906 Archaea 2409
103 Ga0207699_10116967 3300025906 Archaea 1718
104 Ga0207699_10159476 3300025906 Bacteria 1500
105 Ga0207643_10120890 3300025908 Archaea 1551
106 Ga0207684_10202553 3300025910 Bacteria 1712
107 Ga0207693_10002280 3300025915 Archaea 16681
108 Ga0207663_10000115 3300025916 Archaea 38664
109 Ga0207663_10000407 3300025916 Archaea 18651
110 Ga0207663_10005563 3300025916 Archaea 6361
111 Ga0207700_10270538 3300025928 Archaea 1458
112 Ga0207670_10156235 3300025936 Archaea 1698
113 Ga0207669_10121370 3300025937 Archaea 1775
114 Ga0207665_10003292 3300025939 Archaea 10819
115 Ga0207711_10013221 3300025941 Bacteria 6858
116 Ga0207708_10049336 3300026075 Archaea 3205
117 Ga0207708_10106403 3300026075 Archaea 2175
118 Ga0207702_10173871 3300026078 Archaea 1977
119 Ga0209813_10000168 3300027866 Bacteria 21290
120 Ga0207428_10000577 3300027907 Archaea 43300
121 Ga0207428_10033776 3300027907 Archaea 4196
122 Ga0207428_10067457 3300027907 Archaea 2816
123 Ga0268266_10000002 3300028379 Bacteria 3059047
124 Ga0268266_10036875 3300028379 Bacteria 4165
125 Ga0237817_10014 3300030083 Bacteria 74143
126 Ga0307408_100031159 3300031548 Bacteria 3711
127 Ga0307413_10022117 3300031824 Archaea 3420
128 Ga0307410_10061718 3300031852 Bacteria 2566
129 Ga0307406_10040746 3300031901 Archaea 2890
130 Ga0307406_10094716 3300031901 Bacteria 2019
131 Ga0307407_10036934 3300031903 Archaea 2695
132 Ga0307407_10051501 3300031903 Unclassified 2360
133 Ga0307412_10000301 3300031911 Bacteria 31415
134 Ga0307412_10003239 3300031911 Bacteria 9056
135 Ga0307412_10037082 3300031911 Bacteria 3130
136 Ga0307412_10138092 3300031911 Archaea 1781
137 Ga0307409_100047752 3300031995 Archaea 3252
138 Ga0307409_100138269 3300031995 Bacteria 2094
139 Ga0307409_100248434 3300031995 Bacteria 1625
140 Ga0307416_100039351 3300032002 Archaea 3659
141 Ga0307411_10063693 3300032005 Bacteria 2465
142 Ga0307411_10161154 3300032005 Archaea 1680
143 Ga0307411_10201448 3300032005 Bacteria 1529
144 Ga0436364_0379917 3300037853 Bacteria 167058
145 Ga0436364_0668324 3300037853 Bacteria 1417
146 Ga0436364_0963615 3300037853 Bacteria 1746
147 Ga0237819_00107 3300038705 Bacteria 30668
148 Ga0436365_0013485 3300039437 Bacteria 16188
149 Ga0436365_0475527 3300039437 Bacteria 3793
150 Ga0439438_016699 3300041405 Archaea 2131
151 Ga0439439_0008090 3300041406 Archaea 2474
152 Ga0451789_0343611 3300041443 Bacteria 1199
153 Ga0439450_019370 3300042008 Archaea 1441
154 Ga0450923_001501 3300042125 Archaea 3115
155 Ga0450906_007673 3300042145 Archaea 2122
156 Ga0439460_0007861 3300042461 Unclassified 2679
157 Ga0439440_0006138 3300042993 Archaea 2408
158 Ga0466972_0030948 3300044658 Bacteria 2634
159 Ga0466965_0014325 3300044683 Bacteria 3751
160 Ga0466968_0011165 3300044735 Bacteria 3498
161 Ga0466960_0033586 3300044901 Bacteria 2385
162 Ga0466960_0099182 3300044901 Bacteria 1497
163 Ga0495594_0002280 3300046499 Bacteria 9996
164 Ga0495606_0037467 3300046507 Unclassified 3293
165 Ga0495606_0109433 3300046507 Bacteria 1669
166 Ga0495631_0041030 3300046518 Bacteria 2049
167 Ga0495644_0000037 3300046523 Bacteria 64819
168 Ga0495609_0029380 3300046538 Bacteria 2503
169 Ga0495668_0000895 3300046616 Bacteria 33522
170 Ga0495661_0064406 3300046665 Bacteria 2163
171 Ga0496102_0148382 3300048905 Bacteria 2202
172 Ga0496103_0021684 3300048906 Bacteria 3866
173 Ga0496104_0024479 3300048907 Bacteria 5553
174 Ga0496105_0019692 3300048908 Bacteria 5444
175 Ga0496106_0028013 3300048909 Archaea 4194
176 Ga0496107_0095244 3300048910 Archaea 2178
177 Ga0496108_0010697 3300048911 Bacteria 7444
178 Ga0496108_0168737 3300048911 Bacteria 1893
179 Ga0496109_0014246 3300048912 Bacteria 6917
180 Ga0496109_0319993 3300048912 Bacteria 1464
181 Ga0496110_0077650 3300048913 Bacteria 2954
182 Ga0496111_0004383 3300048914 Bacteria 8914
183 Ga0496113_0024177 3300048916 Bacteria 4314
184 Ga0496113_0036991 3300048916 Archaea 3579
185 Ga0496115_0255273 3300048918 Archaea 1443
186 Ga0496116_0003390 3300048919 Bacteria 15786
187 Ga0496116_0012963 3300048919 Bacteria 6763
188 Ga0496117_0017139 3300048920 Bacteria 6063
189 Ga0496117_0089667 3300048920 Bacteria 1985
190 Ga0496118_0005133 3300048921 Bacteria 15032
191 Ga0496119_0082002 3300048922 Bacteria 1855
192 Ga0496120_0017083 3300048923 Bacteria 4716
193 Ga0496120_0032192 3300048923 Bacteria 3164
194 Ga0496120_0069345 3300048923 Bacteria 1942
195 Ga0496121_0007523 3300048924 Bacteria 13140
196 Ga0496122_0015796 3300048925 Bacteria 7192
197 Ga0496122_0048663 3300048925 Bacteria 3256
198 Ga0496123_0054822 3300048926 Bacteria 2621
199 Ga0496124_0000043 3300048927 Bacteria 300907
200 Ga0496125_0000247 3300048928 Bacteria 111049
201 Ga0501290_005058 3300049513 Archaea 1647
202 Ga0501292_008117 3300049515 Archaea 1529
203 Ga0501031_0011428 3300049568 Archaea 5782
204 Ga0501031_0115766 3300049568 Archaea 1751
205 Ga0501032_0010570 3300049569 Archaea 6655
206 Ga0501036_0075452 3300049572 Archaea 2851
207 Ga0501037_0126833 3300049573 Archaea 1831
208 Ga0501039_0031791 3300049575 Archaea 4069
209 Ga0501039_0189550 3300049575 Archaea 1617
210 Ga0501039_0244955 3300049575 Archaea 1409
211 Ga0501040_0002745 3300049576 Archaea 11340
212 Ga0501040_0224584 3300049576 Archaea 1336
213 Ga0501041_0169868 3300049577 Archaea 1364
214 Ga0501042_0042858 3300049578 Archaea 3222
215 Ga0501042_0176199 3300049578 Archaea 1542
216 Ga0501043_0016891 3300049579 Archaea 5721
217 Ga0501047_0086760 3300049581 Archaea 3007
218 Ga0501048_0017954 3300049582 Archaea 5206
219 Ga0501071_0010329 3300049587 Archaea 6253
220 Ga0501071_0116656 3300049587 Archaea 1976
221 Ga0501072_0104201 3300049588 Archaea 2255
222 Ga0501073_0083199 3300049589 Archaea 2227
223 Ga0501075_0003521 3300049591 Archaea 10474
224 Ga0501075_0189968 3300049591 Archaea 1566
225 Ga0501076_0010850 3300049592 Archaea 6774
226 Ga0501076_0150474 3300049592 Archaea 1893
227 Ga0501077_0039810 3300049593 Archaea 2994
228 Ga0501202_000594 3300049652 Archaea 5289
229 Ga0501224_001926 3300049664 Archaea 2798
230 Ga0501235_004685 3300049669 Archaea 2958
231 Ga0501243_001942 3300049675 Archaea 3005
232 Ga0501243_012169 3300049675 Unclassified 1355
233 Ga0501251_005185 3300049681 Unclassified 1373
234 Ga0501257_017878 3300049686 Bacteria 1651
235 Ga0501221_000395 3300049704 Archaea 6682
236 Ga0501245_004088 3300049708 Archaea 1996
237 Ga0501079_0035846 3300049741 Archaea 3819
238 Ga0501080_0200484 3300049742 Archaea 1832
239 Ga0501081_0167945 3300049743 Archaea 1583
240 Ga0501083_0042698 3300049744 Archaea 3073
241 Ga0501266_001624 3300049763 Archaea 2865
242 Ga0501035_0134026 3300049822 Archaea 2157
243 Ga0501044_0069899 3300049823 Archaea 3573
244 Ga0501045_0098814 3300049824 Archaea 2159
245 Ga0501045_0204894 3300049824 Archaea 1469
246 nmdc:mga03n38_10961_c1 3300050490 Bacteria 3360
247 nmdc:mga04h51_278_c1 3300050495 Bacteria 13132
248 nmdc:mga05p37_11578_c1 3300050507 Archaea 10511
249 nmdc:mga05p37_135103_c1 3300050507 Bacteria 3025
250 nmdc:mga05p37_185009_c1 3300050507 Archaea 2533
251 nmdc:mga05p37_378297_c1 3300050507 Archaea 1660
252 nmdc:mga05p37_68548_c1 3300050507 Archaea 4362
253 nmdc:mga09592_18686_c1 3300050508 Archaea 5685
254 nmdc:mga0qj67_102465_c1 3300050509 Archaea 2308
255 nmdc:mga0qj67_1742_c1 3300050509 Archaea 15384
256 nmdc:mga0qj67_2024_c1 3300050509 Archaea 14467
257 nmdc:mga06r32_135496_c1 3300050510 Archaea 2437
258 nmdc:mga06r32_14240_c1 3300050510 Archaea 7214
259 nmdc:mga06r32_22928_c1 3300050510 Archaea 5774
260 nmdc:mga06r32_242311_c1 3300050510 Bacteria 1790
261 nmdc:mga08y16_156146_c1 3300050511 Bacteria 2371
262 nmdc:mga08y16_92968_c1 3300050511 Archaea 3143
263 nmdc:mga08y16_97736_c1 3300050511 Archaea 3058
264 nmdc:mga0n895_264426_c1 3300050512 Bacteria 1745
265 nmdc:mga0n895_8845_c1 3300050512 Archaea 8765
266 Ga0501084_0051922 3300054114 Archaea 3431
267 Ga0501084_0386535 3300054114 Archaea 1182
268 Ga0587077_016783 3300059493 Archaea 1238
269 Ga0587101_007238 3300059623 Archaea 1303
270 Ga0587062_007538 3300059639 Archaea 1273
271 Ga0501082_0079228 3300060353 Archaea 2834
272 Ga0530510_0160723 3300061734 Archaea 1661
273 2511699647 2511231119 Bacteria 4019861
274 2545555917 2545555800 Bacteria 4222588
275 2578929339 2576861599 Bacteria 4217202
276 2595091955 2593339131 Bacteria 5116855
277 2595452383 2593339239 Bacteria 4124669
278 2596375465 2595698237 Bacteria 6712432
279 2631983124 2630968484 Bacteria 3876276
280 2644721121 2643221731 Bacteria 5623886
281 2651533061 2648501850 Bacteria 3975476
282 2672336398 2671180330 Bacteria 5521719
283 2685150717 2684622632 Bacteria 5380049
284 2695627599 2695420354 Bacteria 3922431
285 2717916601 2716884898 Bacteria 3928789
286 2739267880 2738543017 Bacteria 4271950
287 2808867475 2808606364 Bacteria 4465927
288 2816864344 2816332186 Bacteria 5331395
289 2819554560 2818991438 Bacteria 5793701
290 2819714866 2818991466 Bacteria 4748179
291 2835190593 2835188231 Bacteria 3476928
292 2839989632 2839986021 Bacteria 3685650
293 2842683167 2842682962 Bacteria 5589973
294 2842884892 2842882022 Bacteria 6158489
295 2849145155 2849139964 Bacteria 5613304
296 2857455565 2857453340 Bacteria 8090534
297 2857582883 2857581216 Bacteria 5522813
298 2857605315 2857604169 Bacteria 5111450
299 2864736399 2864733723 Bacteria 6770668
300 2877770434 2877768649 Bacteria 3957164
301 2880171428 2880169592 Bacteria 3900066
302 2889051980 2889049205 Bacteria 7524325
303 2889280108 2889276214 Bacteria 5979355
304 2904115964 2904113452 Bacteria 7796941
305 2904527335 2904524088 Bacteria 5887454
306 2904561152 2904560550 Bacteria 4029838
307 2919144054 2919143609 Bacteria 6219228
308 2919426613 2919425241 Bacteria 8055701
309 2919519277 2919517244 Bacteria 5858162
310 2919724798 2919720352 Bacteria 5986006
311 2928097155 2928093941 Bacteria 5965005
312 2928128336 2928125067 Bacteria 5937560
313 2928531265 2928526807 Bacteria 4760224
314 2928969918 2928968154 Bacteria 4633371
315 2929009648 2929004312 Bacteria 5678476
316 2947429428 2947426588 Bacteria 5357194
317 2969142888 2969141011 Bacteria 4118468
318 2971409688 2971403814 Bacteria 7370929
319 2971416781 2971410472 Bacteria 8311090
320 2971895200 2971893375 Bacteria 3929648
321 2977255298 2977254563 Bacteria 4828420
322 2996707203 2996706504 Bacteria 5757485
323 3001273297 3001272096 Bacteria 4729684
324 3001895989 3001892409 Bacteria 6328293
325 3006977086 3006973921 Bacteria 4423788
326 3006985250 3006984091 Bacteria 4207523
327 648170323 648028048 Bacteria 5394884
328 8002319510 8002317523 Bacteria 8051857
329 8007378862 8007375930 Bacteria 4080554
330 8022625055 8022621104 Bacteria 5241040
331 8022631049 8022630665 Bacteria 3886130
332 8022894751 8022893055 Bacteria 5300455
333 8052174830 8052174270 Bacteria 3881265
334 8054283689 8054280661 Bacteria 4232245
335 Ga0495603_0021678
336 rootH1_10054011
337 rootH2_10034336
338 rootH2_10179630
339 rootL2_10021895
340 rootL2_10385458
341 rootH1_10368009
342 Ga0055532_1000133
343 Ga0055532_1000523
344 Ga0055537_1001730
345 Ga0055528_1007870
346 Ga0070683_100267648
347 Ga0070689_100120938
348 Ga0070689_100204452
349 Ga0070668_100100864
350 Ga0070674_100135361
351 Ga0070659_100126663
352 Ga0070709_10013628
353 Ga0070710_10042096
354 Ga0070710_10110226
355 Ga0070711_100000906
356 Ga0070711_100001673
357 Ga0070711_100007273
358 Ga0070706_100214207
359 Ga0070707_100064306
360 Ga0070698_100005093
361 Ga0070699_100003225
362 Ga0070665_100001647
363 Ga0070665_100051035
364 Ga0068856_100300998
365 Ga0070702_100043103
366 Ga0068859_100345730
367 Ga0081455_10003335
368 Ga0075365_10124974
369 Ga0075368_10000330
370 Ga0070716_100000467
371 Ga0070712_100048163
372 Ga0075367_10004746
373 Ga0097621_100285492
374 Ga0075428_100002249
375 Ga0075428_100373541
376 Ga0075430_100005764
377 Ga0075430_100006476
378 Ga0075430_100091065
379 Ga0075430_100097565
380 Ga0075431_100000983
381 Ga0075431_100394531
382 Ga0075431_100400988
383 Ga0075434_100005082
384 Ga0075434_100293536
385 Ga0075429_100023872
386 Ga0075429_100041018
387 Ga0075429_100047027
388 Ga0075436_100128094
389 Ga0097620_100345733
390 Ga0075435_100186494
391 Ga0111539_10001496
392 Ga0111539_10037739
393 Ga0111539_10096484
394 Ga0111539_10116800
395 Ga0111539_10268937
396 Ga0114129_10002185
397 Ga0114129_10027937
398 Ga0114129_10099607
399 Ga0114129_10207484
400 Ga0114129_10424651
401 Ga0105241_10077288
402 Ga0105248_10005601
403 Ga0105249_10095463
404 Ga0105249_10227513
405 Ga0105249_10261027
406 Ga0105239_10023222
407 Ga0105246_10090039
408 Ga0157374_10046035
409 Ga0157372_10258335
410 Ga0182008_10023628
411 Ga0157377_10042971
412 Ga0183363_1005
413 Ga0206356_11237808
414 Ga0206349_1296590
415 Ga0206352_10585048
416 Ga0206353_11915692
417 Ga0154015_1495710
418 Ga0213876_10001234
419 Ga0213875_10000553
420 Ga0209147_100020
421 Ga0209147_100304
422 Ga0209147_100493
423 Ga0209565_1000245
424 Ga0209673_1012944
425 Ga0209675_1016879
426 Ga0209676_1001224
427 Ga0209025_1003855
428 Ga0209025_1015774
429 Ga0209025_1024406
430 Ga0209564_1004626
431 Ga0209256_1013253
432 Ga0207713_1004049
433 Ga0207692_10132765
434 Ga0207688_10021680
435 Ga0207685_10004221
436 Ga0207699_10052747
437 Ga0207699_10116967
438 Ga0207699_10159476
439 Ga0207643_10120890
440 Ga0207684_10202553
441 Ga0207693_10002280
442 Ga0207663_10000115
443 Ga0207663_10000407
444 Ga0207663_10005563
445 Ga0207700_10270538
446 Ga0207670_10156235
447 Ga0207669_10121370
448 Ga0207665_10003292
449 Ga0207711_10013221
450 Ga0207708_10049336
451 Ga0207708_10106403
452 Ga0207702_10173871
453 Ga0209813_10000168
454 Ga0207428_10000577
455 Ga0207428_10033776
456 Ga0207428_10067457
457 Ga0268266_10000002
458 Ga0268266_10036875
459 Ga0237817_10014
460 Ga0307408_100031159
461 Ga0307413_10022117
462 Ga0307410_10061718
463 Ga0307406_10040746
464 Ga0307406_10094716
465 Ga0307407_10036934
466 Ga0307407_10051501
467 Ga0307412_10000301
468 Ga0307412_10003239
469 Ga0307412_10037082
470 Ga0307412_10138092
471 Ga0307409_100047752
472 Ga0307409_100138269
473 Ga0307409_100248434
474 Ga0307416_100039351
475 Ga0307411_10063693
476 Ga0307411_10161154
477 Ga0307411_10201448
478 Ga0436364_0379917
479 Ga0436364_0668324
480 Ga0436364_0963615
481 Ga0237819_00107
482 Ga0436365_0013485
483 Ga0436365_0475527
484 Ga0439438_016699
485 Ga0439439_0008090
486 Ga0451789_0343611
487 Ga0439450_019370
488 Ga0450923_001501
489 Ga0450906_007673
490 Ga0439460_0007861
491 Ga0439440_0006138
492 Ga0466972_0030948
493 Ga0466965_0014325
494 Ga0466968_0011165
495 Ga0466960_0033586
496 Ga0466960_0099182
497 Ga0495594_0002280
498 Ga0495606_0037467
499 Ga0495606_0109433
500 Ga0495631_0041030
501 Ga0495644_0000037
502 Ga0495609_0029380
503 Ga0495668_0000895
504 Ga0495661_0064406
505 Ga0496102_0148382
506 Ga0496103_0021684
507 Ga0496104_0024479
508 Ga0496105_0019692
509 Ga0496106_0028013
510 Ga0496107_0095244
511 Ga0496108_0010697
512 Ga0496108_0168737
513 Ga0496109_0014246
514 Ga0496109_0319993
515 Ga0496110_0077650
516 Ga0496111_0004383
517 Ga0496113_0024177
518 Ga0496113_0036991
519 Ga0496115_0255273
520 Ga0496116_0003390
521 Ga0496116_0012963
522 Ga0496117_0017139
523 Ga0496117_0089667
524 Ga0496118_0005133
525 Ga0496119_0082002
526 Ga0496120_0017083
527 Ga0496120_0032192
528 Ga0496120_0069345
529 Ga0496121_0007523
530 Ga0496122_0015796
531 Ga0496122_0048663
532 Ga0496123_0054822
533 Ga0496124_0000043
534 Ga0496125_0000247
535 Ga0501290_005058
536 Ga0501292_008117
537 Ga0501031_0011428
538 Ga0501031_0115766
539 Ga0501032_0010570
540 Ga0501036_0075452
541 Ga0501037_0126833
542 Ga0501039_0031791
543 Ga0501039_0189550
544 Ga0501039_0244955
545 Ga0501040_0002745
546 Ga0501040_0224584
547 Ga0501041_0169868
548 Ga0501042_0042858
549 Ga0501042_0176199
550 Ga0501043_0016891
551 Ga0501047_0086760
552 Ga0501048_0017954
553 Ga0501071_0010329
554 Ga0501071_0116656
555 Ga0501072_0104201
556 Ga0501073_0083199
557 Ga0501075_0003521
558 Ga0501075_0189968
559 Ga0501076_0010850
560 Ga0501076_0150474
561 Ga0501077_0039810
562 Ga0501202_000594
563 Ga0501224_001926
564 Ga0501235_004685
565 Ga0501243_001942
566 Ga0501243_012169
567 Ga0501251_005185
568 Ga0501257_017878
569 Ga0501221_000395
570 Ga0501245_004088
571 Ga0501079_0035846
572 Ga0501080_0200484
573 Ga0501081_0167945
574 Ga0501083_0042698
575 Ga0501266_001624
576 Ga0501035_0134026
577 Ga0501044_0069899
578 Ga0501045_0098814
579 Ga0501045_0204894
580 nmdc:mga03n38_10961_c1
581 nmdc:mga04h51_278_c1
582 nmdc:mga05p37_11578_c1
583 nmdc:mga05p37_135103_c1
584 nmdc:mga05p37_185009_c1
585 nmdc:mga05p37_378297_c1
586 nmdc:mga05p37_68548_c1
587 nmdc:mga09592_18686_c1
588 nmdc:mga0qj67_102465_c1
589 nmdc:mga0qj67_1742_c1
590 nmdc:mga0qj67_2024_c1
591 nmdc:mga06r32_135496_c1
592 nmdc:mga06r32_14240_c1
593 nmdc:mga06r32_22928_c1
594 nmdc:mga06r32_242311_c1
595 nmdc:mga08y16_156146_c1
596 nmdc:mga08y16_92968_c1
597 nmdc:mga08y16_97736_c1
598 nmdc:mga0n895_264426_c1
599 nmdc:mga0n895_8845_c1
600 Ga0501084_0051922
601 Ga0501084_0386535
602 Ga0587077_016783
603 Ga0587101_007238
604 Ga0587062_007538
605 Ga0501082_0079228
606 Ga0530510_0160723
607 2511699647
608 2545555917
609 2578929339
610 2595091955
611 2595452383
612 2596375465
613 2631983124
614 2644721121
615 2651533061
616 2672336398
617 2685150717
618 2695627599
619 2717916601
620 2739267880
621 2808867475
622 2816864344
623 2819554560
624 2819714866
625 2835190593
626 2839989632
627 2842683167
628 2842884892
629 2849145155
630 2857455565
631 2857582883
632 2857605315
633 2864736399
634 2877770434
635 2880171428
636 2889051980
637 2889280108
638 2904115964
639 2904527335
640 2904561152
641 2919144054
642 2919426613
643 2919519277
644 2919724798
645 2928097155
646 2928128336
647 2928531265
648 2928969918
649 2929009648
650 2947429428
651 2969142888
652 2971409688
653 2971416781
654 2971895200
655 2977255298
656 2996707203
657 3001273297
658 3001895989
659 3006977086
660 3006985250
661 648170323
662 8002319510
663 8007378862
664 8022625055
665 8022631049
666 8022894751
667 8052174830
668 8054283689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03022

MRJP

Major royal jelly protein

166

455

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe8-assembly1.cif.gz_A crystal structure of a putative hydrolase (ava_4197) from anabaena variabilis atcc 29413 at 1.35 a resolution 0.9169 20 366
2qe8-assembly1.cif.gz_A crystal structure of a putative hydrolase (ava_4197) from anabaena variabilis atcc 29413 at 1.35 a resolution 0.8988 20 366
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8138 225 310
6qsh-assembly1.cif.gz_A-2 crystal structure of the hybrid bioinorganic complex of pizza6s linked by the 1:2 ce-substituted keggin 0.8003 20 362
7zpw-assembly2.cif.gz_D crystal structure of pizza6-tsk-tsh with silicotungstic acid (sta) polyoxometalate 0.7947 20 362
ID Description Score Start End Superfamily
af_Q66H79_552_654_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9358 280 333 2.40.10.500
2qe8B00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9134 20 366 2.120.10.30
2qe8B00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8951 20 366 2.120.10.30
af_Q8VZ10_784_886_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8435 280 333 2.40.10.500
af_Q9VJI5_22_405_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8322 22 361 2.120.10.30
ID Description Score Start End GO Terms
AF-W4AYB1-F1-model_v4 deleted 1 10 370
AF-W4AYB1-F1-model_v4 deleted 0.9975 10 370
AF-A0A2A9BP36-F1-model_v4 deleted 0.9939 58 371
AF-A0A7T8M5K1-F1-model_v4 deleted 0.9926 9 367
AF-V9HG24-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9922 177 368 GO:0005576

Map