F411890

General Info

Members Datasets Scaffolds Average Seq Length
334 201 668 99

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1109918|Ga0436365_1109918_91_393
Length 100
Sequence MIRVVLPFHLRKLARLDGDELHLELAEPITVRAVLDEIEMRYPVLRGTIRDHGTLQRRPFIRFFACKEDLSLDPPETTQLPEAVVNGDEPFLIIGAMAGG

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
189 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.59
Rhizosphere 95.81
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1109918 3300039437 Bacteria 535
2 Ga0065712_10494164 3300005290 Bacteria 651
3 Ga0065715_10447155 3300005293 Bacteria 830
4 Ga0065707_10179142 3300005295 Bacteria 1430
5 Ga0070676_10061177 3300005328 Bacteria 2238
6 Ga0070683_102364084 3300005329 Bacteria 509
7 Ga0068869_100010318 3300005334 Bacteria 6089
8 Ga0068869_100045274 3300005334 Bacteria 3167
9 Ga0070666_10034466 3300005335 Bacteria 3355
10 Ga0070689_102145427 3300005340 Bacteria 512
11 Ga0070661_100073635 3300005344 Bacteria 2515
12 Ga0070692_10152586 3300005345 Bacteria 1317
13 Ga0070692_10918926 3300005345 Bacteria 606
14 Ga0070669_100194762 3300005353 Bacteria 1592
15 Ga0070669_100280998 3300005353 Bacteria 1334
16 Ga0070675_100053952 3300005354 Bacteria 3306
17 Ga0070675_100180767 3300005354 Bacteria 1823
18 Ga0070674_101349744 3300005356 Bacteria 637
19 Ga0070674_102021370 3300005356 Unclassified 525
20 Ga0070673_100021037 3300005364 Bacteria 4720
21 Ga0070703_10008562 3300005406 Bacteria 2877
22 Ga0070703_10043891 3300005406 Bacteria 1404
23 Ga0070703_10613948 3300005406 Bacteria 503
24 Ga0070709_11084455 3300005434 Bacteria 640
25 Ga0070714_100044670 3300005435 Bacteria 3751
26 Ga0070713_100104837 3300005436 Bacteria 2455
27 Ga0070713_101850808 3300005436 Bacteria 586
28 Ga0070710_10985531 3300005437 Bacteria 613
29 Ga0070711_100036114 3300005439 Bacteria 3310
30 Ga0070711_100096672 3300005439 Unclassified 2140
31 Ga0070711_101824179 3300005439 Unclassified 534
32 Ga0070700_100840429 3300005441 Bacteria 743
33 Ga0070708_100072445 3300005445 Bacteria 3104
34 Ga0070708_100407505 3300005445 Bacteria 1282
35 Ga0070708_100685240 3300005445 Bacteria 965
36 Ga0070678_100578802 3300005456 Bacteria 1000
37 Ga0070662_100661164 3300005457 Bacteria 882
38 Ga0070681_10074902 3300005458 Bacteria 3346
39 Ga0070681_10172759 3300005458 Unclassified 2083
40 Ga0070707_100000896 3300005468 Bacteria 29593
41 Ga0070707_100128594 3300005468 Bacteria 2462
42 Ga0070707_100489181 3300005468 Bacteria 1192
43 Ga0070707_100753987 3300005468 Bacteria 937
44 Ga0070698_100254077 3300005471 Bacteria 1690
45 Ga0070698_102005543 3300005471 Unclassified 532
46 Ga0070699_102177002 3300005518 Unclassified 506
47 Ga0070679_100078516 3300005530 Bacteria 3290
48 Ga0070679_100267139 3300005530 Unclassified 1665
49 Ga0070684_101283812 3300005535 Bacteria 689
50 Ga0070697_100061303 3300005536 Bacteria 3068
51 Ga0070697_100388015 3300005536 Bacteria 1210
52 Ga0070697_101613901 3300005536 Bacteria 580
53 Ga0068853_100346339 3300005539 Bacteria 1381
54 Ga0070672_100622732 3300005543 Bacteria 941
55 Ga0070695_100013686 3300005545 Bacteria 4876
56 Ga0070695_100037689 3300005545 Bacteria 3048
57 Ga0070696_100029861 3300005546 Bacteria 3728
58 Ga0070696_100209808 3300005546 Bacteria 1457
59 Ga0070696_100344539 3300005546 Bacteria 1152
60 Ga0070665_100210332 3300005548 Bacteria 1946
61 Ga0070665_102517781 3300005548 Bacteria 516
62 Ga0070704_100016370 3300005549 Bacteria 4683
63 Ga0070704_100045905 3300005549 Bacteria 3042
64 Ga0068855_100256340 3300005563 Unclassified 1950
65 Ga0068857_101432735 3300005577 Unclassified 672
66 Ga0068854_100219609 3300005578 Bacteria 1503
67 Ga0068856_100114386 3300005614 Unclassified 2697
68 Ga0068859_100000016 3300005617 Bacteria 261719
69 Ga0068864_101833178 3300005618 Bacteria 612
70 Ga0068864_102502227 3300005618 Bacteria 522
71 Ga0068861_100207054 3300005719 Bacteria 1650
72 Ga0068862_100124592 3300005844 Bacteria 2274
73 Ga0081540_1000965 3300005983 Bacteria 25934
74 Ga0070715_10921528 3300006163 Bacteria 539
75 Ga0070716_101831846 3300006173 Unclassified 503
76 Ga0070712_100322675 3300006175 Bacteria 1256
77 Ga0070712_101161998 3300006175 Bacteria 671
78 Ga0070712_101454253 3300006175 Bacteria 598
79 Ga0097621_100343493 3300006237 Bacteria 1326
80 Ga0068871_100280206 3300006358 Bacteria 1458
81 Ga0068871_100618702 3300006358 Bacteria 986
82 Ga0075428_100163964 3300006844 Bacteria 2411
83 Ga0075430_100124005 3300006846 Bacteria 2153
84 Ga0075431_100301885 3300006847 Bacteria 1617
85 Ga0075433_10001097 3300006852 Bacteria 19542
86 Ga0075433_10006605 3300006852 Bacteria 9182
87 Ga0075433_10021647 3300006852 Bacteria 5393
88 Ga0075433_10089893 3300006852 Bacteria 2714
89 Ga0075434_100003381 3300006871 Bacteria 14283
90 Ga0075434_100004776 3300006871 Bacteria 12269
91 Ga0075434_100008715 3300006871 Bacteria 9438
92 Ga0075434_100019782 3300006871 Bacteria 6518
93 Ga0075434_100028787 3300006871 Bacteria 5463
94 Ga0075434_102408241 3300006871 Unclassified 528
95 Ga0075429_100022992 3300006880 Bacteria 5404
96 Ga0075429_100077339 3300006880 Bacteria 2899
97 Ga0075436_100001876 3300006914 Bacteria 14443
98 Ga0075436_100008831 3300006914 Bacteria 6891
99 Ga0075436_100417793 3300006914 Bacteria 973
100 Ga0097620_100000016 3300006931 Bacteria 261719
101 Ga0075435_100051562 3300007076 Bacteria 3315
102 Ga0075435_100173742 3300007076 Bacteria 1818
103 Ga0075435_100186860 3300007076 Bacteria 1753
104 Ga0075435_101812409 3300007076 Bacteria 536
105 Ga0105240_10097494 3300009093 Bacteria 3582
106 Ga0105240_10421096 3300009093 Bacteria 1500
107 Ga0111539_10000562 3300009094 Bacteria 47603
108 Ga0105245_10263158 3300009098 Bacteria 1679
109 Ga0105245_11574447 3300009098 Bacteria 709
110 Ga0105247_10229631 3300009101 Bacteria 1260
111 Ga0114129_10001123 3300009147 Bacteria 35345
112 Ga0114129_10386729 3300009147 Bacteria 1846
113 Ga0114129_10719005 3300009147 Bacteria 1282
114 Ga0114129_11081552 3300009147 Bacteria 1005
115 Ga0114129_11243176 3300009147 Bacteria 926
116 Ga0105243_10098407 3300009148 Bacteria 2423
117 Ga0105241_10003138 3300009174 Bacteria 12291
118 Ga0105241_10053489 3300009174 Bacteria 3088
119 Ga0105248_10234571 3300009177 Bacteria 2065
120 Ga0105248_10679390 3300009177 Bacteria 1162
121 Ga0105248_11461555 3300009177 Unclassified 774
122 Ga0105248_11464306 3300009177 Bacteria 773
123 Ga0105237_10174769 3300009545 Unclassified 2148
124 Ga0105237_10498568 3300009545 Bacteria 1224
125 Ga0105237_11707516 3300009545 Bacteria 637
126 Ga0105238_10196444 3300009551 Bacteria 1993
127 Ga0105238_10571468 3300009551 Bacteria 1136
128 Ga0105249_11865324 3300009553 Bacteria 674
129 Ga0105249_12167208 3300009553 Bacteria 629
130 Ga0157373_10005937 3300013100 Bacteria 9135
131 Ga0157369_10884118 3300013105 Unclassified 917
132 Ga0157374_11193285 3300013296 Bacteria 782
133 Ga0163162_10842312 3300013306 Unclassified 1032
134 Ga0163162_10904756 3300013306 Bacteria 995
135 Ga0157372_10001842 3300013307 Bacteria 22977
136 Ga0157375_10016043 3300013308 Bacteria 6720
137 Ga0163163_10030461 3300014325 Bacteria 5199
138 Ga0163163_10198221 3300014325 Bacteria 2056
139 Ga0163163_12411790 3300014325 Bacteria 584
140 Ga0163163_12475919 3300014325 Bacteria 577
141 Ga0157380_10065164 3300014326 Bacteria 2927
142 Ga0157380_12637483 3300014326 Bacteria 569
143 Ga0157379_10021531 3300014968 Bacteria 5708
144 Ga0157376_10281368 3300014969 Bacteria 1567
145 Ga0157376_12431491 3300014969 Bacteria 563
146 Ga0213872_10098254 3300021361 Bacteria 1306
147 Ga0224572_1001113 3300024225 Bacteria 3798
148 Ga0228598_1011372 3300024227 Bacteria 1770
149 Ga0207653_10008942 3300025885 Bacteria 3126
150 Ga0207653_10391866 3300025885 Bacteria 544
151 Ga0207699_10817358 3300025906 Bacteria 686
152 Ga0207645_10010292 3300025907 Bacteria 6425
153 Ga0207684_10020611 3300025910 Bacteria 5633
154 Ga0207684_11092792 3300025910 Bacteria 664
155 Ga0207654_10031573 3300025911 Bacteria 2919
156 Ga0207654_10297747 3300025911 Bacteria 1096
157 Ga0207707_10090837 3300025912 Bacteria 2668
158 Ga0207707_10373575 3300025912 Bacteria 1226
159 Ga0207671_10213018 3300025914 Unclassified 1512
160 Ga0207693_10295001 3300025915 Bacteria 1270
161 Ga0207693_10397197 3300025915 Bacteria 1078
162 Ga0207663_10176284 3300025916 Unclassified 1523
163 Ga0207663_10240329 3300025916 Bacteria 1328
164 Ga0207660_10562027 3300025917 Bacteria 928
165 Ga0207662_11153968 3300025918 Bacteria 551
166 Ga0207649_10776138 3300025920 Bacteria 747
167 Ga0207652_11255060 3300025921 Unclassified 643
168 Ga0207646_10000012 3300025922 Bacteria 367049
169 Ga0207646_10020438 3300025922 Bacteria 6134
170 Ga0207646_10114670 3300025922 Bacteria 2420
171 Ga0207646_10489294 3300025922 Bacteria 1109
172 Ga0207646_10940107 3300025922 Bacteria 766
173 Ga0207694_10378169 3300025924 Bacteria 1175
174 Ga0207659_10207693 3300025926 Bacteria 1568
175 Ga0207687_10300167 3300025927 Bacteria 1293
176 Ga0207687_10415755 3300025927 Bacteria 1109
177 Ga0207700_10420624 3300025928 Bacteria 1174
178 Ga0207664_10294185 3300025929 Bacteria 1427
179 Ga0207664_10315219 3300025929 Unclassified 1379
180 Ga0207686_10346771 3300025934 Bacteria 1117
181 Ga0207709_11770340 3300025935 Bacteria 514
182 Ga0207670_11740161 3300025936 Bacteria 530
183 Ga0207669_10700619 3300025937 Bacteria 832
184 Ga0207665_11432707 3300025939 Bacteria 550
185 Ga0207691_10740644 3300025940 Bacteria 828
186 Ga0207711_11538651 3300025941 Bacteria 608
187 Ga0207689_10000942 3300025942 Bacteria 27963
188 Ga0207689_10056751 3300025942 Bacteria 3222
189 Ga0207667_11036169 3300025949 Bacteria 806
190 Ga0207712_10093914 3300025961 Bacteria 2214
191 Ga0207640_10187609 3300025981 Bacteria 1556
192 Ga0207677_10623087 3300026023 Bacteria 949
193 Ga0207639_10017113 3300026041 Bacteria 5136
194 Ga0207639_11105665 3300026041 Unclassified 743
195 Ga0207708_11118010 3300026075 Bacteria 687
196 Ga0207702_10039053 3300026078 Unclassified 3976
197 Ga0207648_10290245 3300026089 Bacteria 1464
198 Ga0207676_10687261 3300026095 Bacteria 990
199 Ga0207676_10780587 3300026095 Bacteria 931
200 Ga0207674_11897440 3300026116 Unclassified 562
201 Ga0207675_100403770 3300026118 Bacteria 1347
202 Ga0207698_10160676 3300026142 Bacteria 1964
203 Ga0207428_10000144 3300027907 Bacteria 96684
204 Ga0265357_1008660 3300028023 Bacteria 1002
205 Ga0268265_10051356 3300028380 Bacteria 3112
206 Ga0265322_10000143 3300028654 Bacteria 33417
207 Ga0265338_10004929 3300028800 Bacteria 17729
208 Ga0265338_10010636 3300028800 Bacteria 10751
209 Ga0265338_10040125 3300028800 Bacteria 4401
210 Ga0265760_10012328 3300031090 Bacteria 2443
211 Ga0265760_10020761 3300031090 Bacteria 1897
212 Ga0265760_10298253 3300031090 Bacteria 570
213 Ga0265325_10078964 3300031241 Bacteria 1639
214 Ga0265339_10001013 3300031249 Bacteria 21374
215 Ga0265339_10018085 3300031249 Bacteria 4161
216 Ga0265339_10172271 3300031249 Bacteria 1082
217 Ga0265339_10470926 3300031249 Unclassified 582
218 Ga0265316_10014893 3300031344 Bacteria 6821
219 Ga0265316_10250036 3300031344 Unclassified 1302
220 Ga0265316_10311341 3300031344 Bacteria 1145
221 Ga0265313_10334363 3300031595 Bacteria 603
222 Ga0265314_10001761 3300031711 Bacteria 23372
223 Ga0265342_10006451 3300031712 Bacteria 8734
224 Ga0307412_10346000 3300031911 Bacteria 1192
225 Ga0373940_0043235 3300035088 Bacteria 1244
226 Ga0373940_0162135 3300035088 Bacteria 718
227 Ga0373936_0484303 3300035113 Unclassified 574
228 Ga0373945_0323757 3300035116 Unclassified 664
229 Ga0373943_0716803 3300035170 Bacteria 593
230 Ga0373946_0219346 3300035171 Bacteria 918
231 Ga0373931_0023343 3300035691 Bacteria 3122
232 Ga0373931_1188274 3300035691 Bacteria 522
233 Ga0373927_0107974 3300035695 Bacteria 1813
234 Ga0373947_0109314 3300035725 Bacteria 1745
235 Ga0373947_0177004 3300035725 Bacteria 1387
236 Ga0373925_0125892 3300037068 Bacteria 1993
237 Ga0373925_0247327 3300037068 Bacteria 1430
238 Ga0373925_0796765 3300037068 Bacteria 779
239 Ga0436361_0494955 3300039447 Bacteria 1183
240 Ga0436361_0586031 3300039447 Bacteria 14421
241 Ga0436363_1228002 3300039450 Bacteria 838
242 Ga0451577_0000536 3300042876 Bacteria 62369
243 Ga0439440_0061780 3300042993 Bacteria 958
244 Ga0453683_0027041 3300044673 Bacteria 3642
245 Ga0453683_0292748 3300044673 Bacteria 1041
246 Ga0453683_0299405 3300044673 Unclassified 1029
247 Ga0453683_0482635 3300044673 Bacteria 803
248 Ga0453683_0637358 3300044673 Bacteria 696
249 Ga0453684_0000023 3300044712 Bacteria 857153
250 Ga0453684_0001218 3300044712 Bacteria 78994
251 Ga0453684_0538665 3300044712 Bacteria 1287
252 Ga0453684_1391620 3300044712 Bacteria 728
253 Ga0466968_0135776 3300044735 Bacteria 1122
254 Ga0451576_0004776 3300045051 Bacteria 17369
255 Ga0451576_0139091 3300045051 Bacteria 2533
256 Ga0451576_0276130 3300045051 Bacteria 1757
257 Ga0451576_0368660 3300045051 Bacteria 1504
258 Ga0451576_0761029 3300045051 Bacteria 1017
259 Ga0451576_0775045 3300045051 Bacteria 1007
260 Ga0451576_1161142 3300045051 Bacteria 807
261 Ga0495603_0088256 3300046455 Bacteria 1815
262 Ga0495603_0105711 3300046455 Bacteria 1643
263 Ga0495651_0000024 3300046462 Bacteria 113645
264 Ga0495651_0264758 3300046462 Unclassified 1168
265 Ga0495653_0441587 3300046463 Bacteria 820
266 Ga0495653_0724078 3300046463 Bacteria 603
267 Ga0495580_0053975 3300046472 Bacteria 2835
268 Ga0495580_0068070 3300046472 Bacteria 2490
269 Ga0495605_0391340 3300046474 Unclassified 579
270 Ga0495664_0624065 3300046477 Bacteria 640
271 Ga0495618_0568572 3300046514 Unclassified 677
272 Ga0495628_0676641 3300046516 Bacteria 731
273 Ga0495663_0400127 3300046525 Bacteria 505
274 Ga0495586_0547560 3300046535 Bacteria 668
275 Ga0495645_0033618 3300046543 Bacteria 3741
276 Ga0495667_0007600 3300046559 Bacteria 7357
277 Ga0495667_0999319 3300046559 Bacteria 510
278 Ga0495659_0183360 3300046664 Bacteria 853
279 Ga0495600_0094068 3300046809 Bacteria 1954
280 Ga0495600_0621381 3300046809 Bacteria 655
281 Ga0495604_0086475 3300047317 Unclassified 2337
282 Ga0495604_0097000 3300047317 Bacteria 2175
283 Ga0495674_0357390 3300047319 Bacteria 1185
284 Ga0495680_0000749 3300047322 Bacteria 36388
285 Ga0495675_0008673 3300047444 Bacteria 6306
286 Ga0495675_0544726 3300047444 Unclassified 662
287 Ga0495602_0307457 3300048088 Bacteria 1158
288 Ga0496100_0800753 3300048903 Bacteria 738
289 Ga0496102_0038222 3300048905 Bacteria 4330
290 Ga0496102_0956119 3300048905 Bacteria 778
291 Ga0496103_0009182 3300048906 Bacteria 5855
292 Ga0496104_0094136 3300048907 Unclassified 2866
293 Ga0496105_0889198 3300048908 Bacteria 672
294 Ga0496106_0944946 3300048909 Bacteria 679
295 Ga0496107_0160164 3300048910 Bacteria 1668
296 Ga0496108_1136863 3300048911 Bacteria 662
297 Ga0496112_0011513 3300048915 Bacteria 8082
298 Ga0496114_1214201 3300048917 Bacteria 640
299 Ga0496115_0680546 3300048918 Bacteria 810
300 Ga0501291_079245 3300049514 Bacteria 651
301 Ga0501042_0494850 3300049578 Bacteria 888
302 Ga0501047_1284145 3300049581 Bacteria 546
303 Ga0501283_001186 3300049779 Bacteria 3441
304 Ga0501226_035656 3300049853 Bacteria 571
305 nmdc:mga05p37_103696_c1 3300050507 Bacteria 3500
306 nmdc:mga05p37_135969_c1 3300050507 Bacteria 3014
307 nmdc:mga05p37_1658354_c1 3300050507 Bacteria 626
308 nmdc:mga05p37_297035_c1 3300050507 Bacteria 1921
309 nmdc:mga05p37_723_c1 3300050507 Bacteria 36579
310 nmdc:mga05p37_833468_c1 3300050507 Bacteria 1004
311 nmdc:mga09592_15431_c1 3300050508 Bacteria 6241
312 nmdc:mga09592_444609_c1 3300050508 Bacteria 1119
313 nmdc:mga0qj67_333789_c1 3300050509 Bacteria 1227
314 nmdc:mga06r32_30285_c1 3300050510 Bacteria 5078
315 nmdc:mga08y16_1233_c1 3300050511 Bacteria 25318
316 nmdc:mga0n895_1397_c1 3300050512 Bacteria 17994
317 nmdc:mga0n895_14384_c1 3300050512 Bacteria 7184
318 nmdc:mga0n895_21933_c1 3300050512 Bacteria 5982
319 nmdc:mga0n895_691276_c1 3300050512 Bacteria 1017
320 nmdc:mga0n895_86181_c1 3300050512 Bacteria 3137
321 nmdc:mga0rr50_1890996_c1 3300050513 Bacteria 502
322 nmdc:mga0rr50_49477_c1 3300050513 Bacteria 3112
323 nmdc:mga0rr50_678807_c1 3300050513 Unclassified 879
324 nmdc:mga0rr50_739065_c1 3300050513 Bacteria 840
325 nmdc:mga08x19_24406_c1 3300050514 Bacteria 3757
326 nmdc:mga08x19_3858_c1 3300050514 Bacteria 8922
327 nmdc:mga08x19_636014_c1 3300050514 Bacteria 757
328 nmdc:mga0a205_114927_c1 3300050515 Bacteria 2590
329 nmdc:mga0a205_166960_c1 3300050515 Bacteria 2097
330 nmdc:mga0a205_6577_c1 3300050515 Bacteria 10516
331 Ga0495619_0139285 3300053085 Unclassified 1670
332 Ga0501082_0615162 3300060353 Bacteria 951
333 Ga0501082_1384899 3300060353 Bacteria 614
334 Ga0530510_0387502 3300061734 Bacteria 1052
335 Ga0436365_1109918
336 Ga0065712_10494164
337 Ga0065715_10447155
338 Ga0065707_10179142
339 Ga0070676_10061177
340 Ga0070683_102364084
341 Ga0068869_100010318
342 Ga0068869_100045274
343 Ga0070666_10034466
344 Ga0070689_102145427
345 Ga0070661_100073635
346 Ga0070692_10152586
347 Ga0070692_10918926
348 Ga0070669_100194762
349 Ga0070669_100280998
350 Ga0070675_100053952
351 Ga0070675_100180767
352 Ga0070674_101349744
353 Ga0070674_102021370
354 Ga0070673_100021037
355 Ga0070703_10008562
356 Ga0070703_10043891
357 Ga0070703_10613948
358 Ga0070709_11084455
359 Ga0070714_100044670
360 Ga0070713_100104837
361 Ga0070713_101850808
362 Ga0070710_10985531
363 Ga0070711_100036114
364 Ga0070711_100096672
365 Ga0070711_101824179
366 Ga0070700_100840429
367 Ga0070708_100072445
368 Ga0070708_100407505
369 Ga0070708_100685240
370 Ga0070678_100578802
371 Ga0070662_100661164
372 Ga0070681_10074902
373 Ga0070681_10172759
374 Ga0070707_100000896
375 Ga0070707_100128594
376 Ga0070707_100489181
377 Ga0070707_100753987
378 Ga0070698_100254077
379 Ga0070698_102005543
380 Ga0070699_102177002
381 Ga0070679_100078516
382 Ga0070679_100267139
383 Ga0070684_101283812
384 Ga0070697_100061303
385 Ga0070697_100388015
386 Ga0070697_101613901
387 Ga0068853_100346339
388 Ga0070672_100622732
389 Ga0070695_100013686
390 Ga0070695_100037689
391 Ga0070696_100029861
392 Ga0070696_100209808
393 Ga0070696_100344539
394 Ga0070665_100210332
395 Ga0070665_102517781
396 Ga0070704_100016370
397 Ga0070704_100045905
398 Ga0068855_100256340
399 Ga0068857_101432735
400 Ga0068854_100219609
401 Ga0068856_100114386
402 Ga0068859_100000016
403 Ga0068864_101833178
404 Ga0068864_102502227
405 Ga0068861_100207054
406 Ga0068862_100124592
407 Ga0081540_1000965
408 Ga0070715_10921528
409 Ga0070716_101831846
410 Ga0070712_100322675
411 Ga0070712_101161998
412 Ga0070712_101454253
413 Ga0097621_100343493
414 Ga0068871_100280206
415 Ga0068871_100618702
416 Ga0075428_100163964
417 Ga0075430_100124005
418 Ga0075431_100301885
419 Ga0075433_10001097
420 Ga0075433_10006605
421 Ga0075433_10021647
422 Ga0075433_10089893
423 Ga0075434_100003381
424 Ga0075434_100004776
425 Ga0075434_100008715
426 Ga0075434_100019782
427 Ga0075434_100028787
428 Ga0075434_102408241
429 Ga0075429_100022992
430 Ga0075429_100077339
431 Ga0075436_100001876
432 Ga0075436_100008831
433 Ga0075436_100417793
434 Ga0097620_100000016
435 Ga0075435_100051562
436 Ga0075435_100173742
437 Ga0075435_100186860
438 Ga0075435_101812409
439 Ga0105240_10097494
440 Ga0105240_10421096
441 Ga0111539_10000562
442 Ga0105245_10263158
443 Ga0105245_11574447
444 Ga0105247_10229631
445 Ga0114129_10001123
446 Ga0114129_10386729
447 Ga0114129_10719005
448 Ga0114129_11081552
449 Ga0114129_11243176
450 Ga0105243_10098407
451 Ga0105241_10003138
452 Ga0105241_10053489
453 Ga0105248_10234571
454 Ga0105248_10679390
455 Ga0105248_11461555
456 Ga0105248_11464306
457 Ga0105237_10174769
458 Ga0105237_10498568
459 Ga0105237_11707516
460 Ga0105238_10196444
461 Ga0105238_10571468
462 Ga0105249_11865324
463 Ga0105249_12167208
464 Ga0157373_10005937
465 Ga0157369_10884118
466 Ga0157374_11193285
467 Ga0163162_10842312
468 Ga0163162_10904756
469 Ga0157372_10001842
470 Ga0157375_10016043
471 Ga0163163_10030461
472 Ga0163163_10198221
473 Ga0163163_12411790
474 Ga0163163_12475919
475 Ga0157380_10065164
476 Ga0157380_12637483
477 Ga0157379_10021531
478 Ga0157376_10281368
479 Ga0157376_12431491
480 Ga0213872_10098254
481 Ga0224572_1001113
482 Ga0228598_1011372
483 Ga0207653_10008942
484 Ga0207653_10391866
485 Ga0207699_10817358
486 Ga0207645_10010292
487 Ga0207684_10020611
488 Ga0207684_11092792
489 Ga0207654_10031573
490 Ga0207654_10297747
491 Ga0207707_10090837
492 Ga0207707_10373575
493 Ga0207671_10213018
494 Ga0207693_10295001
495 Ga0207693_10397197
496 Ga0207663_10176284
497 Ga0207663_10240329
498 Ga0207660_10562027
499 Ga0207662_11153968
500 Ga0207649_10776138
501 Ga0207652_11255060
502 Ga0207646_10000012
503 Ga0207646_10020438
504 Ga0207646_10114670
505 Ga0207646_10489294
506 Ga0207646_10940107
507 Ga0207694_10378169
508 Ga0207659_10207693
509 Ga0207687_10300167
510 Ga0207687_10415755
511 Ga0207700_10420624
512 Ga0207664_10294185
513 Ga0207664_10315219
514 Ga0207686_10346771
515 Ga0207709_11770340
516 Ga0207670_11740161
517 Ga0207669_10700619
518 Ga0207665_11432707
519 Ga0207691_10740644
520 Ga0207711_11538651
521 Ga0207689_10000942
522 Ga0207689_10056751
523 Ga0207667_11036169
524 Ga0207712_10093914
525 Ga0207640_10187609
526 Ga0207677_10623087
527 Ga0207639_10017113
528 Ga0207639_11105665
529 Ga0207708_11118010
530 Ga0207702_10039053
531 Ga0207648_10290245
532 Ga0207676_10687261
533 Ga0207676_10780587
534 Ga0207674_11897440
535 Ga0207675_100403770
536 Ga0207698_10160676
537 Ga0207428_10000144
538 Ga0265357_1008660
539 Ga0268265_10051356
540 Ga0265322_10000143
541 Ga0265338_10004929
542 Ga0265338_10010636
543 Ga0265338_10040125
544 Ga0265760_10012328
545 Ga0265760_10020761
546 Ga0265760_10298253
547 Ga0265325_10078964
548 Ga0265339_10001013
549 Ga0265339_10018085
550 Ga0265339_10172271
551 Ga0265339_10470926
552 Ga0265316_10014893
553 Ga0265316_10250036
554 Ga0265316_10311341
555 Ga0265313_10334363
556 Ga0265314_10001761
557 Ga0265342_10006451
558 Ga0307412_10346000
559 Ga0373940_0043235
560 Ga0373940_0162135
561 Ga0373936_0484303
562 Ga0373945_0323757
563 Ga0373943_0716803
564 Ga0373946_0219346
565 Ga0373931_0023343
566 Ga0373931_1188274
567 Ga0373927_0107974
568 Ga0373947_0109314
569 Ga0373947_0177004
570 Ga0373925_0125892
571 Ga0373925_0247327
572 Ga0373925_0796765
573 Ga0436361_0494955
574 Ga0436361_0586031
575 Ga0436363_1228002
576 Ga0451577_0000536
577 Ga0439440_0061780
578 Ga0453683_0027041
579 Ga0453683_0292748
580 Ga0453683_0299405
581 Ga0453683_0482635
582 Ga0453683_0637358
583 Ga0453684_0000023
584 Ga0453684_0001218
585 Ga0453684_0538665
586 Ga0453684_1391620
587 Ga0466968_0135776
588 Ga0451576_0004776
589 Ga0451576_0139091
590 Ga0451576_0276130
591 Ga0451576_0368660
592 Ga0451576_0761029
593 Ga0451576_0775045
594 Ga0451576_1161142
595 Ga0495603_0088256
596 Ga0495603_0105711
597 Ga0495651_0000024
598 Ga0495651_0264758
599 Ga0495653_0441587
600 Ga0495653_0724078
601 Ga0495580_0053975
602 Ga0495580_0068070
603 Ga0495605_0391340
604 Ga0495664_0624065
605 Ga0495618_0568572
606 Ga0495628_0676641
607 Ga0495663_0400127
608 Ga0495586_0547560
609 Ga0495645_0033618
610 Ga0495667_0007600
611 Ga0495667_0999319
612 Ga0495659_0183360
613 Ga0495600_0094068
614 Ga0495600_0621381
615 Ga0495604_0086475
616 Ga0495604_0097000
617 Ga0495674_0357390
618 Ga0495680_0000749
619 Ga0495675_0008673
620 Ga0495675_0544726
621 Ga0495602_0307457
622 Ga0496100_0800753
623 Ga0496102_0038222
624 Ga0496102_0956119
625 Ga0496103_0009182
626 Ga0496104_0094136
627 Ga0496105_0889198
628 Ga0496106_0944946
629 Ga0496107_0160164
630 Ga0496108_1136863
631 Ga0496112_0011513
632 Ga0496114_1214201
633 Ga0496115_0680546
634 Ga0501291_079245
635 Ga0501042_0494850
636 Ga0501047_1284145
637 Ga0501283_001186
638 Ga0501226_035656
639 nmdc:mga05p37_103696_c1
640 nmdc:mga05p37_135969_c1
641 nmdc:mga05p37_1658354_c1
642 nmdc:mga05p37_297035_c1
643 nmdc:mga05p37_723_c1
644 nmdc:mga05p37_833468_c1
645 nmdc:mga09592_15431_c1
646 nmdc:mga09592_444609_c1
647 nmdc:mga0qj67_333789_c1
648 nmdc:mga06r32_30285_c1
649 nmdc:mga08y16_1233_c1
650 nmdc:mga0n895_1397_c1
651 nmdc:mga0n895_14384_c1
652 nmdc:mga0n895_21933_c1
653 nmdc:mga0n895_691276_c1
654 nmdc:mga0n895_86181_c1
655 nmdc:mga0rr50_1890996_c1
656 nmdc:mga0rr50_49477_c1
657 nmdc:mga0rr50_678807_c1
658 nmdc:mga0rr50_739065_c1
659 nmdc:mga08x19_24406_c1
660 nmdc:mga08x19_3858_c1
661 nmdc:mga08x19_636014_c1
662 nmdc:mga0a205_114927_c1
663 nmdc:mga0a205_166960_c1
664 nmdc:mga0a205_6577_c1
665 Ga0495619_0139285
666 Ga0501082_0615162
667 Ga0501082_1384899
668 Ga0530510_0387502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8675 3 98
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8546 3 93
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8328 3 98
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8308 3 94
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8131 3 91
ID Description Score Start End Superfamily
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8325 3 93 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8319 1 98 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8232 1 98 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8226 2 93 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.813 3 91 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 1.001 1 46
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9972 1 94
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.997 1 85
AF-A0A536BAC8-F1-model_v4 MoaD/ThiS family protein 0.9963 1 51
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9886 1 85

Map