F411816

General Info

Members Datasets Scaffolds Average Seq Length
334 218 301 157

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1001365|Ga0209257_10013657
Length 189
Sequence MTVRQPSGVFATVTRTGRRSVTTRTPFPRKRQADMKSLLSVLAMTTALTLPGLAMARPVTLTTTLTNYGGDGAYLALYVTDPQGKYAGTLWVAGGKSKYYEHLSGWYRATGGRAGIDGITGASVGAGRTLEISLDLADALFDAGYTLHVDAAVEDMRDSPNEVAVPLTVASAKTPVRGRRYVSTVAYSF

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
7 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
8 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
9 2534681786 Brucella suis 92/29 Isolate Unclassified
10 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
11 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
12 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
15 2802429633 Rhizobium anhuiense J3 Isolate Nodule
16 2802429634 Rhizobium anhuiense S10 Isolate Nodule
17 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
18 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
19 2802429637 Rhizobium anhuiense C15 Isolate Nodule
20 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
21 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
22 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
23 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
24 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
25 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
26 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
27 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
28 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
29 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
111 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
211 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
215 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
216 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
217 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
218 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.12
Metatranscriptomes 0
Isolates 9.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.96
Nodule 5.99
Rhizoplane 0.9
Rhizosphere 64.07
Stem 0
Stem Tuber 0.3
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000326 3300002704 Bacteria 15911
2 JGI25156J39149_1000798 3300002705 Bacteria 16153
3 JGI25154J39366_1000656 3300002738 Bacteria 16153
4 JGI25157J39369_1000790 3300002741 Bacteria 16153
5 JGI25152J39213_1000605 3300002773 Bacteria 19315
6 JGI25151J46595_10000238 3300003187 Bacteria 64884
7 JGI25151J46595_10080758 3300003187 Bacteria 942
8 JGI25153J46596_10000797 3300003215 Bacteria 19315
9 JGI25153J46596_10003297 3300003215 Bacteria 9070
10 rootL2_10028947 3300003322 Bacteria 18772
11 rootH1_10298660 3300003323 Bacteria 1518
12 JGI25160J50197_1008053 3300003354 Bacteria 4050
13 Ga0055526_1004821 3300003771 Bacteria 7972
14 Ga0055526_1008521 3300003771 Bacteria 5098
15 Ga0055524_1002622 3300003775 Bacteria 9150
16 Ga0055524_1059376 3300003775 Bacteria 804
17 Ga0055528_1003145 3300003790 Bacteria 8460
18 Ga0055528_1055480 3300003790 Bacteria 774
19 Ga0055540_1021226 3300003792 Bacteria 1692
20 Ga0055543_1002290 3300004625 Bacteria 6463
21 Ga0065165_1010942 3300005262 Bacteria 3852
22 Ga0070687_100764888 3300005343 Bacteria 681
23 Ga0068853_100152867 3300005539 Bacteria 2078
24 Ga0070665_101974467 3300005548 Bacteria 589
25 Ga0068866_10840730 3300005718 Bacteria 641
26 Ga0075365_10043773 3300006038 Bacteria 2931
27 Ga0075365_10232231 3300006038 Bacteria 1295
28 Ga0075363_100040979 3300006048 Bacteria 2442
29 Ga0075362_10001346 3300006177 Bacteria 7769
30 Ga0075367_10000445 3300006178 Bacteria 15379
31 Ga0075369_10002484 3300006186 Bacteria 6583
32 Ga0075370_10004448 3300006353 Bacteria 6808
33 Ga0075430_101316518 3300006846 Bacteria 594
34 Ga0105245_11506796 3300009098 Bacteria 723
35 Ga0105247_10006054 3300009101 Bacteria 7524
36 Ga0105243_11272168 3300009148 Unclassified 752
37 Ga0105237_10029699 3300009545 Bacteria 5554
38 Ga0105237_10671104 3300009545 Bacteria 1043
39 Ga0163162_10777229 3300013306 Bacteria 1076
40 Ga0157375_10602553 3300013308 Bacteria 1258
41 Ga0163163_11631497 3300014325 Bacteria 706
42 Ga0157379_11821676 3300014968 Bacteria 598
43 Ga0209435_100023 3300025206 Bacteria 201972
44 Ga0207425_1001236 3300025245 Bacteria 11202
45 Ga0207425_1014131 3300025245 Bacteria 1821
46 Ga0209646_1000080 3300025246 Bacteria 201975
47 Ga0209026_1000076 3300025250 Bacteria 201975
48 Ga0209759_1000059 3300025256 Bacteria 201975
49 Ga0209129_1000739 3300025258 Bacteria 20890
50 Ga0209129_1001036 3300025258 Bacteria 16518
51 Ga0209673_1001623 3300025273 Bacteria 19529
52 Ga0209673_1002481 3300025273 Bacteria 12747
53 Ga0209673_1003767 3300025273 Bacteria 8634
54 Ga0209676_1039415 3300025292 Bacteria 1342
55 Ga0209025_1000237 3300025294 Bacteria 128553
56 Ga0209025_1001909 3300025294 Bacteria 24278
57 Ga0209564_1000868 3300025295 Bacteria 40261
58 Ga0209564_1001116 3300025295 Bacteria 31612
59 Ga0209758_1000545 3300025297 Bacteria 59830
60 Ga0209758_1001607 3300025297 Bacteria 25796
61 Ga0209256_1000327 3300025299 Bacteria 81082
62 Ga0209256_1002985 3300025299 Bacteria 12615
63 Ga0209256_1009087 3300025299 Bacteria 4433
64 Ga0207426_1000302 3300025302 Bacteria 96742
65 Ga0207426_1003541 3300025302 Bacteria 8355
66 Ga0209051_1001031 3300025303 Bacteria 26450
67 Ga0209257_1001365 3300025304 Bacteria 29470
68 Ga0207710_10055088 3300025900 Bacteria 1792
69 Ga0209995_1012963 3300027471 Bacteria 1363
70 Ga0209971_1016482 3300027682 Bacteria 1752
71 Ga0307511_10116408 3300030521 Bacteria 1675
72 Ga0265330_10000332 3300031235 Bacteria 33956
73 Ga0265332_10000008 3300031238 Bacteria 301609
74 Ga0265320_10029148 3300031240 Bacteria 2858
75 Ga0265325_10002673 3300031241 Bacteria 11929
76 Ga0265314_10000156 3300031711 Bacteria 102980
77 Ga0265342_10122711 3300031712 Bacteria 1462
78 Ga0316576_10036167 3300031727 Bacteria 3529
79 Ga0316576_10416117 3300031727 Bacteria 995
80 Ga0316576_10515581 3300031727 Bacteria 879
81 Ga0307413_11370524 3300031824 Bacteria 621
82 Ga0307409_100574929 3300031995 Bacteria 1110
83 Ga0307411_10269256 3300032005 Bacteria 1350
84 Ga0307411_10557137 3300032005 Bacteria 979
85 Ga0307507_10392388 3300033179 Bacteria 793
86 Ga0373927_0024452 3300035695 Bacteria 3952
87 Ga0316584_0078604 3300036712 Bacteria 2471
88 Ga0373925_0242949 3300037068 Bacteria 1442
89 Ga0395899_0000059 3300037312 Bacteria 213004
90 Ga0395899_0674157 3300037312 Unclassified 651
91 Ga0395900_0000017 3300037418 Bacteria 369602
92 Ga0395900_0074238 3300037418 Bacteria 3497
93 Ga0395900_0951970 3300037418 Bacteria 780
94 Ga0395898_0000030 3300037466 Bacteria 369577
95 Ga0395905_0000056 3300037471 Bacteria 209230
96 Ga0395905_0089779 3300037471 Bacteria 2880
97 Ga0395905_0493581 3300037471 Bacteria 1124
98 Ga0395905_0579602 3300037471 Bacteria 1023
99 Ga0395901_0000015 3300038443 Bacteria 373388
100 Ga0395901_0001470 3300038443 Bacteria 24496
101 Ga0395901_0005382 3300038443 Bacteria 12949
102 Ga0439447_077339 3300041407 Bacteria 770
103 Ga0451835_0651999 3300041492 Bacteria 4572
104 Ga0451837_1381965 3300041494 Bacteria 2205
105 Ga0451839_0062617 3300041496 Bacteria 9486
106 Ga0451841_1358901 3300041498 Bacteria 10823
107 Ga0451845_0792661 3300041501 Bacteria 4611
108 Ga0451849_0479820 3300041505 Bacteria 1968
109 Ga0451851_0248772 3300041507 Bacteria 11551
110 Ga0451843_1019230 3300041509 Bacteria 3410
111 Ga0451855_1504608 3300041511 Bacteria 2597
112 Ga0451853_0315672 3300041512 Bacteria 9590
113 Ga0450923_034025 3300042125 Bacteria 1049
114 Ga0453684_1358577 3300044712 Bacteria 739
115 Ga0451576_0023966 3300045051 Bacteria 6596
116 Ga0451576_0036823 3300045051 Bacteria 5185
117 Ga0451576_0093192 3300045051 Bacteria 3132
118 Ga0495629_0021947 3300046459 Bacteria 4555
119 Ga0495629_0039562 3300046459 Bacteria 3318
120 Ga0495651_0054475 3300046462 Bacteria 3076
121 Ga0495651_0077740 3300046462 Bacteria 2512
122 Ga0495653_0015935 3300046463 Bacteria 6127
123 Ga0495585_0009899 3300046492 Bacteria 5695
124 Ga0495583_0002232 3300046506 Bacteria 17070
125 Ga0495608_0243000 3300046511 Bacteria 1124
126 Ga0495616_0408971 3300046513 Bacteria 556
127 Ga0495620_0005632 3300046515 Bacteria 6971
128 Ga0495628_0084052 3300046516 Bacteria 2470
129 Ga0495630_0022258 3300046517 Bacteria 4682
130 Ga0495637_0126706 3300046520 Bacteria 978
131 Ga0495643_0002298 3300046522 Bacteria 15434
132 Ga0495666_0007740 3300046526 Bacteria 5377
133 Ga0495665_0103808 3300046531 Bacteria 1491
134 Ga0495640_0226939 3300046533 Bacteria 1176
135 Ga0495586_0608612 3300046535 Bacteria 631
136 Ga0495633_0021329 3300046558 Bacteria 3242
137 Ga0495667_0572217 3300046559 Bacteria 705
138 Ga0495634_0478297 3300046642 Bacteria 732
139 Ga0495625_0004269 3300046660 Bacteria 13602
140 Ga0495625_0011725 3300046660 Bacteria 7123
141 Ga0495635_0457318 3300046663 Bacteria 843
142 Ga0495599_0017349 3300046678 Bacteria 4476
143 Ga0495623_0005649 3300046679 Bacteria 8163
144 Ga0495624_0000383 3300046690 Bacteria 35210
145 Ga0495624_0478808 3300046690 Bacteria 745
146 Ga0495670_0183865 3300046691 Bacteria 1104
147 Ga0495600_0365098 3300046809 Bacteria 903
148 Ga0495600_0475280 3300046809 Bacteria 771
149 Ga0495604_0025383 3300047317 Bacteria 4723
150 Ga0495674_0230620 3300047319 Bacteria 1528
151 Ga0495680_0071061 3300047322 Bacteria 2651
152 Ga0495687_016620 3300047443 Bacteria 3696
153 Ga0495675_0017777 3300047444 Bacteria 4508
154 Ga0495675_0058310 3300047444 Bacteria 2448
155 Ga0495675_0215755 3300047444 Bacteria 1163
156 Ga0495675_0558100 3300047444 Bacteria 652
157 Ga0495673_0300364 3300047469 Bacteria 576
158 Ga0495684_0068066 3300047471 Bacteria 2708
159 Ga0495684_0718392 3300047471 Bacteria 661
160 Ga0495593_0162280 3300047673 Bacteria 1128
161 Ga0495602_0027230 3300048088 Bacteria 5497
162 Ga0495602_0057891 3300048088 Bacteria 3396
163 Ga0495602_0131814 3300048088 Bacteria 1992
164 Ga0496102_0763888 3300048905 Bacteria 889
165 Ga0496105_0019049 3300048908 Bacteria 5531
166 Ga0496108_0977972 3300048911 Bacteria 724
167 Ga0496118_0399178 3300048921 Bacteria 715
168 Ga0496119_0203010 3300048922 Bacteria 1025
169 Ga0496121_0073804 3300048924 Bacteria 2732
170 Ga0496121_0306312 3300048924 Bacteria 1076
171 Ga0496122_0001031 3300048925 Bacteria 48975
172 Ga0496123_0005552 3300048926 Bacteria 12641
173 Ga0496124_0023705 3300048927 Bacteria 5596
174 Ga0496125_0211010 3300048928 Bacteria 1261
175 Ga0496126_0333096 3300048929 Unclassified 1245
176 Ga0501031_0008858 3300049568 Bacteria 6541
177 Ga0501031_0051693 3300049568 Bacteria 2677
178 Ga0501031_0106866 3300049568 Bacteria 1827
179 Ga0501031_0410769 3300049568 Bacteria 875
180 Ga0501032_0000449 3300049569 Bacteria 33607
181 Ga0501032_0014045 3300049569 Bacteria 5681
182 Ga0501032_0021653 3300049569 Bacteria 4467
183 Ga0501033_0000210 3300049570 Bacteria 55950
184 Ga0501033_0010301 3300049570 Bacteria 7175
185 Ga0501033_0015375 3300049570 Bacteria 5806
186 Ga0501033_0164382 3300049570 Bacteria 1596
187 Ga0501034_0012758 3300049571 Bacteria 8666
188 Ga0501034_0023202 3300049571 Bacteria 6322
189 Ga0501034_0086440 3300049571 Bacteria 3136
190 Ga0501034_0133845 3300049571 Bacteria 2461
191 Ga0501034_0190063 3300049571 Bacteria 2016
192 Ga0501034_0197098 3300049571 Bacteria 1973
193 Ga0501034_0422919 3300049571 Bacteria 1253
194 Ga0501034_1257694 3300049571 Unclassified 618
195 Ga0501036_0001261 3300049572 Bacteria 19388
196 Ga0501036_0006744 3300049572 Bacteria 9334
197 Ga0501036_0078759 3300049572 Bacteria 2787
198 Ga0501036_0082683 3300049572 Bacteria 2714
199 Ga0501036_1565440 3300049572 Bacteria 533
200 Ga0501037_0001265 3300049573 Bacteria 18630
201 Ga0501037_0009098 3300049573 Bacteria 7277
202 Ga0501037_0073957 3300049573 Bacteria 2477
203 Ga0501037_0087461 3300049573 Bacteria 2255
204 Ga0501037_0087556 3300049573 Bacteria 2254
205 Ga0501037_0243060 3300049573 Bacteria 1261
206 Ga0501038_0012053 3300049574 Bacteria 7894
207 Ga0501038_0025188 3300049574 Bacteria 5304
208 Ga0501038_0033414 3300049574 Bacteria 4532
209 Ga0501038_0078470 3300049574 Bacteria 2786
210 Ga0501038_0202925 3300049574 Bacteria 1590
211 Ga0501039_0012139 3300049575 Bacteria 6568
212 Ga0501039_0040893 3300049575 Bacteria 3579
213 Ga0501039_0136827 3300049575 Bacteria 1924
214 Ga0501039_0974349 3300049575 Bacteria 659
215 Ga0501040_0393428 3300049576 Bacteria 995
216 Ga0501040_0552470 3300049576 Bacteria 831
217 Ga0501041_0018683 3300049577 Bacteria 4129
218 Ga0501042_0102724 3300049578 Bacteria 2056
219 Ga0501043_0003265 3300049579 Bacteria 13371
220 Ga0501043_0010090 3300049579 Bacteria 7405
221 Ga0501043_0011271 3300049579 Bacteria 6999
222 Ga0501043_0095356 3300049579 Bacteria 2338
223 Ga0501043_0344015 3300049579 Bacteria 1134
224 Ga0501046_0001788 3300049580 Bacteria 20500
225 Ga0501046_0124228 3300049580 Bacteria 1962
226 Ga0501046_0352013 3300049580 Bacteria 1069
227 Ga0501047_0003908 3300049581 Bacteria 14011
228 Ga0501047_0019087 3300049581 Bacteria 6578
229 Ga0501047_0048729 3300049581 Bacteria 4092
230 Ga0501047_0075929 3300049581 Bacteria 3234
231 Ga0501047_0286309 3300049581 Bacteria 1492
232 Ga0501047_0778912 3300049581 Bacteria 772
233 Ga0501048_0072499 3300049582 Bacteria 2431
234 Ga0501048_0176529 3300049582 Bacteria 1514
235 Ga0501067_0100311 3300049583 Bacteria 1608
236 Ga0501067_0116738 3300049583 Bacteria 1484
237 Ga0501067_0136846 3300049583 Bacteria 1364
238 Ga0501068_0203172 3300049584 Bacteria 1257
239 Ga0501068_0533931 3300049584 Bacteria 762
240 Ga0501069_0010722 3300049585 Bacteria 4860
241 Ga0501070_0033372 3300049586 Bacteria 4308
242 Ga0501070_0272044 3300049586 Bacteria 1383
243 Ga0501070_0420458 3300049586 Bacteria 1079
244 Ga0501071_0088006 3300049587 Bacteria 2279
245 Ga0501071_0212603 3300049587 Bacteria 1454
246 Ga0501072_0141380 3300049588 Bacteria 1919
247 Ga0501073_0092783 3300049589 Bacteria 2098
248 Ga0501073_0136887 3300049589 Bacteria 1697
249 Ga0501074_0081726 3300049590 Bacteria 2317
250 Ga0501074_0235462 3300049590 Bacteria 1303
251 Ga0501075_0772270 3300049591 Bacteria 731
252 Ga0501076_0021650 3300049592 Bacteria 4934
253 Ga0501079_0608621 3300049741 Bacteria 860
254 Ga0501079_0614071 3300049741 Bacteria 856
255 Ga0501080_0006955 3300049742 Bacteria 10205
256 Ga0501080_0414767 3300049742 Bacteria 1210
257 Ga0501081_0720903 3300049743 Bacteria 749
258 Ga0501035_0003814 3300049822 Bacteria 14365
259 Ga0501035_0011428 3300049822 Bacteria 8231
260 Ga0501035_0019949 3300049822 Bacteria 6158
261 Ga0501035_0066222 3300049822 Bacteria 3206
262 Ga0501035_0082022 3300049822 Bacteria 2846
263 Ga0501035_0163873 3300049822 Bacteria 1923
264 Ga0501035_0171144 3300049822 Bacteria 1876
265 Ga0501035_0291787 3300049822 Bacteria 1376
266 Ga0501044_0021500 3300049823 Bacteria 6880
267 Ga0501044_0022604 3300049823 Bacteria 6700
268 Ga0501044_0034811 3300049823 Bacteria 5279
269 Ga0501044_0053120 3300049823 Bacteria 4170
270 Ga0501044_0171575 3300049823 Bacteria 2140
271 Ga0501044_0913197 3300049823 Bacteria 752
272 Ga0501045_0017271 3300049824 Bacteria 5122
273 Ga0501045_0290051 3300049824 Bacteria 1218
274 Ga0501045_0542604 3300049824 Bacteria 863
275 nmdc:mga03683_40666_c1 3300050489 Bacteria 1908
276 nmdc:mga00v17_293908_c1 3300050491 Bacteria 1055
277 nmdc:mga0yw44_207585_c1 3300050492 Bacteria 1295
278 nmdc:mga0yw44_2583_c1 3300050492 Bacteria 7782
279 nmdc:mga0k408_3068_c1 3300050493 Bacteria 8854
280 nmdc:mga06z11_20227_c1 3300050494 Bacteria 3074
281 nmdc:mga07m45_1750_c1 3300050496 Bacteria 10003
282 nmdc:mga0qj67_1186740_c1 3300050509 Bacteria 594
283 nmdc:mga0qj67_433658_c1 3300050509 Bacteria 1059
284 nmdc:mga06r32_470031_c1 3300050510 Bacteria 1236
285 nmdc:mga0sz30_163034_c1 3300050516 Bacteria 988
286 Ga0495601_0459880 3300053077 Bacteria 823
287 Ga0500635_0011274 3300053080 Bacteria 2537
288 Ga0495595_0141413 3300053084 Bacteria 1181
289 Ga0495619_0095088 3300053085 Unclassified 2022
290 Ga0495619_0197069 3300053085 Bacteria 1394
291 Ga0500566_0323983 3300053094 Bacteria 716
292 Ga0500573_0154684 3300053140 Bacteria 1252
293 Ga0500636_0000026 3300053177 Bacteria 84046
294 Ga0500636_0104395 3300053177 Bacteria 1607
295 Ga0500636_0208573 3300053177 Bacteria 1027
296 Ga0500637_0101674 3300053178 Bacteria 1666
297 Ga0500552_001426 3300053733 Bacteria 2282
298 Ga0500596_007452 3300053735 Bacteria 1793
299 Ga0501084_0426332 3300054114 Bacteria 1121
300 Ga0501082_0000867 3300060353 Bacteria 26750
301 Ga0501082_1072617 3300060353 Bacteria 704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0344015 Ga0501043_0344015_721_1119 132
2 3300042125 Ga0450923_034025 Ga0450923_034025_159_584 141
3 3300046515 Ga0495620_0005632 Ga0495620_0005632_3581_4009 142
4 3300037312 Ga0395899_0674157 Ga0395899_0674157_138_581 147
5 3300045051 Ga0451576_0093192 Ga0451576_0093192_2475_2954 147
6 3300049591 Ga0501075_0772270 Ga0501075_0772270_264_707 147
7 iso_pu_bacteria 2855020534 2855023466 149
8 iso_pu_bacteria 643348564 643600793 149
9 iso_pu_bacteria 2898795034 2898797204 151
10 iso_pu_bacteria 2513237087 2513590016 152
11 iso_pu_bacteria 2534681786 2535486219 152
12 iso_pu_bacteria 2588253730 2588517902 152
13 iso_pu_bacteria 2842333319 2842339684 152
14 iso_pu_bacteria 2876377896 2876383520 152
15 iso_pu_bacteria 2938014810 2938017873 152
16 iso_pu_bacteria 8005658619 8005661215 152
17 iso_pu_bacteria 2513237166 2514052454 153
18 iso_pu_bacteria 2990703756 2990703875 153
19 iso_pu_bacteria 2509276033 2509445043 154
20 iso_pu_bacteria 2510461076 2510899618 154
21 iso_pu_bacteria 2513237103 2513710207 154
22 iso_pu_bacteria 2515154113 2515633666 154
23 iso_pu_bacteria 2515154114 2515642209 154
24 iso_pu_bacteria 2516653077 2517035600 154
25 iso_pu_bacteria 2582581299 2585233901 154
26 iso_pu_bacteria 2585427528 2585540398 154
27 iso_pu_bacteria 2585427593 2585838597 154
28 iso_pu_bacteria 2738541333 2739038323 154
29 iso_pu_bacteria 2802429633 2806045501 154
30 iso_pu_bacteria 2802429634 2806051694 154
31 iso_pu_bacteria 2802429635 2806061738 154
32 iso_pu_bacteria 2802429636 2806067919 154
33 iso_pu_bacteria 2802429637 2806072729 154
34 iso_pu_bacteria 2842217011 2842220626 154
35 iso_pu_bacteria 3005416602 3005419001 154
36 iso_pu_bacteria 3005445848 3005446212 154
37 iso_pu_bacteria 639633055 639648159 154
38 iso_pu_bacteria 8005570704 8005575445 154
39 iso_pu_bacteria 8057874678 8057875473 154
40 3300031824 Ga0307413_11370524 Ga0307413_113705241 155
41 3300031995 Ga0307409_100574929 Ga0307409_1005749292 155
42 3300032005 Ga0307411_10269256 Ga0307411_102692562 155
43 3300048924 Ga0496121_0306312 Ga0496121_0306312_257_724 155
44 3300049568 Ga0501031_0106866 Ga0501031_0106866_797_1264 155
45 3300049570 Ga0501033_0010301 Ga0501033_0010301_4335_4802 155
46 3300049573 Ga0501037_0073957 Ga0501037_0073957_730_1197 155
47 3300049575 Ga0501039_0974349 Ga0501039_0974349_114_581 155
48 3300049584 Ga0501068_0533931 Ga0501068_0533931_85_552 155
49 3300049589 Ga0501073_0092783 Ga0501073_0092783_1249_1716 155
50 3300049590 Ga0501074_0235462 Ga0501074_0235462_311_778 155
51 3300049822 Ga0501035_0082022 Ga0501035_0082022_1611_2078 155
52 3300049822 Ga0501035_0171144 Ga0501035_0171144_347_814 155
53 3300049823 Ga0501044_0053120 Ga0501044_0053120_3286_3753 155
54 3300003323 rootH1_10298660 rootH1_102986602 156
55 3300005343 Ga0070687_100764888 Ga0070687_1007648882 156
56 3300005539 Ga0068853_100152867 Ga0068853_1001528672 156
57 3300005548 Ga0070665_101974467 Ga0070665_1019744671 156
58 3300005718 Ga0068866_10840730 Ga0068866_108407301 156
59 3300006038 Ga0075365_10232231 Ga0075365_102322312 156
60 3300006846 Ga0075430_101316518 Ga0075430_1013165181 156
61 3300009098 Ga0105245_11506796 Ga0105245_115067961 156
62 3300009101 Ga0105247_10006054 Ga0105247_100060542 156
63 3300009148 Ga0105243_11272168 Ga0105243_112721682 156
64 3300009545 Ga0105237_10029699 Ga0105237_100296997 156
65 3300009545 Ga0105237_10671104 Ga0105237_106711042 156
66 3300013306 Ga0163162_10777229 Ga0163162_107772292 156
67 3300013308 Ga0157375_10602553 Ga0157375_106025532 156
68 3300014325 Ga0163163_11631497 Ga0163163_116314972 156
69 3300014968 Ga0157379_11821676 Ga0157379_118216761 156
70 3300025900 Ga0207710_10055088 Ga0207710_100550882 156
71 3300030521 Ga0307511_10116408 Ga0307511_101164082 156
72 3300031727 Ga0316576_10036167 Ga0316576_100361673 156
73 3300031727 Ga0316576_10416117 Ga0316576_104161172 156
74 3300031727 Ga0316576_10515581 Ga0316576_105155811 156
75 3300032005 Ga0307411_10557137 Ga0307411_105571372 156
76 3300033179 Ga0307507_10392388 Ga0307507_103923882 156
77 3300035695 Ga0373927_0024452 Ga0373927_0024452_2931_3401 156
78 3300036712 Ga0316584_0078604 Ga0316584_0078604_1364_1834 156
79 3300037068 Ga0373925_0242949 Ga0373925_0242949_589_1059 156
80 3300037418 Ga0395900_0074238 Ga0395900_0074238_1909_2379 156
81 3300037418 Ga0395900_0951970 Ga0395900_0951970_84_554 156
82 3300037471 Ga0395905_0089779 Ga0395905_0089779_1283_1753 156
83 3300037471 Ga0395905_0493581 Ga0395905_0493581_45_515 156
84 3300037471 Ga0395905_0579602 Ga0395905_0579602_301_771 156
85 3300038443 Ga0395901_0001470 Ga0395901_0001470_14905_15375 156
86 3300038443 Ga0395901_0005382 Ga0395901_0005382_10274_10744 156
87 3300041407 Ga0439447_077339 Ga0439447_077339_115_585 156
88 3300041492 Ga0451835_0651999 Ga0451835_0651999_475_945 156
89 3300041494 Ga0451837_1381965 Ga0451837_1381965_1244_1714 156
90 3300041496 Ga0451839_0062617 Ga0451839_0062617_3663_4133 156
91 3300041498 Ga0451841_1358901 Ga0451841_1358901_5354_5824 156
92 3300041501 Ga0451845_0792661 Ga0451845_0792661_693_1163 156
93 3300041505 Ga0451849_0479820 Ga0451849_0479820_586_1056 156
94 3300041507 Ga0451851_0248772 Ga0451851_0248772_5419_5889 156
95 3300041509 Ga0451843_1019230 Ga0451843_1019230_846_1316 156
96 3300041511 Ga0451855_1504608 Ga0451855_1504608_1974_2444 156
97 3300041512 Ga0451853_0315672 Ga0451853_0315672_5354_5824 156
98 3300045051 Ga0451576_0023966 Ga0451576_0023966_5760_6230 156
99 3300046459 Ga0495629_0021947 Ga0495629_0021947_265_735 156
100 3300046459 Ga0495629_0039562 Ga0495629_0039562_2156_2626 156
101 3300046462 Ga0495651_0077740 Ga0495651_0077740_1107_1577 156
102 3300046463 Ga0495653_0015935 Ga0495653_0015935_2325_2795 156
103 3300046492 Ga0495585_0009899 Ga0495585_0009899_407_877 156
104 3300046506 Ga0495583_0002232 Ga0495583_0002232_6209_6679 156
105 3300046511 Ga0495608_0243000 Ga0495608_0243000_587_1057 156
106 3300046513 Ga0495616_0408971 Ga0495616_0408971_11_481 156
107 3300046516 Ga0495628_0084052 Ga0495628_0084052_862_1332 156
108 3300046517 Ga0495630_0022258 Ga0495630_0022258_3448_3918 156
109 3300046520 Ga0495637_0126706 Ga0495637_0126706_477_947 156
110 3300046522 Ga0495643_0002298 Ga0495643_0002298_7729_8199 156
111 3300046526 Ga0495666_0007740 Ga0495666_0007740_2503_2973 156
112 3300046531 Ga0495665_0103808 Ga0495665_0103808_855_1325 156
113 3300046558 Ga0495633_0021329 Ga0495633_0021329_1266_1736 156
114 3300046642 Ga0495634_0478297 Ga0495634_0478297_238_708 156
115 3300046660 Ga0495625_0004269 Ga0495625_0004269_6498_6968 156
116 3300046660 Ga0495625_0011725 Ga0495625_0011725_5079_5549 156
117 3300046663 Ga0495635_0457318 Ga0495635_0457318_263_733 156
118 3300046678 Ga0495599_0017349 Ga0495599_0017349_1818_2288 156
119 3300046679 Ga0495623_0005649 Ga0495623_0005649_3668_4138 156
120 3300046690 Ga0495624_0000383 Ga0495624_0000383_9031_9501 156
121 3300046690 Ga0495624_0478808 Ga0495624_0478808_257_727 156
122 3300046691 Ga0495670_0183865 Ga0495670_0183865_114_584 156
123 3300046809 Ga0495600_0475280 Ga0495600_0475280_35_505 156
124 3300047317 Ga0495604_0025383 Ga0495604_0025383_3985_4455 156
125 3300047319 Ga0495674_0230620 Ga0495674_0230620_1011_1481 156
126 3300047322 Ga0495680_0071061 Ga0495680_0071061_1178_1648 156
127 3300047443 Ga0495687_016620 Ga0495687_016620_313_783 156
128 3300047444 Ga0495675_0017777 Ga0495675_0017777_3754_4224 156
129 3300047444 Ga0495675_0558100 Ga0495675_0558100_63_533 156
130 3300047469 Ga0495673_0300364 Ga0495673_0300364_90_560 156
131 3300047471 Ga0495684_0068066 Ga0495684_0068066_19_489 156
132 3300047471 Ga0495684_0718392 Ga0495684_0718392_176_646 156
133 3300047673 Ga0495593_0162280 Ga0495593_0162280_393_863 156
134 3300048088 Ga0495602_0027230 Ga0495602_0027230_3833_4303 156
135 3300048088 Ga0495602_0057891 Ga0495602_0057891_1729_2199 156
136 3300048905 Ga0496102_0763888 Ga0496102_0763888_373_843 156
137 3300048908 Ga0496105_0019049 Ga0496105_0019049_2809_3279 156
138 3300048911 Ga0496108_0977972 Ga0496108_0977972_39_509 156
139 3300048921 Ga0496118_0399178 Ga0496118_0399178_65_535 156
140 3300048922 Ga0496119_0203010 Ga0496119_0203010_490_960 156
141 3300048924 Ga0496121_0073804 Ga0496121_0073804_1789_2259 156
142 3300048927 Ga0496124_0023705 Ga0496124_0023705_3677_4147 156
143 3300048928 Ga0496125_0211010 Ga0496125_0211010_333_803 156
144 3300048929 Ga0496126_0333096 Ga0496126_0333096_35_505 156
145 3300049568 Ga0501031_0008858 Ga0501031_0008858_2617_3087 156
146 3300049568 Ga0501031_0051693 Ga0501031_0051693_409_879 156
147 3300049568 Ga0501031_0410769 Ga0501031_0410769_62_538 156
148 3300049569 Ga0501032_0000449 Ga0501032_0000449_2695_3171 156
149 3300049569 Ga0501032_0014045 Ga0501032_0014045_3661_4131 156
150 3300049569 Ga0501032_0021653 Ga0501032_0021653_751_1221 156
151 3300049570 Ga0501033_0015375 Ga0501033_0015375_4671_5147 156
152 3300049570 Ga0501033_0164382 Ga0501033_0164382_448_918 156
153 3300049571 Ga0501034_0023202 Ga0501034_0023202_324_800 156
154 3300049571 Ga0501034_0086440 Ga0501034_0086440_2376_2846 156
155 3300049571 Ga0501034_0133845 Ga0501034_0133845_1131_1607 156
156 3300049571 Ga0501034_0190063 Ga0501034_0190063_1028_1498 156
157 3300049571 Ga0501034_0422919 Ga0501034_0422919_357_827 156
158 3300049571 Ga0501034_1257694 Ga0501034_1257694_79_549 156
159 3300049572 Ga0501036_0001261 Ga0501036_0001261_12895_13371 156
160 3300049572 Ga0501036_0006744 Ga0501036_0006744_3231_3701 156
161 3300049572 Ga0501036_0082683 Ga0501036_0082683_1909_2379 156
162 3300049572 Ga0501036_1565440 Ga0501036_1565440_29_499 156
163 3300049573 Ga0501037_0001265 Ga0501037_0001265_17645_18121 156
164 3300049573 Ga0501037_0009098 Ga0501037_0009098_4890_5360 156
165 3300049573 Ga0501037_0087461 Ga0501037_0087461_887_1363 156
166 3300049573 Ga0501037_0087556 Ga0501037_0087556_563_1033 156
167 3300049573 Ga0501037_0243060 Ga0501037_0243060_77_547 156
168 3300049574 Ga0501038_0012053 Ga0501038_0012053_4998_5474 156
169 3300049574 Ga0501038_0025188 Ga0501038_0025188_2861_3331 156
170 3300049574 Ga0501038_0033414 Ga0501038_0033414_2874_3344 156
171 3300049574 Ga0501038_0078470 Ga0501038_0078470_747_1217 156
172 3300049574 Ga0501038_0202925 Ga0501038_0202925_968_1438 156
173 3300049575 Ga0501039_0012139 Ga0501039_0012139_4340_4810 156
174 3300049575 Ga0501039_0136827 Ga0501039_0136827_764_1234 156
175 3300049576 Ga0501040_0393428 Ga0501040_0393428_41_511 156
176 3300049576 Ga0501040_0552470 Ga0501040_0552470_65_535 156
177 3300049577 Ga0501041_0018683 Ga0501041_0018683_301_771 156
178 3300049578 Ga0501042_0102724 Ga0501042_0102724_895_1365 156
179 3300049579 Ga0501043_0003265 Ga0501043_0003265_7234_7710 156
180 3300049579 Ga0501043_0010090 Ga0501043_0010090_4890_5360 156
181 3300049579 Ga0501043_0011271 Ga0501043_0011271_1464_1934 156
182 3300049579 Ga0501043_0095356 Ga0501043_0095356_665_1135 156
183 3300049580 Ga0501046_0001788 Ga0501046_0001788_17708_18184 156
184 3300049580 Ga0501046_0124228 Ga0501046_0124228_635_1105 156
185 3300049580 Ga0501046_0352013 Ga0501046_0352013_516_986 156
186 3300049581 Ga0501047_0003908 Ga0501047_0003908_510_986 156
187 3300049581 Ga0501047_0019087 Ga0501047_0019087_637_1107 156
188 3300049581 Ga0501047_0048729 Ga0501047_0048729_847_1317 156
189 3300049581 Ga0501047_0778912 Ga0501047_0778912_13_483 156
190 3300049582 Ga0501048_0072499 Ga0501048_0072499_1782_2252 156
191 3300049582 Ga0501048_0176529 Ga0501048_0176529_973_1443 156
192 3300049583 Ga0501067_0100311 Ga0501067_0100311_805_1275 156
193 3300049583 Ga0501067_0116738 Ga0501067_0116738_989_1459 156
194 3300049583 Ga0501067_0136846 Ga0501067_0136846_713_1183 156
195 3300049584 Ga0501068_0203172 Ga0501068_0203172_336_806 156
196 3300049585 Ga0501069_0010722 Ga0501069_0010722_4002_4472 156
197 3300049586 Ga0501070_0033372 Ga0501070_0033372_299_769 156
198 3300049586 Ga0501070_0272044 Ga0501070_0272044_520_990 156
199 3300049586 Ga0501070_0420458 Ga0501070_0420458_245_715 156
200 3300049587 Ga0501071_0088006 Ga0501071_0088006_700_1170 156
201 3300049587 Ga0501071_0212603 Ga0501071_0212603_783_1253 156
202 3300049588 Ga0501072_0141380 Ga0501072_0141380_125_595 156
203 3300049589 Ga0501073_0136887 Ga0501073_0136887_839_1309 156
204 3300049590 Ga0501074_0081726 Ga0501074_0081726_1654_2124 156
205 3300049592 Ga0501076_0021650 Ga0501076_0021650_1996_2466 156
206 3300049741 Ga0501079_0608621 Ga0501079_0608621_173_643 156
207 3300049741 Ga0501079_0614071 Ga0501079_0614071_327_797 156
208 3300049742 Ga0501080_0006955 Ga0501080_0006955_1674_2144 156
209 3300049742 Ga0501080_0414767 Ga0501080_0414767_171_641 156
210 3300049743 Ga0501081_0720903 Ga0501081_0720903_256_726 156
211 3300049822 Ga0501035_0011428 Ga0501035_0011428_252_722 156
212 3300049822 Ga0501035_0019949 Ga0501035_0019949_600_1076 156
213 3300049822 Ga0501035_0066222 Ga0501035_0066222_284_754 156
214 3300049822 Ga0501035_0163873 Ga0501035_0163873_1163_1633 156
215 3300049822 Ga0501035_0291787 Ga0501035_0291787_155_625 156
216 3300049823 Ga0501044_0021500 Ga0501044_0021500_3126_3596 156
217 3300049823 Ga0501044_0022604 Ga0501044_0022604_1554_2030 156
218 3300049823 Ga0501044_0034811 Ga0501044_0034811_935_1405 156
219 3300049823 Ga0501044_0171575 Ga0501044_0171575_1019_1489 156
220 3300049823 Ga0501044_0913197 Ga0501044_0913197_70_540 156
221 3300049824 Ga0501045_0017271 Ga0501045_0017271_3180_3650 156
222 3300049824 Ga0501045_0290051 Ga0501045_0290051_702_1172 156
223 3300049824 Ga0501045_0542604 Ga0501045_0542604_222_692 156
224 3300050489 nmdc:mga03683_40666_c1 nmdc:mga03683_40666_c1_1236_1706 156
225 3300050491 nmdc:mga00v17_293908_c1 nmdc:mga00v17_293908_c1_508_978 156
226 3300050492 nmdc:mga0yw44_207585_c1 nmdc:mga0yw44_207585_c1_327_797 156
227 3300050492 nmdc:mga0yw44_2583_c1 nmdc:mga0yw44_2583_c1_1012_1482 156
228 3300050493 nmdc:mga0k408_3068_c1 nmdc:mga0k408_3068_c1_5632_6102 156
229 3300050494 nmdc:mga06z11_20227_c1 nmdc:mga06z11_20227_c1_2216_2686 156
230 3300050496 nmdc:mga07m45_1750_c1 nmdc:mga07m45_1750_c1_3302_3772 156
231 3300050509 nmdc:mga0qj67_1186740_c1 nmdc:mga0qj67_1186740_c1_17_487 156
232 3300050509 nmdc:mga0qj67_433658_c1 nmdc:mga0qj67_433658_c1_479_949 156
233 3300050516 nmdc:mga0sz30_163034_c1 nmdc:mga0sz30_163034_c1_203_673 156
234 3300053080 Ga0500635_0011274 Ga0500635_0011274_1291_1761 156
235 3300053085 Ga0495619_0095088 Ga0495619_0095088_847_1317 156
236 3300053094 Ga0500566_0323983 Ga0500566_0323983_205_675 156
237 3300053140 Ga0500573_0154684 Ga0500573_0154684_118_588 156
238 3300053177 Ga0500636_0000026 Ga0500636_0000026_26636_27106 156
239 3300053177 Ga0500636_0104395 Ga0500636_0104395_183_653 156
240 3300053177 Ga0500636_0208573 Ga0500636_0208573_536_1006 156
241 3300053178 Ga0500637_0101674 Ga0500637_0101674_496_966 156
242 3300053733 Ga0500552_001426 Ga0500552_001426_830_1300 156
243 3300053735 Ga0500596_007452 Ga0500596_007452_618_1088 156
244 3300054114 Ga0501084_0426332 Ga0501084_0426332_607_1077 156
245 3300060353 Ga0501082_1072617 Ga0501082_1072617_161_631 156
246 3300003322 rootL2_10028947 rootL2_100289477 157
247 3300025304 Ga0209257_1001365 Ga0209257_10013657 157
248 3300027471 Ga0209995_1012963 Ga0209995_10129632 157
249 3300027682 Ga0209971_1016482 Ga0209971_10164822 157
250 3300031235 Ga0265330_10000332 Ga0265330_1000033223 157
251 3300031238 Ga0265332_10000008 Ga0265332_10000008167 157
252 3300031240 Ga0265320_10029148 Ga0265320_100291482 157
253 3300031241 Ga0265325_10002673 Ga0265325_100026737 157
254 3300031711 Ga0265314_10000156 Ga0265314_1000015623 157
255 3300031712 Ga0265342_10122711 Ga0265342_101227112 157
256 3300044712 Ga0453684_1358577 Ga0453684_1358577_42_518 157
257 3300045051 Ga0451576_0036823 Ga0451576_0036823_2655_3131 157
258 3300046462 Ga0495651_0054475 Ga0495651_0054475_2381_2854 157
259 3300047444 Ga0495675_0058310 Ga0495675_0058310_1429_1902 157
260 3300048088 Ga0495602_0131814 Ga0495602_0131814_185_658 157
261 3300048925 Ga0496122_0001031 Ga0496122_0001031_13423_13896 157
262 3300048926 Ga0496123_0005552 Ga0496123_0005552_830_1303 157
263 3300002704 JGI25155J39150_1000326 JGI25155J39150_100032619 158
264 3300002705 JGI25156J39149_1000798 JGI25156J39149_100079820 158
265 3300002738 JGI25154J39366_1000656 JGI25154J39366_10006564 158
266 3300002741 JGI25157J39369_1000790 JGI25157J39369_100079020 158
267 3300002773 JGI25152J39213_1000605 JGI25152J39213_100060521 158
268 3300003187 JGI25151J46595_10000238 JGI25151J46595_1000023826 158
269 3300003187 JGI25151J46595_10080758 JGI25151J46595_100807582 158
270 3300003215 JGI25153J46596_10000797 JGI25153J46596_100007974 158
271 3300003215 JGI25153J46596_10003297 JGI25153J46596_1000329711 158
272 3300003354 JGI25160J50197_1008053 JGI25160J50197_10080532 158
273 3300003771 Ga0055526_1004821 Ga0055526_10048216 158
274 3300003771 Ga0055526_1008521 Ga0055526_10085212 158
275 3300003775 Ga0055524_1002622 Ga0055524_10026226 158
276 3300003775 Ga0055524_1059376 Ga0055524_10593761 158
277 3300003790 Ga0055528_1003145 Ga0055528_10031457 158
278 3300003790 Ga0055528_1055480 Ga0055528_10554802 158
279 3300003792 Ga0055540_1021226 Ga0055540_10212262 158
280 3300004625 Ga0055543_1002290 Ga0055543_10022903 158
281 3300005262 Ga0065165_1010942 Ga0065165_10109422 158
282 3300006038 Ga0075365_10043773 Ga0075365_100437734 158
283 3300006048 Ga0075363_100040979 Ga0075363_1000409792 158
284 3300006177 Ga0075362_10001346 Ga0075362_100013466 158
285 3300006178 Ga0075367_10000445 Ga0075367_100004457 158
286 3300006186 Ga0075369_10002484 Ga0075369_100024842 158
287 3300006353 Ga0075370_10004448 Ga0075370_100044486 158
288 3300025206 Ga0209435_100023 Ga0209435_1000234 158
289 3300025245 Ga0207425_1001236 Ga0207425_100123612 158
290 3300025245 Ga0207425_1014131 Ga0207425_10141312 158
291 3300025246 Ga0209646_1000080 Ga0209646_10000804 158
292 3300025250 Ga0209026_1000076 Ga0209026_10000764 158
293 3300025256 Ga0209759_1000059 Ga0209759_10000594 158
294 3300025258 Ga0209129_1000739 Ga0209129_10007397 158
295 3300025258 Ga0209129_1001036 Ga0209129_100103610 158
296 3300025273 Ga0209673_1001623 Ga0209673_10016238 158
297 3300025273 Ga0209673_1002481 Ga0209673_10024816 158
298 3300025273 Ga0209673_1003767 Ga0209673_10037676 158
299 3300025292 Ga0209676_1039415 Ga0209676_10394152 158
300 3300025294 Ga0209025_1000237 Ga0209025_100023753 158
301 3300025294 Ga0209025_1001909 Ga0209025_100190927 158
302 3300025295 Ga0209564_1000868 Ga0209564_100086838 158
303 3300025295 Ga0209564_1001116 Ga0209564_10011166 158
304 3300025297 Ga0209758_1000545 Ga0209758_100054547 158
305 3300025297 Ga0209758_1001607 Ga0209758_100160730 158
306 3300025299 Ga0209256_1000327 Ga0209256_100032773 158
307 3300025299 Ga0209256_1002985 Ga0209256_10029851 158
308 3300025299 Ga0209256_1009087 Ga0209256_10090875 158
309 3300025302 Ga0207426_1000302 Ga0207426_100030245 158
310 3300025302 Ga0207426_1003541 Ga0207426_10035417 158
311 3300025303 Ga0209051_1001031 Ga0209051_100103125 158
312 3300037312 Ga0395899_0000059 Ga0395899_0000059_28864_29400 158
313 3300037418 Ga0395900_0000017 Ga0395900_0000017_28864_29400 158
314 3300037466 Ga0395898_0000030 Ga0395898_0000030_28839_29375 158
315 3300037471 Ga0395905_0000056 Ga0395905_0000056_179831_180367 158
316 3300038443 Ga0395901_0000015 Ga0395901_0000015_340203_340739 158
317 3300046533 Ga0495640_0226939 Ga0495640_0226939_27_527 158
318 3300046535 Ga0495586_0608612 Ga0495586_0608612_78_578 158
319 3300046559 Ga0495667_0572217 Ga0495667_0572217_118_618 158
320 3300046809 Ga0495600_0365098 Ga0495600_0365098_91_591 158
321 3300047444 Ga0495675_0215755 Ga0495675_0215755_75_575 158
322 3300049570 Ga0501033_0000210 Ga0501033_0000210_29585_30061 158
323 3300049571 Ga0501034_0012758 Ga0501034_0012758_2456_2992 158
324 3300049571 Ga0501034_0197098 Ga0501034_0197098_834_1421 158
325 3300049572 Ga0501036_0078759 Ga0501036_0078759_1102_1683 158
326 3300049575 Ga0501039_0040893 Ga0501039_0040893_2879_3466 158
327 3300049581 Ga0501047_0075929 Ga0501047_0075929_910_1497 158
328 3300049581 Ga0501047_0286309 Ga0501047_0286309_338_871 158
329 3300049822 Ga0501035_0003814 Ga0501035_0003814_7750_8226 158
330 3300050510 nmdc:mga06r32_470031_c1 nmdc:mga06r32_470031_c1_93_626 158
331 3300053077 Ga0495601_0459880 Ga0495601_0459880_224_724 158
332 3300053084 Ga0495595_0141413 Ga0495595_0141413_287_787 158
333 3300053085 Ga0495619_0197069 Ga0495619_0197069_493_993 158
334 3300060353 Ga0501082_0000867 Ga0501082_0000867_16815_17297 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10029

DUF2271

Predicted periplasmic protein (DUF2271)

56

184

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vsw-assembly4.cif.gz_M crystal structure of a fab-like fragment of anti-mesothelin antibody 0.6759 98 137
4wi6-assembly1.cif.gz_B structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation n434a 0.6727 98 137
6ifj-assembly1.cif.gz_A structure of bispecific fc 0.6725 98 137
1cqk-assembly1.cif.gz_B crystal structure of the ch3 domain from the mak33 antibody 0.6725 98 134
6wna-assembly1.cif.gz_H next generation monomeric igg4 fc 0.6548 98 137
ID Description Score Start End Superfamily
2w59B02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6746 98 135 2.60.40.10
af_Q8BJ95_345_443_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6469 23 139 2.60.40.10
af_B0CLV3_130_228_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6291 98 137 2.60.40.10
af_Q08189_594_692_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.626 25 137 2.60.40.10
af_P0DKG4_3_138_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.6154 29 62 2.60.210.10
ID Description Score Start End GO Terms
AF-A0A2M9PAZ3-F1-model_v4 DUF2271 domain-containing protein 0.949 10 158
AF-A0A509MT37-F1-model_v4 deleted 0.9337 20 157
AF-A0A2M9PAZ3-F1-model_v4 DUF2271 domain-containing protein 0.9304 10 158
AF-A0A3C1KT28-F1-model_v4 DUF2271 domain-containing protein 0.9195 18 158
AF-A0A7C6JGZ4-F1-model_v4 DUF2271 domain-containing protein 0.9166 18 158

Feature Viewer

pLDDT pTM Quality
76.85 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map