F411746

General Info

Members Datasets Scaffolds Average Seq Length
334 262 297 235

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000169|Ga0079104_100016983
Length 240
Sequence MTPQNPLSAFSVTRKWPATQPDRIQLYSLPTPNGVKVSIALEEMGLPYEAHRVGFESNDQLSPEFVDTFPNNKIPAILDPQGPGGKPLALFESGAILVYLAEKSGSPLLPADPAARYETLQWLMFQMGGVGPMFGQLGFFHKFAGKDFEDKRPRDRYVNESVRLLGVLERRLAGRAWVMGEQFTIADIALWPWVRNMVVEQGYNAAELLGWERFPELQRVLAAFVARPAVQKGLVTPPRN

Samples

Sample ID Description Type Environment
1 2519103095 Burkholderia sp. KJ006 Isolate Nodule
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
10 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
11 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
12 2721755523 Delftia sp. HK171 Isolate Unclassified
13 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
14 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
15 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
16 2818991436 Collimonas arenae 515 Isolate Unclassified
17 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
18 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
19 2885198086 Variovorax sp. 679 Isolate Unclassified
20 2885211737 Variovorax sp. 553 Isolate Unclassified
21 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
22 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
23 2899924645 Variovorax sp. 369 Isolate Unclassified
24 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
25 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
26 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
27 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
28 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
29 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
30 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
31 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
32 2928070936 Variovorax gossypii 1167 Isolate Unclassified
33 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
34 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
35 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
45 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
46 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
55 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
56 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
167 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
191 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
192 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
193 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
194 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
195 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
196 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
245 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
248 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
249 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
250 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
251 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
254 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
261 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
262 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.92
Metatranscriptomes 0
Isolates 11.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.45
Nodule 0.9
Rhizoplane 2.4
Rhizosphere 61.98
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1003108 3300002739 Bacteria 2610
2 JGI25152J39213_1007777 3300002773 Bacteria 2738
3 JGI25150J39212_1001480 3300002774 Bacteria 6539
4 JGI25159J45721_1006034 3300002987 Bacteria 3693
5 JGI25159J45721_1008789 3300002987 Bacteria 2738
6 JGI25151J46595_10021034 3300003187 Bacteria 2738
7 JGI25153J46596_10018211 3300003215 Bacteria 2738
8 rootL2_10003345 3300003322 Bacteria 38796
9 JGI25160J50197_1004678 3300003354 Bacteria 5868
10 JGI25160J50197_1013786 3300003354 Bacteria 2738
11 JGI25161J50226_1003223 3300003374 Bacteria 3825
12 JGI25161J50226_1004919 3300003374 Bacteria 2710
13 Ga0055538_1000002 3300003751 Bacteria 999437
14 Ga0055539_1000002 3300003752 Bacteria 999437
15 Ga0055533_1000004 3300003756 Bacteria 999437
16 Ga0055525_1000002 3300003759 Bacteria 999437
17 Ga0055535_1000086 3300003761 Bacteria 104327
18 Ga0055542_1000009 3300003762 Bacteria 416550
19 Ga0055526_1001737 3300003771 Bacteria 15134
20 Ga0055526_1003526 3300003771 Bacteria 9883
21 Ga0055526_1017458 3300003771 Bacteria 2738
22 Ga0055537_1007131 3300003773 Bacteria 2738
23 Ga0055537_1011806 3300003773 Bacteria 1746
24 Ga0055524_1003367 3300003775 Bacteria 7788
25 Ga0055524_1005178 3300003775 Bacteria 5873
26 Ga0055524_1015786 3300003775 Bacteria 2738
27 Ga0055534_1007049 3300003784 Bacteria 2738
28 Ga0055534_1007116 3300003784 Bacteria 2720
29 Ga0055528_1015583 3300003790 Bacteria 2738
30 Ga0055530_10000151 3300003791 Bacteria 62528
31 Ga0055540_1010260 3300003792 Bacteria 3130
32 Ga0055531_10025428 3300003794 Bacteria 2151
33 Ga0055541_1000002 3300003841 Bacteria 896405
34 Ga0055543_1003275 3300004625 Bacteria 4876
35 Ga0070658_10054253 3300005327 Bacteria 3255
36 Ga0068869_100295635 3300005334 Bacteria 1306
37 Ga0070680_100001999 3300005336 Bacteria 15008
38 Ga0070680_100082311 3300005336 Bacteria 2656
39 Ga0070682_100014282 3300005337 Bacteria 4587
40 Ga0070668_100088094 3300005347 Bacteria 2443
41 Ga0070675_100004547 3300005354 Bacteria 10590
42 Ga0070671_100049072 3300005355 Bacteria 3512
43 Ga0070674_100441513 3300005356 Bacteria 1072
44 Ga0070667_100362998 3300005367 Bacteria 1313
45 Ga0070711_100049599 3300005439 Bacteria 2875
46 Ga0070678_100385773 3300005456 Bacteria 1213
47 Ga0070662_100108967 3300005457 Bacteria 2107
48 Ga0070681_10000929 3300005458 Bacteria 24674
49 Ga0070681_10121454 3300005458 Bacteria 2547
50 Ga0068867_100003166 3300005459 Bacteria 11604
51 Ga0070679_100005197 3300005530 Bacteria 12043
52 Ga0070679_100089678 3300005530 Bacteria 3062
53 Ga0070679_100111187 3300005530 Bacteria 2726
54 Ga0070672_100024014 3300005543 Bacteria 4498
55 Ga0070672_100052425 3300005543 Bacteria 3185
56 Ga0068855_100000055 3300005563 Bacteria 136099
57 Ga0068855_100000865 3300005563 Bacteria 37618
58 Ga0068855_100242461 3300005563 Bacteria 2013
59 Ga0068854_100010934 3300005578 Bacteria 5888
60 Ga0068854_100216714 3300005578 Bacteria 1512
61 Ga0068866_10006625 3300005718 Bacteria 4830
62 Ga0068861_100011807 3300005719 Bacteria 6078
63 Ga0068851_10045141 3300005834 Bacteria 2226
64 Ga0068863_100186629 3300005841 Bacteria 1992
65 Ga0068858_100070379 3300005842 Bacteria 3243
66 Ga0068860_100000693 3300005843 Bacteria 38695
67 Ga0068860_100149314 3300005843 Bacteria 2250
68 Ga0068862_100000949 3300005844 Bacteria 27913
69 Ga0070712_100309208 3300006175 Bacteria 1282
70 Ga0075366_10199220 3300006195 Bacteria 1217
71 Ga0097621_100027990 3300006237 Bacteria 4437
72 Ga0068871_100015407 3300006358 Bacteria 5721
73 Ga0079104_1000169 3300006946 Bacteria 93356
74 Ga0105250_10000066 3300009092 Bacteria 100012
75 Ga0105240_10132287 3300009093 Bacteria 2991
76 Ga0105245_10124707 3300009098 Bacteria 2409
77 Ga0105238_10006383 3300009551 Bacteria 11731
78 Ga0105249_10038028 3300009553 Bacteria 4366
79 Ga0157319_1000035 3300012497 Bacteria 40594
80 Ga0157369_10126200 3300013105 Bacteria 2713
81 Ga0163162_10006385 3300013306 Bacteria 11415
82 Ga0163162_10752287 3300013306 Bacteria 1094
83 Ga0157372_10583000 3300013307 Bacteria 1303
84 Ga0157380_10149931 3300014326 Bacteria 2014
85 Ga0157379_10609277 3300014968 Bacteria 1020
86 Ga0157376_10009957 3300014969 Bacteria 6936
87 Ga0157376_10288532 3300014969 Bacteria 1548
88 Ga0182006_1003945 3300015261 Bacteria 7420
89 Ga0182006_1004751 3300015261 Bacteria 6632
90 Ga0182007_10014101 3300015262 Bacteria 3026
91 Ga0182005_1000253 3300015265 Bacteria 34070
92 Ga0183362_10009 3300015683 Bacteria 154236
93 Ga0163161_10154143 3300017792 Bacteria 1748
94 Ga0209436_104651 3300025208 Bacteria 3341
95 Ga0209436_108502 3300025208 Bacteria 2038
96 Ga0209784_100002 3300025224 Bacteria 1753105
97 Ga0209566_100003 3300025225 Bacteria 1753105
98 Ga0209674_100004 3300025226 Bacteria 1753105
99 Ga0209672_100317 3300025228 Bacteria 31877
100 Ga0209147_100379 3300025229 Bacteria 30912
101 Ga0209563_100006 3300025230 Bacteria 1753105
102 Ga0209258_100009 3300025242 Bacteria 996276
103 Ga0207425_1000050 3300025245 Bacteria 177008
104 Ga0207425_1000240 3300025245 Bacteria 42664
105 Ga0209677_100003 3300025253 Bacteria 1753105
106 Ga0209148_1000007 3300025254 Bacteria 1592273
107 Ga0209129_1000013 3300025258 Bacteria 524874
108 Ga0209565_1000239 3300025263 Bacteria 59435
109 Ga0209565_1000289 3300025263 Bacteria 48879
110 Ga0209565_1000675 3300025263 Bacteria 21500
111 Ga0209565_1001239 3300025263 Bacteria 11989
112 Ga0209673_1000188 3300025273 Bacteria 124010
113 Ga0209673_1010401 3300025273 Bacteria 3924
114 Ga0209130_1000405 3300025284 Bacteria 47098
115 Ga0209130_1002419 3300025284 Bacteria 9400
116 Ga0209675_1000086 3300025291 Bacteria 151270
117 Ga0209675_1002191 3300025291 Bacteria 10244
118 Ga0209675_1020854 3300025291 Bacteria 1762
119 Ga0209676_1014116 3300025292 Bacteria 3023
120 Ga0209025_1000381 3300025294 Bacteria 92162
121 Ga0209564_1000063 3300025295 Bacteria 318515
122 Ga0209564_1000214 3300025295 Bacteria 132937
123 Ga0209564_1001671 3300025295 Bacteria 21219
124 Ga0209564_1009729 3300025295 Bacteria 4525
125 Ga0209758_1000134 3300025297 Bacteria 178294
126 Ga0209050_1000050 3300025298 Bacteria 362578
127 Ga0209050_1000341 3300025298 Bacteria 92696
128 Ga0209256_1000060 3300025299 Bacteria 262342
129 Ga0209256_1000227 3300025299 Bacteria 103299
130 Ga0209256_1000638 3300025299 Bacteria 47804
131 Ga0209256_1029088 3300025299 Bacteria 1546
132 Ga0207426_1000100 3300025302 Bacteria 262342
133 Ga0207426_1000506 3300025302 Bacteria 57538
134 Ga0209051_1005839 3300025303 Bacteria 7081
135 Ga0209051_1028857 3300025303 Bacteria 2183
136 Ga0209257_1000075 3300025304 Bacteria 324855
137 Ga0209257_1002281 3300025304 Bacteria 19545
138 Ga0209257_1005708 3300025304 Bacteria 8545
139 Ga0207656_10013350 3300025321 Bacteria 3138
140 Ga0207696_1007489 3300025711 Bacteria 4265
141 Ga0207642_10005107 3300025899 Bacteria 4269
142 Ga0207645_10002661 3300025907 Bacteria 13901
143 Ga0207645_10335895 3300025907 Bacteria 1009
144 Ga0207707_10001482 3300025912 Bacteria 21707
145 Ga0207707_10036620 3300025912 Bacteria 4289
146 Ga0207707_10157694 3300025912 Bacteria 1984
147 Ga0207695_10004893 3300025913 Bacteria 18051
148 Ga0207695_10013254 3300025913 Bacteria 9837
149 Ga0207671_10082478 3300025914 Bacteria 2413
150 Ga0207693_10186227 3300025915 Bacteria 1634
151 Ga0207663_10136768 3300025916 Bacteria 1701
152 Ga0207660_10006475 3300025917 Bacteria 7596
153 Ga0207660_10149287 3300025917 Bacteria 1794
154 Ga0207652_10000219 3300025921 Bacteria 60625
155 Ga0207652_10114222 3300025921 Bacteria 2397
156 Ga0207694_10004375 3300025924 Bacteria 11031
157 Ga0207694_10020925 3300025924 Bacteria 4953
158 Ga0207650_10001866 3300025925 Bacteria 14867
159 Ga0207659_10008345 3300025926 Bacteria 6425
160 Ga0207700_10653368 3300025928 Bacteria 938
161 Ga0207644_10107836 3300025931 Bacteria 2102
162 Ga0207644_10167584 3300025931 Bacteria 1712
163 Ga0207709_10000783 3300025935 Bacteria 24875
164 Ga0207709_10182399 3300025935 Bacteria 1484
165 Ga0207669_10252057 3300025937 Bacteria 1315
166 Ga0207691_10005757 3300025940 Bacteria 11991
167 Ga0207691_10051423 3300025940 Bacteria 3767
168 Ga0207689_10061319 3300025942 Bacteria 3093
169 Ga0207667_10000032 3300025949 Bacteria 322253
170 Ga0207667_10025104 3300025949 Bacteria 6531
171 Ga0207667_10422861 3300025949 Bacteria 1355
172 Ga0207651_10282622 3300025960 Bacteria 1372
173 Ga0207712_10076935 3300025961 Bacteria 2417
174 Ga0207668_10043841 3300025972 Bacteria 3039
175 Ga0207640_10120658 3300025981 Bacteria 1877
176 Ga0207640_10262466 3300025981 Bacteria 1347
177 Ga0207640_10371950 3300025981 Bacteria 1155
178 Ga0207703_10222191 3300026035 Bacteria 1689
179 Ga0207708_10642670 3300026075 Bacteria 902
180 Ga0207641_10123257 3300026088 Bacteria 2316
181 Ga0207648_10001076 3300026089 Bacteria 30578
182 Ga0207648_10003056 3300026089 Bacteria 17699
183 Ga0207676_10003225 3300026095 Bacteria 11629
184 Ga0207674_10206290 3300026116 Bacteria 1915
185 Ga0207675_100000617 3300026118 Bacteria 34769
186 Ga0207683_10026541 3300026121 Bacteria 4999
187 Ga0207683_10340601 3300026121 Bacteria 1375
188 Ga0207683_10498166 3300026121 Bacteria 1125
189 Ga0207698_10211786 3300026142 Bacteria 1744
190 Ga0209281_1000002 3300027111 Bacteria 1924012
191 Ga0209371_1019549 3300027312 Bacteria 1686
192 Ga0268265_10036876 3300028380 Bacteria 3584
193 Ga0268264_10002164 3300028381 Bacteria 17517
194 Ga0268264_10148824 3300028381 Bacteria 2097
195 Ga0307515_10000030 3300028794 Bacteria 364482
196 Ga0265338_10000037 3300028800 Bacteria 237244
197 Ga0265338_10010664 3300028800 Bacteria 10738
198 Ga0268256_1012630 3300030500 Bacteria 2601
199 Ga0265332_10000023 3300031238 Bacteria 211994
200 Ga0265328_10082661 3300031239 Bacteria 1184
201 Ga0265329_10023253 3300031242 Bacteria 2066
202 Ga0265331_10108421 3300031250 Bacteria 1275
203 Ga0307509_10000115 3300031507 Bacteria 116444
204 Ga0307509_10006531 3300031507 Bacteria 15634
205 Ga0307408_100000149 3300031548 Bacteria 77683
206 Ga0307408_100000382 3300031548 Bacteria 40475
207 Ga0307408_100063022 3300031548 Bacteria 2711
208 Ga0307408_100083589 3300031548 Bacteria 2393
209 Ga0307408_100548705 3300031548 Bacteria 1019
210 Ga0307516_10111676 3300031730 Bacteria 2535
211 Ga0307412_10040490 3300031911 Bacteria 3014
212 Ga0307416_101103463 3300032002 Bacteria 898
213 Ga0395900_0000025 3300037418 Bacteria 321217
214 Ga0395900_0125067 3300037418 Bacteria 2637
215 Ga0395898_0000949 3300037466 Bacteria 46173
216 Ga0395905_0013568 3300037471 Bacteria 7806
217 Ga0395901_0251701 3300038443 Bacteria 1840
218 Ga0439461_0021215 3300041410 Bacteria 1293
219 Ga0439465_0150557 3300041413 Bacteria 831
220 Ga0439437_003436 3300042000 Bacteria 1707
221 Ga0439445_0074335 3300042004 Bacteria 944
222 Ga0450911_000002 3300042115 Bacteria 277703
223 Ga0450914_001263 3300042118 Bacteria 1538
224 Ga0450888_000113 3300042126 Bacteria 6428
225 Ga0450890_000740 3300042127 Bacteria 4743
226 Ga0450891_000408 3300042129 Bacteria 4499
227 Ga0450892_001386 3300042130 Bacteria 2390
228 Ga0450916_003002 3300042530 Bacteria 1830
229 Ga0450893_0002928 3300042532 Bacteria 2686
230 Ga0451577_0001497 3300042876 Bacteria 30912
231 Ga0451577_0019144 3300042876 Bacteria 6297
232 Ga0466969_0027496 3300044656 Bacteria 2913
233 Ga0466972_0030561 3300044658 Bacteria 2651
234 Ga0453683_0056164 3300044673 Bacteria 2464
235 Ga0453684_0203859 3300044712 Bacteria 2303
236 Ga0466959_0020608 3300045049 Bacteria 4858
237 Ga0466959_0022784 3300045049 Bacteria 4630
238 Ga0451576_0035812 3300045051 Bacteria 5263
239 Ga0495580_0001750 3300046472 Bacteria 19089
240 Ga0495605_0100846 3300046474 Bacteria 1327
241 Ga0495596_0000293 3300046500 Bacteria 33171
242 Ga0495596_0006709 3300046500 Bacteria 5267
243 Ga0495606_0121339 3300046507 Bacteria 1564
244 Ga0495610_0003867 3300046512 Bacteria 11381
245 Ga0495616_0040217 3300046513 Bacteria 2390
246 Ga0495628_0002314 3300046516 Bacteria 17223
247 Ga0495643_0043609 3300046522 Bacteria 2440
248 Ga0495652_0267404 3300046529 Bacteria 1258
249 Ga0495654_0000083 3300046530 Bacteria 107518
250 Ga0495633_0102226 3300046558 Bacteria 1330
251 Ga0495656_0004896 3300046615 Bacteria 4610
252 Ga0495625_0161235 3300046660 Bacteria 1502
253 Ga0495657_0046280 3300046675 Bacteria 2947
254 Ga0495599_0022928 3300046678 Bacteria 3899
255 Ga0495623_0018835 3300046679 Bacteria 4457
256 Ga0495646_0011181 3300046680 Bacteria 5701
257 Ga0495669_0000035 3300046684 Bacteria 96159
258 Ga0495600_0001529 3300046809 Bacteria 12859
259 Ga0495683_0001248 3300047323 Bacteria 17248
260 Ga0495677_0011703 3300047445 Bacteria 3207
261 Ga0496102_0199717 3300048905 Bacteria 1885
262 Ga0496104_0022061 3300048907 Bacteria 5852
263 Ga0496105_0009291 3300048908 Bacteria 7685
264 Ga0496108_0075094 3300048911 Bacteria 2855
265 Ga0496112_0172995 3300048915 Bacteria 2125
266 Ga0496117_0056679 3300048920 Bacteria 2727
267 Ga0496118_0026896 3300048921 Bacteria 4885
268 Ga0496118_0084611 3300048921 Bacteria 2212
269 Ga0496120_0069272 3300048923 Bacteria 1943
270 Ga0496121_0000382 3300048924 Bacteria 90517
271 Ga0496123_0006365 3300048926 Bacteria 11461
272 Ga0496125_0054413 3300048928 Bacteria 3270
273 Ga0495682_0002629 3300049460 Bacteria 8406
274 Ga0495682_0003577 3300049460 Bacteria 6863
275 Ga0501031_0156491 3300049568 Bacteria 1489
276 Ga0501033_0288484 3300049570 Bacteria 1157
277 Ga0501038_0122987 3300049574 Bacteria 2138
278 Ga0501039_0210775 3300049575 Bacteria 1528
279 Ga0501201_011812 3300049651 Bacteria 866
280 Ga0501202_032196 3300049652 Bacteria 1100
281 Ga0501211_001994 3300049658 Bacteria 2182
282 Ga0501222_000986 3300049662 Bacteria 4070
283 Ga0501235_032312 3300049669 Bacteria 1183
284 Ga0501236_001906 3300049670 Bacteria 2387
285 Ga0501221_000232 3300049704 Bacteria 8022
286 Ga0501229_000925 3300049706 Bacteria 3315
287 Ga0501264_003630 3300049761 Bacteria 1402
288 Ga0501266_003195 3300049763 Bacteria 2039
289 Ga0501268_003957 3300049765 Bacteria 2063
290 Ga0501269_004852 3300049766 Bacteria 1618
291 Ga0501279_001569 3300049775 Bacteria 3009
292 nmdc:mga0k408_79945_c1 3300050493 Bacteria 1913
293 nmdc:mga07m45_12373_c1 3300050496 Bacteria 4509
294 nmdc:mga07m45_36135_c1 3300050496 Bacteria 2750
295 Ga0500650_0007117 3300053098 Bacteria 4328
296 Ga0500595_000727 3300053119 Bacteria 19579
297 Ga0466962_0059368 3300061719 Bacteria 1826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0288484 Ga0501033_0288484_32_634 198
2 iso_pu_bacteria 2519103095 2519458755 230
3 iso_pu_bacteria 2582581311 2585292407 230
4 iso_pu_bacteria 2599185214 2599622591 230
5 iso_pu_bacteria 2599185226 2599671070 230
6 iso_pu_bacteria 2599185227 2599679893 230
7 iso_pu_bacteria 2599185229 2599691909 230
8 iso_pu_bacteria 2600255067 2600811785 230
9 iso_pu_bacteria 2643221544 2643743525 230
10 iso_pu_bacteria 2643221603 2644031449 230
11 iso_pu_bacteria 2816332253 2817261029 230
12 iso_pu_bacteria 2816332256 2817278725 230
13 iso_pu_bacteria 2816332286 2817451800 230
14 iso_pu_bacteria 2818991436 2819543820 230
15 iso_pu_bacteria 2885198086 2885204911 230
16 iso_pu_bacteria 2885211737 2885218402 230
17 iso_pu_bacteria 2886848708 2886850838 230
18 iso_pu_bacteria 2887375801 2887378596 230
19 iso_pu_bacteria 2899924645 2899925996 230
20 iso_pu_bacteria 2928064002 2928065109 230
21 iso_pu_bacteria 2928070936 2928077528 230
22 iso_pu_bacteria 2954767861 2954771305 230
23 iso_pu_bacteria 8020807995 8020813246 230
24 iso_pu_bacteria 8040167225 8040169973 230
25 iso_pu_bacteria 8040173305 8040173438 230
26 3300027312 Ga0209371_1019549 Ga0209371_10195493 231
27 3300030500 Ga0268256_1012630 Ga0268256_10126303 231
28 3300031507 Ga0307509_10006531 Ga0307509_100065316 231
29 iso_pu_bacteria 2521172590 2521558554 231
30 iso_pu_bacteria 2551306416 2553004182 231
31 iso_pu_bacteria 2818991449 2819614222 231
32 iso_pu_bacteria 2904439833 2904445157 231
33 iso_pu_bacteria 2904530477 2904534257 231
34 iso_pu_bacteria 2904584206 2904588902 231
35 iso_pu_bacteria 2904589729 2904590617 231
36 iso_pu_bacteria 2904601388 2904603512 231
37 iso_pu_bacteria 2919079590 2919080479 231
38 iso_pu_bacteria 2923510766 2923512019 231
39 iso_pu_bacteria 2928130867 2928131737 231
40 3300049568 Ga0501031_0156491 Ga0501031_0156491_661_1359 232
41 3300053098 Ga0500650_0007117 Ga0500650_0007117_222_920 232
42 iso_pu_bacteria 2721755523 2722886262 232
43 iso_pu_bacteria 2839138175 2839141891 232
44 3300005327 Ga0070658_10054253 Ga0070658_100542533 233
45 3300005439 Ga0070711_100049599 Ga0070711_1000495993 233
46 3300006175 Ga0070712_100309208 Ga0070712_1003092082 233
47 3300025915 Ga0207693_10186227 Ga0207693_101862272 233
48 3300025916 Ga0207663_10136768 Ga0207663_101367682 233
49 3300025928 Ga0207700_10653368 Ga0207700_106533682 233
50 3300037418 Ga0395900_0125067 Ga0395900_0125067_1455_2162 233
51 3300038443 Ga0395901_0251701 Ga0395901_0251701_694_1401 233
52 3300046500 Ga0495596_0000293 Ga0495596_0000293_7932_8633 233
53 3300046513 Ga0495616_0040217 Ga0495616_0040217_1609_2310 233
54 3300047445 Ga0495677_0011703 Ga0495677_0011703_1902_2603 233
55 3300002739 JGI25158J39367_1003108 JGI25158J39367_10031082 234
56 3300002773 JGI25152J39213_1007777 JGI25152J39213_10077772 234
57 3300002774 JGI25150J39212_1001480 JGI25150J39212_10014806 234
58 3300002987 JGI25159J45721_1006034 JGI25159J45721_10060344 234
59 3300002987 JGI25159J45721_1008789 JGI25159J45721_10087892 234
60 3300003187 JGI25151J46595_10021034 JGI25151J46595_100210342 234
61 3300003215 JGI25153J46596_10018211 JGI25153J46596_100182112 234
62 3300003322 rootL2_10003345 rootL2_1000334511 234
63 3300003354 JGI25160J50197_1004678 JGI25160J50197_10046786 234
64 3300003354 JGI25160J50197_1013786 JGI25160J50197_10137862 234
65 3300003374 JGI25161J50226_1003223 JGI25161J50226_10032234 234
66 3300003374 JGI25161J50226_1004919 JGI25161J50226_10049193 234
67 3300003751 Ga0055538_1000002 Ga0055538_100000225 234
68 3300003752 Ga0055539_1000002 Ga0055539_100000225 234
69 3300003756 Ga0055533_1000004 Ga0055533_100000425 234
70 3300003759 Ga0055525_1000002 Ga0055525_100000225 234
71 3300003761 Ga0055535_1000086 Ga0055535_100008630 234
72 3300003762 Ga0055542_1000009 Ga0055542_1000009318 234
73 3300003771 Ga0055526_1001737 Ga0055526_10017372 234
74 3300003771 Ga0055526_1003526 Ga0055526_10035262 234
75 3300003771 Ga0055526_1017458 Ga0055526_10174582 234
76 3300003773 Ga0055537_1007131 Ga0055537_10071312 234
77 3300003773 Ga0055537_1011806 Ga0055537_10118062 234
78 3300003775 Ga0055524_1003367 Ga0055524_10033672 234
79 3300003775 Ga0055524_1005178 Ga0055524_10051782 234
80 3300003775 Ga0055524_1015786 Ga0055524_10157862 234
81 3300003784 Ga0055534_1007049 Ga0055534_10070492 234
82 3300003784 Ga0055534_1007116 Ga0055534_10071162 234
83 3300003790 Ga0055528_1015583 Ga0055528_10155832 234
84 3300003791 Ga0055530_10000151 Ga0055530_1000015113 234
85 3300003792 Ga0055540_1010260 Ga0055540_10102602 234
86 3300003794 Ga0055531_10025428 Ga0055531_100254283 234
87 3300003841 Ga0055541_1000002 Ga0055541_1000002815 234
88 3300004625 Ga0055543_1003275 Ga0055543_10032756 234
89 3300005334 Ga0068869_100295635 Ga0068869_1002956352 234
90 3300005336 Ga0070680_100001999 Ga0070680_1000019997 234
91 3300005336 Ga0070680_100082311 Ga0070680_1000823113 234
92 3300005337 Ga0070682_100014282 Ga0070682_1000142823 234
93 3300005347 Ga0070668_100088094 Ga0070668_1000880943 234
94 3300005354 Ga0070675_100004547 Ga0070675_1000045472 234
95 3300005355 Ga0070671_100049072 Ga0070671_1000490722 234
96 3300005356 Ga0070674_100441513 Ga0070674_1004415132 234
97 3300005367 Ga0070667_100362998 Ga0070667_1003629982 234
98 3300005456 Ga0070678_100385773 Ga0070678_1003857731 234
99 3300005457 Ga0070662_100108967 Ga0070662_1001089672 234
100 3300005458 Ga0070681_10000929 Ga0070681_1000092921 234
101 3300005458 Ga0070681_10121454 Ga0070681_101214542 234
102 3300005459 Ga0068867_100003166 Ga0068867_1000031668 234
103 3300005530 Ga0070679_100005197 Ga0070679_1000051974 234
104 3300005530 Ga0070679_100089678 Ga0070679_1000896783 234
105 3300005530 Ga0070679_100111187 Ga0070679_1001111872 234
106 3300005543 Ga0070672_100024014 Ga0070672_1000240141 234
107 3300005543 Ga0070672_100052425 Ga0070672_1000524254 234
108 3300005563 Ga0068855_100000055 Ga0068855_10000005597 234
109 3300005563 Ga0068855_100000865 Ga0068855_10000086528 234
110 3300005563 Ga0068855_100242461 Ga0068855_1002424612 234
111 3300005578 Ga0068854_100010934 Ga0068854_1000109343 234
112 3300005578 Ga0068854_100216714 Ga0068854_1002167142 234
113 3300005718 Ga0068866_10006625 Ga0068866_100066253 234
114 3300005719 Ga0068861_100011807 Ga0068861_1000118073 234
115 3300005834 Ga0068851_10045141 Ga0068851_100451412 234
116 3300005841 Ga0068863_100186629 Ga0068863_1001866292 234
117 3300005842 Ga0068858_100070379 Ga0068858_1000703794 234
118 3300005843 Ga0068860_100000693 Ga0068860_10000069323 234
119 3300005843 Ga0068860_100149314 Ga0068860_1001493142 234
120 3300005844 Ga0068862_100000949 Ga0068862_1000009499 234
121 3300006195 Ga0075366_10199220 Ga0075366_101992202 234
122 3300006237 Ga0097621_100027990 Ga0097621_1000279906 234
123 3300006358 Ga0068871_100015407 Ga0068871_1000154075 234
124 3300006946 Ga0079104_1000169 Ga0079104_100016983 234
125 3300009092 Ga0105250_10000066 Ga0105250_1000006619 234
126 3300009093 Ga0105240_10132287 Ga0105240_101322874 234
127 3300009098 Ga0105245_10124707 Ga0105245_101247072 234
128 3300009551 Ga0105238_10006383 Ga0105238_100063832 234
129 3300009553 Ga0105249_10038028 Ga0105249_100380285 234
130 3300012497 Ga0157319_1000035 Ga0157319_100003514 234
131 3300013105 Ga0157369_10126200 Ga0157369_101262003 234
132 3300013306 Ga0163162_10006385 Ga0163162_100063856 234
133 3300013306 Ga0163162_10752287 Ga0163162_107522871 234
134 3300013307 Ga0157372_10583000 Ga0157372_105830002 234
135 3300014326 Ga0157380_10149931 Ga0157380_101499314 234
136 3300014968 Ga0157379_10609277 Ga0157379_106092772 234
137 3300014969 Ga0157376_10009957 Ga0157376_100099574 234
138 3300014969 Ga0157376_10288532 Ga0157376_102885322 234
139 3300015261 Ga0182006_1003945 Ga0182006_10039455 234
140 3300015261 Ga0182006_1004751 Ga0182006_10047514 234
141 3300015262 Ga0182007_10014101 Ga0182007_100141013 234
142 3300015265 Ga0182005_1000253 Ga0182005_100025332 234
143 3300015683 Ga0183362_10009 Ga0183362_1000979 234
144 3300017792 Ga0163161_10154143 Ga0163161_101541432 234
145 3300025208 Ga0209436_104651 Ga0209436_1046514 234
146 3300025208 Ga0209436_108502 Ga0209436_1085023 234
147 3300025224 Ga0209784_100002 Ga0209784_100002267 234
148 3300025225 Ga0209566_100003 Ga0209566_100003267 234
149 3300025226 Ga0209674_100004 Ga0209674_100004267 234
150 3300025228 Ga0209672_100317 Ga0209672_1003179 234
151 3300025229 Ga0209147_100379 Ga0209147_10037912 234
152 3300025230 Ga0209563_100006 Ga0209563_100006267 234
153 3300025242 Ga0209258_100009 Ga0209258_100009335 234
154 3300025245 Ga0207425_1000050 Ga0207425_100005055 234
155 3300025245 Ga0207425_1000240 Ga0207425_100024027 234
156 3300025253 Ga0209677_100003 Ga0209677_100003267 234
157 3300025254 Ga0209148_1000007 Ga0209148_1000007335 234
158 3300025258 Ga0209129_1000013 Ga0209129_1000013302 234
159 3300025263 Ga0209565_1000239 Ga0209565_100023919 234
160 3300025263 Ga0209565_1000289 Ga0209565_100028912 234
161 3300025263 Ga0209565_1000675 Ga0209565_100067519 234
162 3300025263 Ga0209565_1001239 Ga0209565_10012392 234
163 3300025273 Ga0209673_1000188 Ga0209673_100018869 234
164 3300025273 Ga0209673_1010401 Ga0209673_10104013 234
165 3300025284 Ga0209130_1000405 Ga0209130_10004059 234
166 3300025284 Ga0209130_1002419 Ga0209130_10024192 234
167 3300025291 Ga0209675_1000086 Ga0209675_100008690 234
168 3300025291 Ga0209675_1002191 Ga0209675_100219110 234
169 3300025291 Ga0209675_1020854 Ga0209675_10208542 234
170 3300025292 Ga0209676_1014116 Ga0209676_10141162 234
171 3300025294 Ga0209025_1000381 Ga0209025_100038140 234
172 3300025295 Ga0209564_1000063 Ga0209564_1000063106 234
173 3300025295 Ga0209564_1000214 Ga0209564_100021479 234
174 3300025295 Ga0209564_1001671 Ga0209564_10016712 234
175 3300025295 Ga0209564_1009729 Ga0209564_10097293 234
176 3300025297 Ga0209758_1000134 Ga0209758_100013412 234
177 3300025298 Ga0209050_1000050 Ga0209050_1000050242 234
178 3300025298 Ga0209050_1000341 Ga0209050_100034152 234
179 3300025299 Ga0209256_1000060 Ga0209256_100006079 234
180 3300025299 Ga0209256_1000227 Ga0209256_100022778 234
181 3300025299 Ga0209256_1000638 Ga0209256_10006382 234
182 3300025299 Ga0209256_1029088 Ga0209256_10290882 234
183 3300025302 Ga0207426_1000100 Ga0207426_100010079 234
184 3300025302 Ga0207426_1000506 Ga0207426_100050646 234
185 3300025303 Ga0209051_1005839 Ga0209051_10058398 234
186 3300025303 Ga0209051_1028857 Ga0209051_10288572 234
187 3300025304 Ga0209257_1000075 Ga0209257_1000075242 234
188 3300025304 Ga0209257_1002281 Ga0209257_100228115 234
189 3300025304 Ga0209257_1005708 Ga0209257_10057089 234
190 3300025321 Ga0207656_10013350 Ga0207656_100133502 234
191 3300025711 Ga0207696_1007489 Ga0207696_10074892 234
192 3300025899 Ga0207642_10005107 Ga0207642_100051075 234
193 3300025907 Ga0207645_10002661 Ga0207645_100026617 234
194 3300025907 Ga0207645_10335895 Ga0207645_103358951 234
195 3300025912 Ga0207707_10001482 Ga0207707_100014829 234
196 3300025912 Ga0207707_10036620 Ga0207707_100366202 234
197 3300025912 Ga0207707_10157694 Ga0207707_101576941 234
198 3300025913 Ga0207695_10004893 Ga0207695_1000489317 234
199 3300025913 Ga0207695_10013254 Ga0207695_100132543 234
200 3300025914 Ga0207671_10082478 Ga0207671_100824782 234
201 3300025917 Ga0207660_10006475 Ga0207660_100064756 234
202 3300025917 Ga0207660_10149287 Ga0207660_101492872 234
203 3300025921 Ga0207652_10000219 Ga0207652_1000021932 234
204 3300025921 Ga0207652_10114222 Ga0207652_101142221 234
205 3300025924 Ga0207694_10004375 Ga0207694_100043753 234
206 3300025924 Ga0207694_10020925 Ga0207694_100209256 234
207 3300025925 Ga0207650_10001866 Ga0207650_1000186611 234
208 3300025926 Ga0207659_10008345 Ga0207659_100083453 234
209 3300025931 Ga0207644_10107836 Ga0207644_101078362 234
210 3300025931 Ga0207644_10167584 Ga0207644_101675843 234
211 3300025935 Ga0207709_10000783 Ga0207709_1000078321 234
212 3300025935 Ga0207709_10182399 Ga0207709_101823991 234
213 3300025937 Ga0207669_10252057 Ga0207669_102520572 234
214 3300025940 Ga0207691_10005757 Ga0207691_100057574 234
215 3300025940 Ga0207691_10051423 Ga0207691_100514233 234
216 3300025942 Ga0207689_10061319 Ga0207689_100613192 234
217 3300025949 Ga0207667_10000032 Ga0207667_1000003278 234
218 3300025949 Ga0207667_10025104 Ga0207667_100251046 234
219 3300025949 Ga0207667_10422861 Ga0207667_104228612 234
220 3300025960 Ga0207651_10282622 Ga0207651_102826222 234
221 3300025961 Ga0207712_10076935 Ga0207712_100769354 234
222 3300025972 Ga0207668_10043841 Ga0207668_100438413 234
223 3300025981 Ga0207640_10120658 Ga0207640_101206582 234
224 3300025981 Ga0207640_10262466 Ga0207640_102624662 234
225 3300025981 Ga0207640_10371950 Ga0207640_103719502 234
226 3300026035 Ga0207703_10222191 Ga0207703_102221913 234
227 3300026075 Ga0207708_10642670 Ga0207708_106426702 234
228 3300026088 Ga0207641_10123257 Ga0207641_101232572 234
229 3300026089 Ga0207648_10001076 Ga0207648_1000107623 234
230 3300026089 Ga0207648_10003056 Ga0207648_1000305615 234
231 3300026095 Ga0207676_10003225 Ga0207676_100032255 234
232 3300026116 Ga0207674_10206290 Ga0207674_102062902 234
233 3300026118 Ga0207675_100000617 Ga0207675_1000006177 234
234 3300026121 Ga0207683_10026541 Ga0207683_100265411 234
235 3300026121 Ga0207683_10340601 Ga0207683_103406012 234
236 3300026121 Ga0207683_10498166 Ga0207683_104981662 234
237 3300026142 Ga0207698_10211786 Ga0207698_102117862 234
238 3300027111 Ga0209281_1000002 Ga0209281_1000002237 234
239 3300028380 Ga0268265_10036876 Ga0268265_100368765 234
240 3300028381 Ga0268264_10002164 Ga0268264_1000216418 234
241 3300028381 Ga0268264_10148824 Ga0268264_101488243 234
242 3300028794 Ga0307515_10000030 Ga0307515_10000030115 234
243 3300028800 Ga0265338_10000037 Ga0265338_1000003736 234
244 3300028800 Ga0265338_10010664 Ga0265338_100106643 234
245 3300031238 Ga0265332_10000023 Ga0265332_10000023193 234
246 3300031239 Ga0265328_10082661 Ga0265328_100826612 234
247 3300031242 Ga0265329_10023253 Ga0265329_100232533 234
248 3300031250 Ga0265331_10108421 Ga0265331_101084212 234
249 3300031507 Ga0307509_10000115 Ga0307509_1000011528 234
250 3300031548 Ga0307408_100000149 Ga0307408_10000014930 234
251 3300031548 Ga0307408_100000382 Ga0307408_1000003827 234
252 3300031548 Ga0307408_100063022 Ga0307408_1000630223 234
253 3300031548 Ga0307408_100083589 Ga0307408_1000835893 234
254 3300031548 Ga0307408_100548705 Ga0307408_1005487052 234
255 3300031730 Ga0307516_10111676 Ga0307516_101116762 234
256 3300031911 Ga0307412_10040490 Ga0307412_100404903 234
257 3300032002 Ga0307416_101103463 Ga0307416_1011034632 234
258 3300037418 Ga0395900_0000025 Ga0395900_0000025_160983_161693 234
259 3300037466 Ga0395898_0000949 Ga0395898_0000949_15393_16103 234
260 3300037471 Ga0395905_0013568 Ga0395905_0013568_6422_7126 234
261 3300041410 Ga0439461_0021215 Ga0439461_0021215_501_1205 234
262 3300041413 Ga0439465_0150557 Ga0439465_0150557_93_797 234
263 3300042000 Ga0439437_003436 Ga0439437_003436_669_1373 234
264 3300042004 Ga0439445_0074335 Ga0439445_0074335_94_798 234
265 3300042115 Ga0450911_000002 Ga0450911_000002_216262_216966 234
266 3300042118 Ga0450914_001263 Ga0450914_001263_785_1489 234
267 3300042126 Ga0450888_000113 Ga0450888_000113_4745_5449 234
268 3300042127 Ga0450890_000740 Ga0450890_000740_3464_4168 234
269 3300042129 Ga0450891_000408 Ga0450891_000408_1689_2393 234
270 3300042130 Ga0450892_001386 Ga0450892_001386_1013_1717 234
271 3300042530 Ga0450916_003002 Ga0450916_003002_903_1607 234
272 3300042532 Ga0450893_0002928 Ga0450893_0002928_1015_1719 234
273 3300042876 Ga0451577_0001497 Ga0451577_0001497_24976_25722 234
274 3300042876 Ga0451577_0019144 Ga0451577_0019144_4652_5365 234
275 3300044656 Ga0466969_0027496 Ga0466969_0027496_1451_2161 234
276 3300044658 Ga0466972_0030561 Ga0466972_0030561_1398_2114 234
277 3300044673 Ga0453683_0056164 Ga0453683_0056164_737_1450 234
278 3300044712 Ga0453684_0203859 Ga0453684_0203859_636_1349 234
279 3300045049 Ga0466959_0020608 Ga0466959_0020608_3895_4605 234
280 3300045049 Ga0466959_0022784 Ga0466959_0022784_1104_1964 234
281 3300045051 Ga0451576_0035812 Ga0451576_0035812_869_1582 234
282 3300046472 Ga0495580_0001750 Ga0495580_0001750_1526_2230 234
283 3300046474 Ga0495605_0100846 Ga0495605_0100846_508_1218 234
284 3300046500 Ga0495596_0006709 Ga0495596_0006709_4009_4719 234
285 3300046507 Ga0495606_0121339 Ga0495606_0121339_118_822 234
286 3300046512 Ga0495610_0003867 Ga0495610_0003867_2514_3218 234
287 3300046516 Ga0495628_0002314 Ga0495628_0002314_16285_17040 234
288 3300046522 Ga0495643_0043609 Ga0495643_0043609_307_1059 234
289 3300046529 Ga0495652_0267404 Ga0495652_0267404_10_834 234
290 3300046530 Ga0495654_0000083 Ga0495654_0000083_84042_84749 234
291 3300046558 Ga0495633_0102226 Ga0495633_0102226_475_1179 234
292 3300046615 Ga0495656_0004896 Ga0495656_0004896_531_1244 234
293 3300046660 Ga0495625_0161235 Ga0495625_0161235_216_920 234
294 3300046675 Ga0495657_0046280 Ga0495657_0046280_2231_2935 234
295 3300046678 Ga0495599_0022928 Ga0495599_0022928_660_1484 234
296 3300046679 Ga0495623_0018835 Ga0495623_0018835_84_908 234
297 3300046680 Ga0495646_0011181 Ga0495646_0011181_416_1240 234
298 3300046684 Ga0495669_0000035 Ga0495669_0000035_60650_61360 234
299 3300046809 Ga0495600_0001529 Ga0495600_0001529_354_1109 234
300 3300047323 Ga0495683_0001248 Ga0495683_0001248_3677_4381 234
301 3300048905 Ga0496102_0199717 Ga0496102_0199717_558_1262 234
302 3300048907 Ga0496104_0022061 Ga0496104_0022061_4989_5693 234
303 3300048908 Ga0496105_0009291 Ga0496105_0009291_2117_2821 234
304 3300048911 Ga0496108_0075094 Ga0496108_0075094_795_1571 234
305 3300048915 Ga0496112_0172995 Ga0496112_0172995_307_1011 234
306 3300048920 Ga0496117_0056679 Ga0496117_0056679_1472_2176 234
307 3300048921 Ga0496118_0026896 Ga0496118_0026896_2611_3315 234
308 3300048921 Ga0496118_0084611 Ga0496118_0084611_1125_1829 234
309 3300048923 Ga0496120_0069272 Ga0496120_0069272_313_1017 234
310 3300048924 Ga0496121_0000382 Ga0496121_0000382_41389_42093 234
311 3300048926 Ga0496123_0006365 Ga0496123_0006365_6706_7410 234
312 3300048928 Ga0496125_0054413 Ga0496125_0054413_2479_3183 234
313 3300049460 Ga0495682_0002629 Ga0495682_0002629_4895_5599 234
314 3300049460 Ga0495682_0003577 Ga0495682_0003577_2287_2991 234
315 3300049574 Ga0501038_0122987 Ga0501038_0122987_464_1180 234
316 3300049575 Ga0501039_0210775 Ga0501039_0210775_760_1476 234
317 3300049651 Ga0501201_011812 Ga0501201_011812_94_801 234
318 3300049652 Ga0501202_032196 Ga0501202_032196_267_974 234
319 3300049658 Ga0501211_001994 Ga0501211_001994_523_1230 234
320 3300049662 Ga0501222_000986 Ga0501222_000986_3218_3925 234
321 3300049669 Ga0501235_032312 Ga0501235_032312_11_718 234
322 3300049670 Ga0501236_001906 Ga0501236_001906_1502_2209 234
323 3300049704 Ga0501221_000232 Ga0501221_000232_4317_5024 234
324 3300049706 Ga0501229_000925 Ga0501229_000925_941_1648 234
325 3300049761 Ga0501264_003630 Ga0501264_003630_596_1303 234
326 3300049763 Ga0501266_003195 Ga0501266_003195_522_1238 234
327 3300049765 Ga0501268_003957 Ga0501268_003957_512_1219 234
328 3300049766 Ga0501269_004852 Ga0501269_004852_680_1387 234
329 3300049775 Ga0501279_001569 Ga0501279_001569_673_1377 234
330 3300050493 nmdc:mga0k408_79945_c1 nmdc:mga0k408_79945_c1_958_1668 234
331 3300050496 nmdc:mga07m45_12373_c1 nmdc:mga07m45_12373_c1_1941_2669 234
332 3300050496 nmdc:mga07m45_36135_c1 nmdc:mga07m45_36135_c1_887_1597 234
333 3300053119 Ga0500595_000727 Ga0500595_000727_10461_11285 234
334 3300061719 Ga0466962_0059368 Ga0466962_0059368_151_858 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

23

102

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

31

103

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

26

108

0.86

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

132

228

0.85

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

153

223

0.78

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

138

234

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ikh-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound 0.9917 7 231
4nax-assembly1.cif.gz_B crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit 0.9911 2 231
4nhz-assembly2.cif.gz_D crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound 0.9892 4 234
4nhz-assembly4.cif.gz_H crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound 0.9891 3 234
4mf6-assembly1.cif.gz_A crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit 0.9855 1 234
ID Description Score Start End Superfamily
4ikhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9998 7 104 3.40.30.10
4nhzB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9813 106 221 1.20.1050.10
4naxB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9805 106 221 1.20.1050.10
4nhzB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.973 106 221 1.20.1050.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9725 22 103 3.40.30.10
ID Description Score Start End GO Terms
AF-J2VEM9-F1-model_v4 Glutathione S-transferase 1.005 8 87 GO:0016740
AF-A0A2N9CH63-F1-model_v4 deleted 0.9962 4 234
AF-A2VQC6-F1-model_v4 deleted 0.9957 4 234
AF-A0A4R3M2F7-F1-model_v4 GST-like protein 0.9957 4 234
AF-Q2SVY8-F1-model_v4 Glutathione S-transferase, putative 0.995 4 234

Feature Viewer

pLDDT pTM Quality
94.74 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map