F411674

General Info

Members Datasets Scaffolds Average Seq Length
334 178 668 189

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100308436|Ga0070663_1003084362
Length 183
Sequence MRSDIIPGGTFPDYALPDHTGIVRRLSELQGRDPLILMLSRGHYCPKEHQQHHDLAAFQSKVAVAYTQMVTISTDTFLSDPGRTVQQDLDIAEYTDPDHNPMIPHTLVLKPGLLIHSIYNGYWFWGRPSVDDLWRDLRAAAAEIRPDWDLDAPGLRQAWVAGDHSKFHGWDRHTGPPLATQGR

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.9
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.39
Rhizosphere 90.42
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100308436 3300005455 Bacteria 1269
2 Ga0070676_10070540 3300005328 Bacteria 2096
3 Ga0068869_100570728 3300005334 Bacteria 953
4 Ga0070682_100330419 3300005337 Bacteria 1129
5 Ga0070688_100076051 3300005365 Bacteria 2160
6 Ga0070709_10229941 3300005434 Bacteria 1326
7 Ga0070714_100011043 3300005435 Bacteria 7155
8 Ga0070714_100019153 3300005435 Bacteria 5571
9 Ga0070713_100026545 3300005436 Bacteria 4549
10 Ga0070710_10343085 3300005437 Bacteria 987
11 Ga0070710_10519378 3300005437 Bacteria 818
12 Ga0070711_100290935 3300005439 Bacteria 1296
13 Ga0070700_100051987 3300005441 Bacteria 2553
14 Ga0070678_100104338 3300005456 Bacteria 2204
15 Ga0070685_10283043 3300005466 Bacteria 1111
16 Ga0070706_100080615 3300005467 Bacteria 3014
17 Ga0070706_100429326 3300005467 Bacteria 1230
18 Ga0070698_100126267 3300005471 Bacteria 2515
19 Ga0070698_100642808 3300005471 Bacteria 1002
20 Ga0070684_100145658 3300005535 Bacteria 2144
21 Ga0070672_100747232 3300005543 Bacteria 858
22 Ga0070665_100434068 3300005548 Bacteria 1323
23 Ga0068852_100005066 3300005616 Bacteria 9377
24 Ga0068852_100092008 3300005616 Bacteria 2715
25 Ga0068864_100329572 3300005618 Bacteria 1436
26 Ga0068863_100056657 3300005841 Bacteria 3710
27 Ga0068863_100677133 3300005841 Bacteria 1024
28 Ga0068860_100063510 3300005843 Bacteria 3507
29 Ga0068860_100212755 3300005843 Bacteria 1876
30 Ga0081455_10297095 3300005937 Bacteria 1160
31 Ga0081539_10049620 3300005985 Bacteria 2380
32 Ga0070717_10100409 3300006028 Bacteria 2457
33 Ga0070717_10714455 3300006028 Bacteria 911
34 Ga0070712_100082593 3300006175 Bacteria 2331
35 Ga0075428_100000355 3300006844 Bacteria 45446
36 Ga0075428_100668110 3300006844 Bacteria 1107
37 Ga0075430_100160258 3300006846 Bacteria 1873
38 Ga0075431_100150026 3300006847 Bacteria 2401
39 Ga0111539_10520053 3300009094 Bacteria 1386
40 Ga0105245_10266856 3300009098 Bacteria 1668
41 Ga0105245_10402183 3300009098 Bacteria 1369
42 Ga0105247_10216555 3300009101 Bacteria 1294
43 Ga0105243_10077619 3300009148 Bacteria 2702
44 Ga0105248_10843247 3300009177 Bacteria 1034
45 Ga0105237_11346116 3300009545 Bacteria 720
46 Ga0105239_10194782 3300010375 Bacteria 2269
47 Ga0105239_11779779 3300010375 Bacteria 714
48 Ga0105246_10727076 3300011119 Bacteria 873
49 Ga0157370_10480558 3300013104 Bacteria 1142
50 Ga0157369_10231284 3300013105 Bacteria 1933
51 Ga0163162_10360132 3300013306 Bacteria 1588
52 Ga0157372_10000006 3300013307 Bacteria 354669
53 Ga0157372_10381424 3300013307 Bacteria 1642
54 Ga0157372_10892013 3300013307 Bacteria 1032
55 Ga0157375_10568553 3300013308 Bacteria 1294
56 Ga0157375_10803406 3300013308 Bacteria 1089
57 Ga0157375_10813643 3300013308 Bacteria 1082
58 Ga0163163_10865879 3300014325 Bacteria 967
59 Ga0157376_10027903 3300014969 Bacteria 4481
60 Ga0207684_10239921 3300025910 Bacteria 1564
61 Ga0207695_10613289 3300025913 Bacteria 969
62 Ga0207671_10192013 3300025914 Bacteria 1593
63 Ga0207694_10751277 3300025924 Bacteria 823
64 Ga0207687_10381699 3300025927 Bacteria 1155
65 Ga0207687_10597808 3300025927 Bacteria 929
66 Ga0207700_10026159 3300025928 Bacteria 4065
67 Ga0207700_10034984 3300025928 Bacteria 3613
68 Ga0207700_10094307 3300025928 Bacteria 2371
69 Ga0207700_10942075 3300025928 Bacteria 773
70 Ga0207686_10480066 3300025934 Bacteria 961
71 Ga0207709_10043704 3300025935 Bacteria 2702
72 Ga0207670_10430374 3300025936 Bacteria 1060
73 Ga0207691_10387061 3300025940 Unclassified 1193
74 Ga0207689_10415714 3300025942 Bacteria 1122
75 Ga0207651_10358616 3300025960 Bacteria 1230
76 Ga0207651_10490738 3300025960 Bacteria 1060
77 Ga0207678_10053512 3300026067 Bacteria 3478
78 Ga0207678_10772190 3300026067 Bacteria 848
79 Ga0207708_10075087 3300026075 Bacteria 2592
80 Ga0207641_10521415 3300026088 Bacteria 1156
81 Ga0207676_10034862 3300026095 Bacteria 3813
82 Ga0207683_10012703 3300026121 Bacteria 7184
83 Ga0207683_10362299 3300026121 Bacteria 1331
84 Ga0207698_10565845 3300026142 Bacteria 1116
85 Ga0268266_10281816 3300028379 Bacteria 1546
86 Ga0268266_10320233 3300028379 Bacteria 1451
87 Ga0268266_10539566 3300028379 Bacteria 1116
88 Ga0268264_10074197 3300028381 Bacteria 2889
89 Ga0268264_10306150 3300028381 Bacteria 1497
90 Ga0265336_10008047 3300028666 Bacteria 3718
91 Ga0265338_10000522 3300028800 Bacteria 67694
92 Ga0265338_10318944 3300028800 Unclassified 1125
93 Ga0265775_102590 3300030762 Bacteria 942
94 Ga0307513_10002041 3300031456 Bacteria 28396
95 Ga0307513_10350462 3300031456 Bacteria 1224
96 Ga0307509_10614924 3300031507 Bacteria 758
97 Ga0307408_100264325 3300031548 Bacteria 1426
98 Ga0307508_10042105 3300031616 Bacteria 4098
99 Ga0307413_10060446 3300031824 Bacteria 2333
100 Ga0307410_10025094 3300031852 Bacteria 3734
101 Ga0307406_10178497 3300031901 Bacteria 1544
102 Ga0307406_10202830 3300031901 Bacteria 1461
103 Ga0307406_10381871 3300031901 Bacteria 1111
104 Ga0307407_10124970 3300031903 Bacteria 1637
105 Ga0307409_100031288 3300031995 Bacteria 3838
106 Ga0307409_100271796 3300031995 Bacteria 1561
107 Ga0307409_100288308 3300031995 Bacteria 1521
108 Ga0307409_100401165 3300031995 Bacteria 1310
109 Ga0307416_100017061 3300032002 Bacteria 5067
110 Ga0307416_100496550 3300032002 Bacteria 1284
111 Ga0307414_10441068 3300032004 Bacteria 1140
112 Ga0307411_10777620 3300032005 Bacteria 841
113 Ga0307415_100063569 3300032126 Bacteria 2565
114 Ga0307415_100075556 3300032126 Bacteria 2385
115 Ga0373926_0000555 3300035083 Bacteria 10045
116 Ga0373934_0000104 3300035086 Bacteria 29933
117 Ga0373944_0049707 3300035089 Bacteria 1318
118 Ga0373923_0009433 3300035111 Bacteria 3521
119 Ga0373936_0000556 3300035113 Bacteria 12798
120 Ga0373936_0070117 3300035113 Bacteria 1443
121 Ga0373945_0000344 3300035116 Bacteria 13286
122 Ga0373953_0000507 3300035117 Bacteria 10840
123 Ga0373953_0122864 3300035117 Bacteria 1103
124 Ga0373954_0010317 3300035118 Bacteria 4121
125 Ga0373954_0024814 3300035118 Bacteria 2735
126 Ga0373956_0003149 3300035119 Bacteria 6672
127 Ga0373957_0000034 3300035120 Bacteria 35486
128 Ga0373957_0022842 3300035120 Bacteria 2231
129 Ga0373943_0000096 3300035170 Bacteria 32386
130 Ga0373943_0105407 3300035170 Bacteria 1480
131 Ga0373946_0009619 3300035171 Bacteria 3565
132 Ga0373946_0175103 3300035171 Bacteria 1015
133 Ga0373955_0000928 3300035172 Bacteria 12573
134 Ga0373955_0011299 3300035172 Bacteria 4249
135 Ga0373955_0048528 3300035172 Bacteria 2302
136 Ga0373924_0009695 3300035410 Bacteria 3538
137 Ga0373924_0090936 3300035410 Bacteria 1305
138 Ga0373935_0001117 3300035692 Bacteria 14635
139 Ga0373927_0003277 3300035695 Bacteria 11645
140 Ga0373927_0190484 3300035695 Bacteria 1346
141 Ga0373927_0306889 3300035695 Bacteria 1045
142 Ga0373933_0000230 3300035724 Bacteria 37223
143 Ga0373933_0053343 3300035724 Bacteria 2422
144 Ga0373933_0087720 3300035724 Bacteria 1916
145 Ga0373947_0000450 3300035725 Bacteria 23417
146 Ga0373947_0087972 3300035725 Bacteria 1933
147 Ga0373947_0105398 3300035725 Bacteria 1776
148 Ga0373937_0000010 3300036401 Bacteria 163001
149 Ga0373937_0023500 3300036401 Bacteria 5551
150 Ga0373937_0119957 3300036401 Bacteria 2450
151 Ga0373937_0260805 3300036401 Bacteria 1634
152 Ga0373925_0015390 3300037068 Bacteria 5529
153 Ga0373925_0113558 3300037068 Bacteria 2095
154 Ga0395900_0407748 3300037418 Bacteria 1322
155 Ga0395898_0003436 3300037466 Bacteria 17717
156 Ga0395905_0090105 3300037471 Bacteria 2875
157 Ga0436364_0797116 3300037853 Bacteria 7644
158 Ga0436364_1044436 3300037853 Bacteria 1963
159 Ga0395901_0009032 3300038443 Bacteria 10091
160 Ga0395901_0048305 3300038443 Bacteria 4419
161 Ga0436365_0085734 3300039437 Bacteria 3102
162 Ga0436363_1021360 3300039450 Bacteria 1196
163 Ga0436362_0346627 3300039453 Bacteria 688
164 Ga0451787_108881 3300041441 Bacteria 2029
165 Ga0451791_0347104 3300041451 Bacteria 3231
166 Ga0451793_0046820 3300041452 Bacteria 4702
167 Ga0451797_0152092 3300041453 Bacteria 7806
168 Ga0451795_0988715 3300041456 Bacteria 4498
169 Ga0451802_0683453 3300041460 Bacteria 2004
170 Ga0451837_1108925 3300041494 Bacteria 3179
171 Ga0451839_0663846 3300041496 Bacteria 1379
172 Ga0451847_0824435 3300041503 Bacteria 723
173 Ga0451849_1563122 3300041505 Bacteria 2423
174 Ga0451843_1339351 3300041509 Bacteria 1065
175 Ga0466963_0320877 3300044694 Bacteria 1090
176 Ga0466960_0000079 3300044901 Bacteria 31870
177 Ga0495592_0000225 3300046454 Bacteria 48726
178 Ga0495592_0036046 3300046454 Bacteria 3726
179 Ga0495592_0046368 3300046454 Bacteria 3240
180 Ga0495592_0064767 3300046454 Bacteria 2677
181 Ga0495629_0002801 3300046459 Bacteria 13294
182 Ga0495629_0179670 3300046459 Bacteria 1467
183 Ga0495641_0006742 3300046461 Bacteria 7370
184 Ga0495641_0042115 3300046461 Bacteria 2118
185 Ga0495641_0109559 3300046461 Bacteria 1232
186 Ga0495651_0000166 3300046462 Bacteria 48436
187 Ga0495651_0006403 3300046462 Bacteria 9009
188 Ga0495651_0016424 3300046462 Bacteria 5733
189 Ga0495651_0033536 3300046462 Bacteria 4004
190 Ga0495651_0040931 3300046462 Bacteria 3600
191 Ga0495653_0015392 3300046463 Bacteria 6234
192 Ga0495653_0025502 3300046463 Bacteria 4749
193 Ga0495653_0308295 3300046463 Bacteria 1030
194 Ga0495582_0017634 3300046473 Bacteria 3906
195 Ga0495582_0018308 3300046473 Bacteria 3832
196 Ga0495639_0025760 3300046475 Bacteria 2595
197 Ga0495639_0103452 3300046475 Bacteria 1346
198 Ga0495662_0003771 3300046476 Bacteria 7644
199 Ga0495662_0098290 3300046476 Bacteria 1431
200 Ga0495664_0000542 3300046477 Bacteria 18993
201 Ga0495664_0018238 3300046477 Bacteria 4017
202 Ga0495594_0020733 3300046499 Bacteria 3503
203 Ga0495594_0234913 3300046499 Bacteria 1045
204 Ga0495608_0000292 3300046511 Bacteria 35120
205 Ga0495608_0011223 3300046511 Bacteria 6236
206 Ga0495608_0013553 3300046511 Bacteria 5654
207 Ga0495608_0049512 3300046511 Bacteria 2789
208 Ga0495608_0213806 3300046511 Bacteria 1211
209 Ga0495618_0008502 3300046514 Bacteria 6207
210 Ga0495618_0065801 3300046514 Bacteria 2303
211 Ga0495618_0440019 3300046514 Bacteria 792
212 Ga0495628_0000535 3300046516 Bacteria 34786
213 Ga0495628_0027226 3300046516 Bacteria 4654
214 Ga0495628_0055673 3300046516 Bacteria 3115
215 Ga0495628_0197609 3300046516 Bacteria 1516
216 Ga0495628_0620756 3300046516 Bacteria 770
217 Ga0495630_0030463 3300046517 Bacteria 4013
218 Ga0495630_0054124 3300046517 Bacteria 3006
219 Ga0495630_0263562 3300046517 Bacteria 1316
220 Ga0495666_0035603 3300046526 Bacteria 2427
221 Ga0495666_0199973 3300046526 Bacteria 919
222 Ga0495652_0001880 3300046529 Bacteria 22338
223 Ga0495652_0018143 3300046529 Bacteria 6280
224 Ga0495652_0097874 3300046529 Bacteria 2385
225 Ga0495665_0036346 3300046531 Bacteria 2630
226 Ga0495665_0246763 3300046531 Bacteria 920
227 Ga0495640_0030926 3300046533 Bacteria 3827
228 Ga0495586_0055675 3300046535 Bacteria 2143
229 Ga0495587_0000294 3300046536 Bacteria 35500
230 Ga0495587_0085850 3300046536 Bacteria 1822
231 Ga0495587_0141043 3300046536 Bacteria 1375
232 Ga0495587_0378065 3300046536 Bacteria 788
233 Ga0495645_0028207 3300046543 Bacteria 4078
234 Ga0495645_0107605 3300046543 Bacteria 1976
235 Ga0495645_0133382 3300046543 Bacteria 1739
236 Ga0495645_0143012 3300046543 Bacteria 1667
237 Ga0495645_0173888 3300046543 Bacteria 1480
238 Ga0495645_0325914 3300046543 Bacteria 996
239 Ga0495622_0136066 3300046557 Bacteria 1117
240 Ga0495667_0000064 3300046559 Bacteria 89628
241 Ga0495667_0010691 3300046559 Bacteria 6206
242 Ga0495667_0016533 3300046559 Bacteria 4983
243 Ga0495667_0034323 3300046559 Bacteria 3392
244 Ga0495634_0013531 3300046642 Bacteria 5894
245 Ga0495635_0001583 3300046663 Bacteria 15304
246 Ga0495635_0036829 3300046663 Bacteria 3388
247 Ga0495635_0216141 3300046663 Bacteria 1297
248 Ga0495657_0002352 3300046675 Bacteria 15904
249 Ga0495657_0350615 3300046675 Bacteria 873
250 Ga0495599_0000179 3300046678 Bacteria 41497
251 Ga0495599_0014964 3300046678 Bacteria 4808
252 Ga0495599_0038118 3300046678 Bacteria 3019
253 Ga0495599_0190377 3300046678 Bacteria 1262
254 Ga0495623_0029880 3300046679 Bacteria 3506
255 Ga0495623_0035524 3300046679 Bacteria 3194
256 Ga0495623_0092378 3300046679 Bacteria 1855
257 Ga0495646_0016519 3300046680 Bacteria 4685
258 Ga0495646_0017759 3300046680 Bacteria 4510
259 Ga0495646_0045595 3300046680 Bacteria 2677
260 Ga0495646_0301190 3300046680 Bacteria 848
261 Ga0495613_0016929 3300046689 Bacteria 5428
262 Ga0495624_0001511 3300046690 Bacteria 18030
263 Ga0495624_0025498 3300046690 Bacteria 3880
264 Ga0495624_0187619 3300046690 Bacteria 1258
265 Ga0495600_0007298 3300046809 Bacteria 6756
266 Ga0495600_0048204 3300046809 Bacteria 2779
267 Ga0495600_0055409 3300046809 Bacteria 2589
268 Ga0495600_0096753 3300046809 Bacteria 1924
269 Ga0495600_0183012 3300046809 Bacteria 1350
270 Ga0495581_0022148 3300047315 Bacteria 3682
271 Ga0495581_0575853 3300047315 Bacteria 653
272 Ga0495604_0000245 3300047317 Bacteria 48436
273 Ga0495604_0042814 3300047317 Bacteria 3546
274 Ga0495604_0136889 3300047317 Bacteria 1754
275 Ga0495604_0195150 3300047317 Bacteria 1408
276 Ga0495604_0227329 3300047317 Bacteria 1282
277 Ga0495674_0001396 3300047319 Bacteria 23606
278 Ga0495674_0069301 3300047319 Bacteria 3050
279 Ga0495674_0141644 3300047319 Bacteria 2021
280 Ga0495674_0367873 3300047319 Bacteria 1165
281 Ga0495674_0470269 3300047319 Bacteria 1008
282 Ga0495676_0003980 3300047321 Bacteria 13450
283 Ga0495676_0271974 3300047321 Bacteria 1149
284 Ga0495680_0004678 3300047322 Bacteria 13041
285 Ga0495680_0009346 3300047322 Bacteria 8825
286 Ga0495680_0091366 3300047322 Bacteria 2282
287 Ga0495680_0092091 3300047322 Bacteria 2271
288 Ga0495680_0094319 3300047322 Bacteria 2239
289 Ga0495680_0226510 3300047322 Bacteria 1332
290 Ga0495675_0146443 3300047444 Bacteria 1461
291 Ga0495675_0277890 3300047444 Bacteria 999
292 Ga0495684_0007161 3300047471 Bacteria 8660
293 Ga0495684_0007262 3300047471 Bacteria 8593
294 Ga0495684_0100014 3300047471 Bacteria 2192
295 Ga0495593_0042249 3300047673 Bacteria 2447
296 Ga0495593_0071697 3300047673 Bacteria 1799
297 Ga0495602_0129442 3300048088 Bacteria 2016
298 Ga0495602_0303184 3300048088 Bacteria 1168
299 Ga0495614_0019379 3300048089 Bacteria 2943
300 Ga0496100_0367345 3300048903 Bacteria 1090
301 Ga0496105_0461321 3300048908 Bacteria 1002
302 Ga0496106_0079053 3300048909 Bacteria 2525
303 Ga0496106_0152751 3300048909 Bacteria 1822
304 Ga0496109_0303810 3300048912 Bacteria 1505
305 Ga0496109_0485733 3300048912 Bacteria 1166
306 Ga0496109_0672880 3300048912 Bacteria 972
307 Ga0496109_0834807 3300048912 Bacteria 859
308 Ga0496111_0202693 3300048914 Bacteria 1475
309 Ga0496111_0458868 3300048914 Bacteria 940
310 Ga0496114_0058703 3300048917 Bacteria 3213
311 Ga0496114_0166914 3300048917 Bacteria 1917
312 nmdc:mga06z11_68615_c1 3300050494 Unclassified 1869
313 nmdc:mga0qj67_148450_c1 3300050509 Bacteria 1901
314 Ga0495601_0003188 3300053077 Bacteria 9389
315 Ga0495601_0005692 3300053077 Bacteria 7261
316 Ga0495601_0021402 3300053077 Bacteria 3960
317 Ga0495601_0207047 3300053077 Bacteria 1281
318 Ga0495612_0000359 3300053078 Bacteria 18494
319 Ga0495612_0006774 3300053078 Bacteria 4693
320 Ga0495612_0147090 3300053078 Bacteria 1024
321 Ga0495595_0005396 3300053084 Bacteria 5180
322 Ga0495595_0006788 3300053084 Bacteria 4672
323 Ga0495595_0082836 3300053084 Bacteria 1530
324 Ga0495595_0101560 3300053084 Bacteria 1389
325 Ga0495619_0013425 3300053085 Bacteria 5161
326 Ga0495619_0081168 3300053085 Bacteria 2183
327 Ga0495619_0091840 3300053085 Bacteria 2056
328 Ga0495619_0112617 3300053085 Bacteria 1860
329 Ga0495619_0122335 3300053085 Bacteria 1784
330 Ga0495619_0203432 3300053085 Bacteria 1371
331 Ga0495619_0441188 3300053085 Bacteria 898
332 Ga0587073_0007340 3300059492 Bacteria 1738
333 Ga0587090_013854 3300059510 Bacteria 1172
334 2676485572 2675903059 Bacteria 8644972
335 Ga0070663_100308436
336 Ga0070676_10070540
337 Ga0068869_100570728
338 Ga0070682_100330419
339 Ga0070688_100076051
340 Ga0070709_10229941
341 Ga0070714_100011043
342 Ga0070714_100019153
343 Ga0070713_100026545
344 Ga0070710_10343085
345 Ga0070710_10519378
346 Ga0070711_100290935
347 Ga0070700_100051987
348 Ga0070678_100104338
349 Ga0070685_10283043
350 Ga0070706_100080615
351 Ga0070706_100429326
352 Ga0070698_100126267
353 Ga0070698_100642808
354 Ga0070684_100145658
355 Ga0070672_100747232
356 Ga0070665_100434068
357 Ga0068852_100005066
358 Ga0068852_100092008
359 Ga0068864_100329572
360 Ga0068863_100056657
361 Ga0068863_100677133
362 Ga0068860_100063510
363 Ga0068860_100212755
364 Ga0081455_10297095
365 Ga0081539_10049620
366 Ga0070717_10100409
367 Ga0070717_10714455
368 Ga0070712_100082593
369 Ga0075428_100000355
370 Ga0075428_100668110
371 Ga0075430_100160258
372 Ga0075431_100150026
373 Ga0111539_10520053
374 Ga0105245_10266856
375 Ga0105245_10402183
376 Ga0105247_10216555
377 Ga0105243_10077619
378 Ga0105248_10843247
379 Ga0105237_11346116
380 Ga0105239_10194782
381 Ga0105239_11779779
382 Ga0105246_10727076
383 Ga0157370_10480558
384 Ga0157369_10231284
385 Ga0163162_10360132
386 Ga0157372_10000006
387 Ga0157372_10381424
388 Ga0157372_10892013
389 Ga0157375_10568553
390 Ga0157375_10803406
391 Ga0157375_10813643
392 Ga0163163_10865879
393 Ga0157376_10027903
394 Ga0207684_10239921
395 Ga0207695_10613289
396 Ga0207671_10192013
397 Ga0207694_10751277
398 Ga0207687_10381699
399 Ga0207687_10597808
400 Ga0207700_10026159
401 Ga0207700_10034984
402 Ga0207700_10094307
403 Ga0207700_10942075
404 Ga0207686_10480066
405 Ga0207709_10043704
406 Ga0207670_10430374
407 Ga0207691_10387061
408 Ga0207689_10415714
409 Ga0207651_10358616
410 Ga0207651_10490738
411 Ga0207678_10053512
412 Ga0207678_10772190
413 Ga0207708_10075087
414 Ga0207641_10521415
415 Ga0207676_10034862
416 Ga0207683_10012703
417 Ga0207683_10362299
418 Ga0207698_10565845
419 Ga0268266_10281816
420 Ga0268266_10320233
421 Ga0268266_10539566
422 Ga0268264_10074197
423 Ga0268264_10306150
424 Ga0265336_10008047
425 Ga0265338_10000522
426 Ga0265338_10318944
427 Ga0265775_102590
428 Ga0307513_10002041
429 Ga0307513_10350462
430 Ga0307509_10614924
431 Ga0307408_100264325
432 Ga0307508_10042105
433 Ga0307413_10060446
434 Ga0307410_10025094
435 Ga0307406_10178497
436 Ga0307406_10202830
437 Ga0307406_10381871
438 Ga0307407_10124970
439 Ga0307409_100031288
440 Ga0307409_100271796
441 Ga0307409_100288308
442 Ga0307409_100401165
443 Ga0307416_100017061
444 Ga0307416_100496550
445 Ga0307414_10441068
446 Ga0307411_10777620
447 Ga0307415_100063569
448 Ga0307415_100075556
449 Ga0373926_0000555
450 Ga0373934_0000104
451 Ga0373944_0049707
452 Ga0373923_0009433
453 Ga0373936_0000556
454 Ga0373936_0070117
455 Ga0373945_0000344
456 Ga0373953_0000507
457 Ga0373953_0122864
458 Ga0373954_0010317
459 Ga0373954_0024814
460 Ga0373956_0003149
461 Ga0373957_0000034
462 Ga0373957_0022842
463 Ga0373943_0000096
464 Ga0373943_0105407
465 Ga0373946_0009619
466 Ga0373946_0175103
467 Ga0373955_0000928
468 Ga0373955_0011299
469 Ga0373955_0048528
470 Ga0373924_0009695
471 Ga0373924_0090936
472 Ga0373935_0001117
473 Ga0373927_0003277
474 Ga0373927_0190484
475 Ga0373927_0306889
476 Ga0373933_0000230
477 Ga0373933_0053343
478 Ga0373933_0087720
479 Ga0373947_0000450
480 Ga0373947_0087972
481 Ga0373947_0105398
482 Ga0373937_0000010
483 Ga0373937_0023500
484 Ga0373937_0119957
485 Ga0373937_0260805
486 Ga0373925_0015390
487 Ga0373925_0113558
488 Ga0395900_0407748
489 Ga0395898_0003436
490 Ga0395905_0090105
491 Ga0436364_0797116
492 Ga0436364_1044436
493 Ga0395901_0009032
494 Ga0395901_0048305
495 Ga0436365_0085734
496 Ga0436363_1021360
497 Ga0436362_0346627
498 Ga0451787_108881
499 Ga0451791_0347104
500 Ga0451793_0046820
501 Ga0451797_0152092
502 Ga0451795_0988715
503 Ga0451802_0683453
504 Ga0451837_1108925
505 Ga0451839_0663846
506 Ga0451847_0824435
507 Ga0451849_1563122
508 Ga0451843_1339351
509 Ga0466963_0320877
510 Ga0466960_0000079
511 Ga0495592_0000225
512 Ga0495592_0036046
513 Ga0495592_0046368
514 Ga0495592_0064767
515 Ga0495629_0002801
516 Ga0495629_0179670
517 Ga0495641_0006742
518 Ga0495641_0042115
519 Ga0495641_0109559
520 Ga0495651_0000166
521 Ga0495651_0006403
522 Ga0495651_0016424
523 Ga0495651_0033536
524 Ga0495651_0040931
525 Ga0495653_0015392
526 Ga0495653_0025502
527 Ga0495653_0308295
528 Ga0495582_0017634
529 Ga0495582_0018308
530 Ga0495639_0025760
531 Ga0495639_0103452
532 Ga0495662_0003771
533 Ga0495662_0098290
534 Ga0495664_0000542
535 Ga0495664_0018238
536 Ga0495594_0020733
537 Ga0495594_0234913
538 Ga0495608_0000292
539 Ga0495608_0011223
540 Ga0495608_0013553
541 Ga0495608_0049512
542 Ga0495608_0213806
543 Ga0495618_0008502
544 Ga0495618_0065801
545 Ga0495618_0440019
546 Ga0495628_0000535
547 Ga0495628_0027226
548 Ga0495628_0055673
549 Ga0495628_0197609
550 Ga0495628_0620756
551 Ga0495630_0030463
552 Ga0495630_0054124
553 Ga0495630_0263562
554 Ga0495666_0035603
555 Ga0495666_0199973
556 Ga0495652_0001880
557 Ga0495652_0018143
558 Ga0495652_0097874
559 Ga0495665_0036346
560 Ga0495665_0246763
561 Ga0495640_0030926
562 Ga0495586_0055675
563 Ga0495587_0000294
564 Ga0495587_0085850
565 Ga0495587_0141043
566 Ga0495587_0378065
567 Ga0495645_0028207
568 Ga0495645_0107605
569 Ga0495645_0133382
570 Ga0495645_0143012
571 Ga0495645_0173888
572 Ga0495645_0325914
573 Ga0495622_0136066
574 Ga0495667_0000064
575 Ga0495667_0010691
576 Ga0495667_0016533
577 Ga0495667_0034323
578 Ga0495634_0013531
579 Ga0495635_0001583
580 Ga0495635_0036829
581 Ga0495635_0216141
582 Ga0495657_0002352
583 Ga0495657_0350615
584 Ga0495599_0000179
585 Ga0495599_0014964
586 Ga0495599_0038118
587 Ga0495599_0190377
588 Ga0495623_0029880
589 Ga0495623_0035524
590 Ga0495623_0092378
591 Ga0495646_0016519
592 Ga0495646_0017759
593 Ga0495646_0045595
594 Ga0495646_0301190
595 Ga0495613_0016929
596 Ga0495624_0001511
597 Ga0495624_0025498
598 Ga0495624_0187619
599 Ga0495600_0007298
600 Ga0495600_0048204
601 Ga0495600_0055409
602 Ga0495600_0096753
603 Ga0495600_0183012
604 Ga0495581_0022148
605 Ga0495581_0575853
606 Ga0495604_0000245
607 Ga0495604_0042814
608 Ga0495604_0136889
609 Ga0495604_0195150
610 Ga0495604_0227329
611 Ga0495674_0001396
612 Ga0495674_0069301
613 Ga0495674_0141644
614 Ga0495674_0367873
615 Ga0495674_0470269
616 Ga0495676_0003980
617 Ga0495676_0271974
618 Ga0495680_0004678
619 Ga0495680_0009346
620 Ga0495680_0091366
621 Ga0495680_0092091
622 Ga0495680_0094319
623 Ga0495680_0226510
624 Ga0495675_0146443
625 Ga0495675_0277890
626 Ga0495684_0007161
627 Ga0495684_0007262
628 Ga0495684_0100014
629 Ga0495593_0042249
630 Ga0495593_0071697
631 Ga0495602_0129442
632 Ga0495602_0303184
633 Ga0495614_0019379
634 Ga0496100_0367345
635 Ga0496105_0461321
636 Ga0496106_0079053
637 Ga0496106_0152751
638 Ga0496109_0303810
639 Ga0496109_0485733
640 Ga0496109_0672880
641 Ga0496109_0834807
642 Ga0496111_0202693
643 Ga0496111_0458868
644 Ga0496114_0058703
645 Ga0496114_0166914
646 nmdc:mga06z11_68615_c1
647 nmdc:mga0qj67_148450_c1
648 Ga0495601_0003188
649 Ga0495601_0005692
650 Ga0495601_0021402
651 Ga0495601_0207047
652 Ga0495612_0000359
653 Ga0495612_0006774
654 Ga0495612_0147090
655 Ga0495595_0005396
656 Ga0495595_0006788
657 Ga0495595_0082836
658 Ga0495595_0101560
659 Ga0495619_0013425
660 Ga0495619_0081168
661 Ga0495619_0091840
662 Ga0495619_0112617
663 Ga0495619_0122335
664 Ga0495619_0203432
665 Ga0495619_0441188
666 Ga0587073_0007340
667 Ga0587090_013854
668 2676485572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.902 7 157
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.897 5 159
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8859 5 159
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.8815 7 160
2h1b-assembly2.cif.gz_B resa e80q 0.8783 8 156
ID Description Score Start End Superfamily
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.897 5 159 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8894 8 160 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8859 5 159 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8745 5 158 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8734 6 139 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A534NT50-F1-model_v4 Redoxin domain-containing protein 0.9965 1 107 GO:0016209
GO:0016491
AF-A0A534NT50-F1-model_v4 Redoxin domain-containing protein 0.9873 1 107 GO:0016209
GO:0016491
AF-A0A538NGE8-F1-model_v4 Redoxin domain-containing protein 0.9656 1 133 GO:0016209
GO:0016491
AF-A0A7W0X9U1-F1-model_v4 Redoxin domain-containing protein 0.9525 5 165 GO:0016209
GO:0016491
AF-A0A538NGE8-F1-model_v4 Redoxin domain-containing protein 0.9516 1 133 GO:0016209
GO:0016491

Map