F411641
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 204 | 313 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100085062|Ga0070670_1000850622 |
| Length | 366 |
| Sequence | MRFGPGHVFAMSRPFCHTFPSVFSALMSDILVFIEHRNCVLNKTSLEAIAAAQSIAKDLGLKASAVIPCDKDCSLAQDISGYDLEKVIVVKNPKLATYTPDAYADAWEQIIKSESPKYVVMSHTYQVRDFAPKVAARLGREVVGDCIRYRTTPSAEAAATPPATGGEPKKLVLTRRIFLGKLDADVTIGGDAPYFVTFQSGSFRGDNAAKGSASVESVDVTVGDVRMTPEEPFQEAKASVDLTKSEIIVAVGRGIKSQENIALAQQLADALGADLAASRPICDADWLPIDRQIGSSGQTVAPKVYIALGISGAIQHIVGMKNAGTIIAINKDAEAPIFDIADYGVAGDLFEAVPVMIEEIKKAKGN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 2 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 3 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 4 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 5 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 6 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 7 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 8 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 9 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 10 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 11 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 12 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 13 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 14 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 15 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 16 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 17 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 18 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 19 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 20 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 21 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 191 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 192 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 193 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 201 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 202 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.41 |
| Metatranscriptomes | 0.3 |
| Isolates | 6.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.9 |
| Nodule | 0.9 |
| Rhizoplane | 4.49 |
| Rhizosphere | 88.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000102 | 3300000549 | Bacteria | 14977 |
| 2 | JGI25406J46586_10000855 | 3300003203 | Bacteria | 14349 |
| 3 | Ga0006562J51391_1009572 | 3300003578 | Bacteria | 3810 |
| 4 | Ga0065715_10160330 | 3300005293 | Bacteria | 1636 |
| 5 | Ga0065715_10172605 | 3300005293 | Bacteria | 1535 |
| 6 | Ga0065707_10094889 | 3300005295 | Bacteria | 3439 |
| 7 | Ga0065707_10117943 | 3300005295 | Bacteria | 2198 |
| 8 | Ga0070676_10152549 | 3300005328 | Bacteria | 1480 |
| 9 | Ga0070690_100012457 | 3300005330 | Bacteria | 5002 |
| 10 | Ga0070670_100025579 | 3300005331 | Bacteria | 5078 |
| 11 | Ga0070670_100048835 | 3300005331 | Unclassified | 3641 |
| 12 | Ga0070670_100085062 | 3300005331 | Unclassified | 2717 |
| 13 | Ga0068869_100337751 | 3300005334 | Bacteria | 1225 |
| 14 | Ga0070680_100270506 | 3300005336 | Bacteria | 1439 |
| 15 | Ga0068868_100238195 | 3300005338 | Bacteria | 1528 |
| 16 | Ga0070660_100097964 | 3300005339 | Bacteria | 2320 |
| 17 | Ga0070661_100095408 | 3300005344 | Bacteria | 2206 |
| 18 | Ga0070668_100069167 | 3300005347 | Bacteria | 2746 |
| 19 | Ga0070668_100155334 | 3300005347 | Bacteria | 1853 |
| 20 | Ga0070675_100009774 | 3300005354 | Bacteria | 7472 |
| 21 | Ga0070675_100249721 | 3300005354 | Bacteria | 1552 |
| 22 | Ga0070674_100024943 | 3300005356 | Bacteria | 3885 |
| 23 | Ga0070674_100370456 | 3300005356 | Bacteria | 1162 |
| 24 | Ga0070673_100014248 | 3300005364 | Bacteria | 5530 |
| 25 | Ga0070673_100298319 | 3300005364 | Bacteria | 1418 |
| 26 | Ga0070673_100366546 | 3300005364 | Unclassified | 1282 |
| 27 | Ga0070659_100366028 | 3300005366 | Bacteria | 1212 |
| 28 | Ga0070667_100007147 | 3300005367 | Bacteria | 9279 |
| 29 | Ga0070667_100082849 | 3300005367 | Bacteria | 2747 |
| 30 | Ga0070667_100160031 | 3300005367 | Bacteria | 1983 |
| 31 | Ga0070703_10000104 | 3300005406 | Bacteria | 43743 |
| 32 | Ga0070709_10000001 | 3300005434 | Bacteria | 412391 |
| 33 | Ga0070711_100000020 | 3300005439 | Bacteria | 127708 |
| 34 | Ga0070705_100000038 | 3300005440 | Bacteria | 66622 |
| 35 | Ga0070663_100042251 | 3300005455 | Bacteria | 3203 |
| 36 | Ga0070678_100004297 | 3300005456 | Bacteria | 8055 |
| 37 | Ga0070678_100157673 | 3300005456 | Bacteria | 1835 |
| 38 | Ga0070681_10009095 | 3300005458 | Bacteria | 9761 |
| 39 | Ga0070681_10043353 | 3300005458 | Bacteria | 4508 |
| 40 | Ga0070706_100000007 | 3300005467 | Bacteria | 228014 |
| 41 | Ga0070698_100198715 | 3300005471 | Bacteria | 1941 |
| 42 | Ga0070699_100000420 | 3300005518 | Bacteria | 40683 |
| 43 | Ga0070679_100116708 | 3300005530 | Unclassified | 2654 |
| 44 | Ga0070697_100000071 | 3300005536 | Bacteria | 80945 |
| 45 | Ga0068853_100003250 | 3300005539 | Bacteria | 12421 |
| 46 | Ga0068853_100025323 | 3300005539 | Bacteria | 4978 |
| 47 | Ga0070672_100191647 | 3300005543 | Bacteria | 1707 |
| 48 | Ga0070672_100349603 | 3300005543 | Bacteria | 1260 |
| 49 | Ga0070696_100000117 | 3300005546 | Bacteria | 41248 |
| 50 | Ga0070693_100014877 | 3300005547 | Bacteria | 3998 |
| 51 | Ga0070693_100113905 | 3300005547 | Bacteria | 1668 |
| 52 | Ga0070704_100019701 | 3300005549 | Bacteria | 4340 |
| 53 | Ga0070664_100006021 | 3300005564 | Bacteria | 9805 |
| 54 | Ga0070664_100431808 | 3300005564 | Bacteria | 1207 |
| 55 | Ga0068857_100469526 | 3300005577 | Bacteria | 1178 |
| 56 | Ga0068859_100012143 | 3300005617 | Bacteria | 8656 |
| 57 | Ga0068859_100109200 | 3300005617 | Unclassified | 2827 |
| 58 | Ga0068859_100121148 | 3300005617 | Bacteria | 2682 |
| 59 | Ga0068859_100247267 | 3300005617 | Unclassified | 1873 |
| 60 | Ga0068864_100029960 | 3300005618 | Bacteria | 4612 |
| 61 | Ga0068864_100032244 | 3300005618 | Bacteria | 4450 |
| 62 | Ga0068864_100134861 | 3300005618 | Unclassified | 2222 |
| 63 | Ga0068864_100174530 | 3300005618 | Unclassified | 1961 |
| 64 | Ga0068866_10072108 | 3300005718 | Bacteria | 1829 |
| 65 | Ga0068861_100130505 | 3300005719 | Bacteria | 2039 |
| 66 | Ga0068851_10086068 | 3300005834 | Bacteria | 1648 |
| 67 | Ga0068863_100396055 | 3300005841 | Bacteria | 1350 |
| 68 | Ga0068858_100025469 | 3300005842 | Bacteria | 5504 |
| 69 | Ga0068858_100107080 | 3300005842 | Unclassified | 2609 |
| 70 | Ga0068860_100030238 | 3300005843 | Bacteria | 5208 |
| 71 | Ga0068860_100066642 | 3300005843 | Bacteria | 3420 |
| 72 | Ga0068862_100091380 | 3300005844 | Bacteria | 2651 |
| 73 | Ga0081539_10001016 | 3300005985 | Bacteria | 51656 |
| 74 | Ga0081539_10001250 | 3300005985 | Bacteria | 45064 |
| 75 | Ga0097621_100138055 | 3300006237 | Bacteria | 2081 |
| 76 | Ga0097621_100487954 | 3300006237 | Bacteria | 1114 |
| 77 | Ga0068871_100267251 | 3300006358 | Bacteria | 1493 |
| 78 | Ga0075433_10256525 | 3300006852 | Unclassified | 1551 |
| 79 | Ga0075429_100017885 | 3300006880 | Bacteria | 6129 |
| 80 | Ga0075436_100000161 | 3300006914 | Bacteria | 41699 |
| 81 | Ga0075436_100173724 | 3300006914 | Bacteria | 1521 |
| 82 | Ga0097620_100012143 | 3300006931 | Bacteria | 8656 |
| 83 | Ga0097620_100109201 | 3300006931 | Unclassified | 2827 |
| 84 | Ga0097620_100121146 | 3300006931 | Bacteria | 2682 |
| 85 | Ga0097620_100247267 | 3300006931 | Unclassified | 1873 |
| 86 | Ga0111539_10115266 | 3300009094 | Bacteria | 3151 |
| 87 | Ga0114129_10025325 | 3300009147 | Bacteria | 8406 |
| 88 | Ga0114129_10027692 | 3300009147 | Bacteria | 8023 |
| 89 | Ga0114129_10090244 | 3300009147 | Bacteria | 4248 |
| 90 | Ga0114129_10159511 | 3300009147 | Bacteria | 3083 |
| 91 | Ga0114129_10756682 | 3300009147 | Bacteria | 1243 |
| 92 | Ga0114129_10837144 | 3300009147 | Bacteria | 1171 |
| 93 | Ga0105243_10120094 | 3300009148 | Unclassified | 2214 |
| 94 | Ga0105242_10064603 | 3300009176 | Bacteria | 3018 |
| 95 | Ga0105248_10120767 | 3300009177 | Bacteria | 2956 |
| 96 | Ga0105248_10328385 | 3300009177 | Bacteria | 1723 |
| 97 | Ga0105249_10040676 | 3300009553 | Bacteria | 4223 |
| 98 | Ga0105249_10055853 | 3300009553 | Bacteria | 3614 |
| 99 | Ga0105249_10117782 | 3300009553 | Bacteria | 2519 |
| 100 | Ga0105249_10217997 | 3300009553 | Unclassified | 1876 |
| 101 | Ga0105239_10009920 | 3300010375 | Bacteria | 10696 |
| 102 | Ga0105239_10534575 | 3300010375 | Bacteria | 1334 |
| 103 | Ga0157373_10355010 | 3300013100 | Bacteria | 1046 |
| 104 | Ga0157369_10078113 | 3300013105 | Bacteria | 3547 |
| 105 | Ga0157369_10110734 | 3300013105 | Bacteria | 2919 |
| 106 | Ga0157378_10069379 | 3300013297 | Bacteria | 3162 |
| 107 | Ga0157378_10119126 | 3300013297 | Bacteria | 2431 |
| 108 | Ga0163162_10000890 | 3300013306 | Bacteria | 27792 |
| 109 | Ga0163162_10207008 | 3300013306 | Bacteria | 2091 |
| 110 | Ga0163162_10303769 | 3300013306 | Bacteria | 1728 |
| 111 | Ga0163162_10407352 | 3300013306 | Unclassified | 1493 |
| 112 | Ga0163162_10498837 | 3300013306 | Bacteria | 1348 |
| 113 | Ga0157372_10038819 | 3300013307 | Bacteria | 5254 |
| 114 | Ga0157372_10250124 | 3300013307 | Bacteria | 2057 |
| 115 | Ga0157372_10291591 | 3300013307 | Archaea | 1897 |
| 116 | Ga0157372_10453656 | 3300013307 | Bacteria | 1494 |
| 117 | Ga0157372_10471442 | 3300013307 | Bacteria | 1463 |
| 118 | Ga0157375_10013631 | 3300013308 | Bacteria | 7245 |
| 119 | Ga0157375_10025012 | 3300013308 | Bacteria | 5538 |
| 120 | Ga0157375_10034072 | 3300013308 | Bacteria | 4847 |
| 121 | Ga0157375_10081534 | 3300013308 | Bacteria | 3275 |
| 122 | Ga0163163_10007699 | 3300014325 | Bacteria | 9518 |
| 123 | Ga0163163_10063178 | 3300014325 | Bacteria | 3671 |
| 124 | Ga0157380_10016098 | 3300014326 | Bacteria | 5509 |
| 125 | Ga0157380_10172688 | 3300014326 | Bacteria | 1890 |
| 126 | Ga0157380_10602344 | 3300014326 | Bacteria | 1087 |
| 127 | Ga0157377_10016856 | 3300014745 | Unclassified | 3767 |
| 128 | Ga0157379_10067664 | 3300014968 | Unclassified | 3192 |
| 129 | Ga0157379_10221789 | 3300014968 | Bacteria | 1713 |
| 130 | Ga0163161_10018515 | 3300017792 | Bacteria | 4879 |
| 131 | Ga0163161_10034425 | 3300017792 | Bacteria | 3624 |
| 132 | Ga0163161_10071175 | 3300017792 | Bacteria | 2544 |
| 133 | Ga0213876_10010703 | 3300021384 | Bacteria | 4914 |
| 134 | Ga0209147_100050 | 3300025229 | Bacteria | 274639 |
| 135 | Ga0207653_10000064 | 3300025885 | Bacteria | 81445 |
| 136 | Ga0207699_10000004 | 3300025906 | Bacteria | 567333 |
| 137 | Ga0207705_10009008 | 3300025909 | Bacteria | 7270 |
| 138 | Ga0207684_10006625 | 3300025910 | Bacteria | 10529 |
| 139 | Ga0207707_10005199 | 3300025912 | Bacteria | 11406 |
| 140 | Ga0207707_10054256 | 3300025912 | Bacteria | 3489 |
| 141 | Ga0207695_10186960 | 3300025913 | Bacteria | 1990 |
| 142 | Ga0207663_10000202 | 3300025916 | Bacteria | 26671 |
| 143 | Ga0207657_10207187 | 3300025919 | Bacteria | 1575 |
| 144 | Ga0207649_10127473 | 3300025920 | Bacteria | 1724 |
| 145 | Ga0207652_10098302 | 3300025921 | Bacteria | 2581 |
| 146 | Ga0207650_10062495 | 3300025925 | Unclassified | 2782 |
| 147 | Ga0207650_10098293 | 3300025925 | Unclassified | 2248 |
| 148 | Ga0207659_10153334 | 3300025926 | Bacteria | 1801 |
| 149 | Ga0207659_10166437 | 3300025926 | Bacteria | 1735 |
| 150 | Ga0207644_10062290 | 3300025931 | Unclassified | 2705 |
| 151 | Ga0207706_10028747 | 3300025933 | Bacteria | 4963 |
| 152 | Ga0207686_10071294 | 3300025934 | Bacteria | 2235 |
| 153 | Ga0207669_10064187 | 3300025937 | Bacteria | 2271 |
| 154 | Ga0207665_10059625 | 3300025939 | Bacteria | 2583 |
| 155 | Ga0207691_10184354 | 3300025940 | Bacteria | 1822 |
| 156 | Ga0207691_10202415 | 3300025940 | Bacteria | 1727 |
| 157 | Ga0207711_10045197 | 3300025941 | Bacteria | 3763 |
| 158 | Ga0207711_10125535 | 3300025941 | Bacteria | 2295 |
| 159 | Ga0207679_10066910 | 3300025945 | Bacteria | 2694 |
| 160 | Ga0207679_10069282 | 3300025945 | Bacteria | 2654 |
| 161 | Ga0207667_10035971 | 3300025949 | Bacteria | 5310 |
| 162 | Ga0207651_10048977 | 3300025960 | Bacteria | 2860 |
| 163 | Ga0207651_10113420 | 3300025960 | Unclassified | 2040 |
| 164 | Ga0207712_10007967 | 3300025961 | Bacteria | 6697 |
| 165 | Ga0207712_10101434 | 3300025961 | Bacteria | 2140 |
| 166 | Ga0207712_10239835 | 3300025961 | Unclassified | 1460 |
| 167 | Ga0207640_10119946 | 3300025981 | Bacteria | 1882 |
| 168 | Ga0207640_10167095 | 3300025981 | Bacteria | 1635 |
| 169 | Ga0207658_10008601 | 3300025986 | Bacteria | 6946 |
| 170 | Ga0207658_10097816 | 3300025986 | Bacteria | 2292 |
| 171 | Ga0207639_10002398 | 3300026041 | Bacteria | 12573 |
| 172 | Ga0207678_10076548 | 3300026067 | Bacteria | 2866 |
| 173 | Ga0207708_10335333 | 3300026075 | Bacteria | 1237 |
| 174 | Ga0207641_10063081 | 3300026088 | Bacteria | 3164 |
| 175 | Ga0207641_10133050 | 3300026088 | Bacteria | 2235 |
| 176 | Ga0207676_10006084 | 3300026095 | Bacteria | 8517 |
| 177 | Ga0207676_10074586 | 3300026095 | Bacteria | 2734 |
| 178 | Ga0207674_10461368 | 3300026116 | Bacteria | 1228 |
| 179 | Ga0207683_10023519 | 3300026121 | Bacteria | 5301 |
| 180 | Ga0207683_10192923 | 3300026121 | Bacteria | 1850 |
| 181 | Ga0207683_10204172 | 3300026121 | Bacteria | 1797 |
| 182 | Ga0268265_10045264 | 3300028380 | Bacteria | 3283 |
| 183 | Ga0268264_10013110 | 3300028381 | Bacteria | 6817 |
| 184 | Ga0268264_10051732 | 3300028381 | Bacteria | 3424 |
| 185 | Ga0268264_10411490 | 3300028381 | Bacteria | 1302 |
| 186 | Ga0307513_10008476 | 3300031456 | Bacteria | 13139 |
| 187 | Ga0307408_100030470 | 3300031548 | Bacteria | 3746 |
| 188 | Ga0307408_100065525 | 3300031548 | Bacteria | 2664 |
| 189 | Ga0307408_100077209 | 3300031548 | Bacteria | 2480 |
| 190 | Ga0307408_100120961 | 3300031548 | Bacteria | 2028 |
| 191 | Ga0307408_100167565 | 3300031548 | Bacteria | 1751 |
| 192 | Ga0307405_10015059 | 3300031731 | Bacteria | 4176 |
| 193 | Ga0307405_10053119 | 3300031731 | Bacteria | 2522 |
| 194 | Ga0307405_10093325 | 3300031731 | Bacteria | 1999 |
| 195 | Ga0307405_10131692 | 3300031731 | Bacteria | 1729 |
| 196 | Ga0307413_10031326 | 3300031824 | Bacteria | 3000 |
| 197 | Ga0307413_10093860 | 3300031824 | Bacteria | 1962 |
| 198 | Ga0307413_10123079 | 3300031824 | Unclassified | 1761 |
| 199 | Ga0307413_10130988 | 3300031824 | Bacteria | 1716 |
| 200 | Ga0307410_10001672 | 3300031852 | Bacteria | 10211 |
| 201 | Ga0307410_10002195 | 3300031852 | Bacteria | 9293 |
| 202 | Ga0307410_10037540 | 3300031852 | Bacteria | 3165 |
| 203 | Ga0307410_10041105 | 3300031852 | Bacteria | 3047 |
| 204 | Ga0307410_10079015 | 3300031852 | Bacteria | 2304 |
| 205 | Ga0307410_10140393 | 3300031852 | Bacteria | 1787 |
| 206 | Ga0307406_10036550 | 3300031901 | Bacteria | 3027 |
| 207 | Ga0307406_10092244 | 3300031901 | Bacteria | 2042 |
| 208 | Ga0307406_10193680 | 3300031901 | Archaea | 1490 |
| 209 | Ga0307406_10437287 | 3300031901 | Bacteria | 1046 |
| 210 | Ga0307407_10001250 | 3300031903 | Bacteria | 9055 |
| 211 | Ga0307407_10001410 | 3300031903 | Bacteria | 8678 |
| 212 | Ga0307407_10016425 | 3300031903 | Bacteria | 3685 |
| 213 | Ga0307407_10017349 | 3300031903 | Bacteria | 3609 |
| 214 | Ga0307412_10072984 | 3300031911 | Bacteria | 2347 |
| 215 | Ga0307412_10157555 | 3300031911 | Bacteria | 1683 |
| 216 | Ga0307412_10161189 | 3300031911 | Bacteria | 1667 |
| 217 | Ga0307409_100004310 | 3300031995 | Bacteria | 7964 |
| 218 | Ga0307409_100047011 | 3300031995 | Bacteria | 3271 |
| 219 | Ga0307409_100085848 | 3300031995 | Bacteria | 2560 |
| 220 | Ga0307409_100100901 | 3300031995 | Bacteria | 2393 |
| 221 | Ga0307409_100134291 | 3300031995 | Bacteria | 2120 |
| 222 | Ga0307409_100185577 | 3300031995 | Bacteria | 1846 |
| 223 | Ga0307409_100367537 | 3300031995 | Bacteria | 1363 |
| 224 | Ga0307416_100029184 | 3300032002 | Bacteria | 4116 |
| 225 | Ga0307416_100040723 | 3300032002 | Bacteria | 3612 |
| 226 | Ga0307416_100054128 | 3300032002 | Bacteria | 3224 |
| 227 | Ga0307416_100067915 | 3300032002 | Bacteria | 2943 |
| 228 | Ga0307414_10012889 | 3300032004 | Bacteria | 4962 |
| 229 | Ga0307411_10005863 | 3300032005 | Bacteria | 6089 |
| 230 | Ga0307411_10005901 | 3300032005 | Bacteria | 6076 |
| 231 | Ga0307411_10011255 | 3300032005 | Bacteria | 4817 |
| 232 | Ga0307411_10216705 | 3300032005 | Bacteria | 1482 |
| 233 | Ga0307411_10247879 | 3300032005 | Bacteria | 1399 |
| 234 | Ga0307415_100018753 | 3300032126 | Bacteria | 4186 |
| 235 | Ga0395905_0000024 | 3300037471 | Bacteria | 318806 |
| 236 | Ga0436365_1540433 | 3300039437 | Bacteria | 5153 |
| 237 | Ga0495592_0218714 | 3300046454 | Bacteria | 1275 |
| 238 | Ga0495603_0112282 | 3300046455 | Bacteria | 1589 |
| 239 | Ga0495638_0000812 | 3300046460 | Bacteria | 32935 |
| 240 | Ga0495580_0005813 | 3300046472 | Bacteria | 10126 |
| 241 | Ga0495605_0001075 | 3300046474 | Bacteria | 18197 |
| 242 | Ga0495664_0054870 | 3300046477 | Bacteria | 2370 |
| 243 | Ga0495583_0025482 | 3300046506 | Bacteria | 2954 |
| 244 | Ga0495583_0026969 | 3300046506 | Bacteria | 2840 |
| 245 | Ga0495616_0061695 | 3300046513 | Bacteria | 1838 |
| 246 | Ga0495632_0035227 | 3300046519 | Bacteria | 2556 |
| 247 | Ga0495665_0029915 | 3300046531 | Bacteria | 2916 |
| 248 | Ga0495665_0035706 | 3300046531 | Bacteria | 2655 |
| 249 | Ga0495645_0008242 | 3300046543 | Bacteria | 7268 |
| 250 | Ga0495668_0008270 | 3300046616 | Bacteria | 6517 |
| 251 | Ga0495668_0212096 | 3300046616 | Bacteria | 1060 |
| 252 | Ga0495670_0001264 | 3300046691 | Bacteria | 12378 |
| 253 | Ga0495671_0026291 | 3300046692 | Bacteria | 3019 |
| 254 | Ga0495589_0000541 | 3300046794 | Bacteria | 26355 |
| 255 | Ga0495660_0067308 | 3300046810 | Bacteria | 1908 |
| 256 | Ga0495660_0129143 | 3300046810 | Bacteria | 1270 |
| 257 | Ga0495604_0056491 | 3300047317 | Bacteria | 3021 |
| 258 | Ga0495674_0009895 | 3300047319 | Bacteria | 9047 |
| 259 | Ga0495674_0011375 | 3300047319 | Bacteria | 8399 |
| 260 | Ga0495672_0015341 | 3300047320 | Bacteria | 5205 |
| 261 | Ga0495676_0211428 | 3300047321 | Unclassified | 1342 |
| 262 | Ga0495683_0036869 | 3300047323 | Bacteria | 2481 |
| 263 | Ga0495687_057372 | 3300047443 | Bacteria | 1619 |
| 264 | Ga0495677_0055039 | 3300047445 | Bacteria | 1468 |
| 265 | Ga0495685_020530 | 3300047447 | Bacteria | 2271 |
| 266 | Ga0495673_0047349 | 3300047469 | Bacteria | 1900 |
| 267 | Ga0495626_0019575 | 3300048091 | Bacteria | 3385 |
| 268 | Ga0495626_0039946 | 3300048091 | Bacteria | 2218 |
| 269 | Ga0496100_0006304 | 3300048903 | Bacteria | 6462 |
| 270 | Ga0496100_0025577 | 3300048903 | Bacteria | 3612 |
| 271 | Ga0496101_0012993 | 3300048904 | Bacteria | 5569 |
| 272 | Ga0496102_0070775 | 3300048905 | Bacteria | 3203 |
| 273 | Ga0496102_0187768 | 3300048905 | Bacteria | 1948 |
| 274 | Ga0496102_0254255 | 3300048905 | Bacteria | 1656 |
| 275 | Ga0496104_0106754 | 3300048907 | Bacteria | 2683 |
| 276 | Ga0496104_0117740 | 3300048907 | Bacteria | 2550 |
| 277 | Ga0496105_0019494 | 3300048908 | Bacteria | 5471 |
| 278 | Ga0496105_0097319 | 3300048908 | Bacteria | 2431 |
| 279 | Ga0496106_0037606 | 3300048909 | Bacteria | 3622 |
| 280 | Ga0496107_0058271 | 3300048910 | Bacteria | 2793 |
| 281 | Ga0496109_0009678 | 3300048912 | Bacteria | 8225 |
| 282 | Ga0496111_0067282 | 3300048914 | Bacteria | 2603 |
| 283 | Ga0496112_0483907 | 3300048915 | Unclassified | 1174 |
| 284 | Ga0496121_0021961 | 3300048924 | Bacteria | 6222 |
| 285 | Ga0496121_0044446 | 3300048924 | Bacteria | 3831 |
| 286 | Ga0495678_041493 | 3300049459 | Bacteria | 1841 |
| 287 | Ga0495682_0048418 | 3300049460 | Bacteria | 1549 |
| 288 | Ga0501041_0019911 | 3300049577 | Bacteria | 4009 |
| 289 | Ga0501042_0018747 | 3300049578 | Bacteria | 4796 |
| 290 | Ga0501046_0191567 | 3300049580 | Bacteria | 1525 |
| 291 | Ga0501072_0016435 | 3300049588 | Bacteria | 5682 |
| 292 | Ga0501072_0135685 | 3300049588 | Bacteria | 1962 |
| 293 | Ga0501075_0005685 | 3300049591 | Bacteria | 8536 |
| 294 | Ga0501076_0401880 | 3300049592 | Bacteria | 1126 |
| 295 | Ga0501077_0020978 | 3300049593 | Bacteria | 4134 |
| 296 | Ga0501217_011286 | 3300049661 | Bacteria | 1974 |
| 297 | Ga0501249_012228 | 3300049679 | Bacteria | 1812 |
| 298 | Ga0501225_0025592 | 3300049705 | Bacteria | 1623 |
| 299 | Ga0501081_0020913 | 3300049743 | Bacteria | 4367 |
| 300 | Ga0501035_0202085 | 3300049822 | Bacteria | 1704 |
| 301 | nmdc:mga05p37_125144_c1 | 3300050507 | Bacteria | 3157 |
| 302 | nmdc:mga05p37_169491_c1 | 3300050507 | Bacteria | 2663 |
| 303 | nmdc:mga05p37_3771_c1 | 3300050507 | Bacteria | 17740 |
| 304 | nmdc:mga09592_32211_c1 | 3300050508 | Bacteria | 4370 |
| 305 | nmdc:mga08y16_234716_c1 | 3300050511 | Unclassified | 1897 |
| 306 | nmdc:mga08x19_33_c1 | 3300050514 | Bacteria | 203200 |
| 307 | nmdc:mga0a205_337920_c1 | 3300050515 | Unclassified | 1375 |
| 308 | nmdc:mga0a205_38328_c1 | 3300050515 | Bacteria | 4610 |
| 309 | nmdc:mga0a205_411510_c1 | 3300050515 | Bacteria | 1215 |
| 310 | Ga0500577_0000972 | 3300053142 | Bacteria | 7392 |
| 311 | Ga0500616_0000961 | 3300053153 | Bacteria | 31238 |
| 312 | Ga0501084_0194521 | 3300054114 | Unclassified | 1711 |
| 313 | Ga0501082_0013491 | 3300060353 | Bacteria | 7020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046477 | Ga0495664_0054870 | Ga0495664_0054870_1521_2360 | 276 |
| 2 | 3300046455 | Ga0495603_0112282 | Ga0495603_0112282_23_931 | 299 |
| 3 | 3300048910 | Ga0496107_0058271 | Ga0496107_0058271_1848_2756 | 299 |
| 4 | 3300049460 | Ga0495682_0048418 | Ga0495682_0048418_603_1511 | 299 |
| 5 | iso_pu_bacteria | 2513237166 | 2514050341 | 309 |
| 6 | iso_pu_bacteria | 642555112 | 642597664 | 309 |
| 7 | 3300048912 | Ga0496109_0009678 | Ga0496109_0009678_2384_3319 | 310 |
| 8 | 3300048914 | Ga0496111_0067282 | Ga0496111_0067282_1288_2223 | 310 |
| 9 | 3300005336 | Ga0070680_100270506 | Ga0070680_1002705061 | 312 |
| 10 | 3300005406 | Ga0070703_10000104 | Ga0070703_1000010411 | 312 |
| 11 | 3300050515 | nmdc:mga0a205_337920_c1 | nmdc:mga0a205_337920_c1_108_1061 | 312 |
| 12 | iso_pu_bacteria | 2711768613 | 2713476207 | 312 |
| 13 | iso_pu_bacteria | 2751185846 | 2753568269 | 312 |
| 14 | iso_pu_bacteria | 2904615490 | 2904616365 | 312 |
| 15 | 3300037471 | Ga0395905_0000024 | Ga0395905_0000024_117043_117993 | 313 |
| 16 | 3300005347 | Ga0070668_100069167 | Ga0070668_1000691672 | 316 |
| 17 | 3300005367 | Ga0070667_100082849 | Ga0070667_1000828493 | 316 |
| 18 | 3300005455 | Ga0070663_100042251 | Ga0070663_1000422513 | 316 |
| 19 | 3300005456 | Ga0070678_100157673 | Ga0070678_1001576732 | 316 |
| 20 | 3300013306 | Ga0163162_10000890 | Ga0163162_100008905 | 316 |
| 21 | 3300013308 | Ga0157375_10013631 | Ga0157375_100136313 | 316 |
| 22 | 3300025926 | Ga0207659_10153334 | Ga0207659_101533342 | 316 |
| 23 | 3300026067 | Ga0207678_10076548 | Ga0207678_100765483 | 316 |
| 24 | 3300026121 | Ga0207683_10204172 | Ga0207683_102041722 | 316 |
| 25 | 3300046454 | Ga0495592_0218714 | Ga0495592_0218714_205_1164 | 316 |
| 26 | 3300046460 | Ga0495638_0000812 | Ga0495638_0000812_28565_29524 | 316 |
| 27 | 3300046472 | Ga0495580_0005813 | Ga0495580_0005813_6081_7040 | 316 |
| 28 | 3300046474 | Ga0495605_0001075 | Ga0495605_0001075_12879_13838 | 316 |
| 29 | 3300046506 | Ga0495583_0025482 | Ga0495583_0025482_330_1289 | 316 |
| 30 | 3300046506 | Ga0495583_0026969 | Ga0495583_0026969_1711_2670 | 316 |
| 31 | 3300046513 | Ga0495616_0061695 | Ga0495616_0061695_176_1135 | 316 |
| 32 | 3300046531 | Ga0495665_0029915 | Ga0495665_0029915_1415_2374 | 316 |
| 33 | 3300046531 | Ga0495665_0035706 | Ga0495665_0035706_950_1909 | 316 |
| 34 | 3300046543 | Ga0495645_0008242 | Ga0495645_0008242_2375_3334 | 316 |
| 35 | 3300046616 | Ga0495668_0212096 | Ga0495668_0212096_32_991 | 316 |
| 36 | 3300046691 | Ga0495670_0001264 | Ga0495670_0001264_3637_4596 | 316 |
| 37 | 3300046692 | Ga0495671_0026291 | Ga0495671_0026291_1571_2530 | 316 |
| 38 | 3300046794 | Ga0495589_0000541 | Ga0495589_0000541_11757_12716 | 316 |
| 39 | 3300046810 | Ga0495660_0129143 | Ga0495660_0129143_87_1046 | 316 |
| 40 | 3300047317 | Ga0495604_0056491 | Ga0495604_0056491_970_1929 | 316 |
| 41 | 3300047319 | Ga0495674_0009895 | Ga0495674_0009895_4638_5597 | 316 |
| 42 | 3300047319 | Ga0495674_0011375 | Ga0495674_0011375_5529_6488 | 316 |
| 43 | 3300047320 | Ga0495672_0015341 | Ga0495672_0015341_1031_1990 | 316 |
| 44 | 3300047323 | Ga0495683_0036869 | Ga0495683_0036869_812_1771 | 316 |
| 45 | 3300047443 | Ga0495687_057372 | Ga0495687_057372_116_1075 | 316 |
| 46 | 3300047445 | Ga0495677_0055039 | Ga0495677_0055039_65_1024 | 316 |
| 47 | 3300047447 | Ga0495685_020530 | Ga0495685_020530_521_1480 | 316 |
| 48 | 3300047469 | Ga0495673_0047349 | Ga0495673_0047349_611_1570 | 316 |
| 49 | 3300048091 | Ga0495626_0019575 | Ga0495626_0019575_659_1618 | 316 |
| 50 | 3300048091 | Ga0495626_0039946 | Ga0495626_0039946_544_1503 | 316 |
| 51 | 3300048903 | Ga0496100_0006304 | Ga0496100_0006304_3483_4442 | 316 |
| 52 | 3300048903 | Ga0496100_0025577 | Ga0496100_0025577_1482_2441 | 316 |
| 53 | 3300048904 | Ga0496101_0012993 | Ga0496101_0012993_1705_2664 | 316 |
| 54 | 3300048905 | Ga0496102_0070775 | Ga0496102_0070775_538_1497 | 316 |
| 55 | 3300048905 | Ga0496102_0254255 | Ga0496102_0254255_595_1554 | 316 |
| 56 | 3300048907 | Ga0496104_0106754 | Ga0496104_0106754_1476_2435 | 316 |
| 57 | 3300048907 | Ga0496104_0117740 | Ga0496104_0117740_1376_2335 | 316 |
| 58 | 3300048908 | Ga0496105_0019494 | Ga0496105_0019494_1907_2866 | 316 |
| 59 | 3300048908 | Ga0496105_0097319 | Ga0496105_0097319_461_1420 | 316 |
| 60 | 3300048909 | Ga0496106_0037606 | Ga0496106_0037606_2016_2975 | 316 |
| 61 | 3300048924 | Ga0496121_0021961 | Ga0496121_0021961_249_1208 | 316 |
| 62 | 3300048924 | Ga0496121_0044446 | Ga0496121_0044446_1679_2638 | 316 |
| 63 | 3300049459 | Ga0495678_041493 | Ga0495678_041493_504_1463 | 316 |
| 64 | 3300049822 | Ga0501035_0202085 | Ga0501035_0202085_494_1456 | 317 |
| 65 | 3300005293 | Ga0065715_10160330 | Ga0065715_101603301 | 322 |
| 66 | 3300005293 | Ga0065715_10172605 | Ga0065715_101726052 | 322 |
| 67 | 3300005328 | Ga0070676_10152549 | Ga0070676_101525492 | 322 |
| 68 | 3300005330 | Ga0070690_100012457 | Ga0070690_1000124573 | 322 |
| 69 | 3300005331 | Ga0070670_100025579 | Ga0070670_1000255795 | 322 |
| 70 | 3300005331 | Ga0070670_100048835 | Ga0070670_1000488353 | 322 |
| 71 | 3300005334 | Ga0068869_100337751 | Ga0068869_1003377511 | 322 |
| 72 | 3300005338 | Ga0068868_100238195 | Ga0068868_1002381952 | 322 |
| 73 | 3300005339 | Ga0070660_100097964 | Ga0070660_1000979642 | 322 |
| 74 | 3300005344 | Ga0070661_100095408 | Ga0070661_1000954083 | 322 |
| 75 | 3300005347 | Ga0070668_100155334 | Ga0070668_1001553342 | 322 |
| 76 | 3300005354 | Ga0070675_100009774 | Ga0070675_1000097749 | 322 |
| 77 | 3300005354 | Ga0070675_100249721 | Ga0070675_1002497211 | 322 |
| 78 | 3300005356 | Ga0070674_100024943 | Ga0070674_1000249435 | 322 |
| 79 | 3300005364 | Ga0070673_100014248 | Ga0070673_1000142482 | 322 |
| 80 | 3300005364 | Ga0070673_100298319 | Ga0070673_1002983192 | 322 |
| 81 | 3300005366 | Ga0070659_100366028 | Ga0070659_1003660281 | 322 |
| 82 | 3300005367 | Ga0070667_100007147 | Ga0070667_1000071474 | 322 |
| 83 | 3300005367 | Ga0070667_100160031 | Ga0070667_1001600312 | 322 |
| 84 | 3300005456 | Ga0070678_100004297 | Ga0070678_1000042978 | 322 |
| 85 | 3300005458 | Ga0070681_10009095 | Ga0070681_100090956 | 322 |
| 86 | 3300005458 | Ga0070681_10043353 | Ga0070681_100433533 | 322 |
| 87 | 3300005530 | Ga0070679_100116708 | Ga0070679_1001167082 | 322 |
| 88 | 3300005539 | Ga0068853_100025323 | Ga0068853_1000253235 | 322 |
| 89 | 3300005543 | Ga0070672_100191647 | Ga0070672_1001916472 | 322 |
| 90 | 3300005543 | Ga0070672_100349603 | Ga0070672_1003496032 | 322 |
| 91 | 3300005547 | Ga0070693_100113905 | Ga0070693_1001139052 | 322 |
| 92 | 3300005564 | Ga0070664_100006021 | Ga0070664_1000060214 | 322 |
| 93 | 3300005564 | Ga0070664_100431808 | Ga0070664_1004318081 | 322 |
| 94 | 3300005617 | Ga0068859_100012143 | Ga0068859_1000121439 | 322 |
| 95 | 3300005617 | Ga0068859_100121148 | Ga0068859_1001211482 | 322 |
| 96 | 3300005617 | Ga0068859_100247267 | Ga0068859_1002472672 | 322 |
| 97 | 3300005618 | Ga0068864_100029960 | Ga0068864_1000299602 | 322 |
| 98 | 3300005618 | Ga0068864_100032244 | Ga0068864_1000322443 | 322 |
| 99 | 3300005618 | Ga0068864_100134861 | Ga0068864_1001348612 | 322 |
| 100 | 3300005718 | Ga0068866_10072108 | Ga0068866_100721082 | 322 |
| 101 | 3300005834 | Ga0068851_10086068 | Ga0068851_100860682 | 322 |
| 102 | 3300005841 | Ga0068863_100396055 | Ga0068863_1003960552 | 322 |
| 103 | 3300005842 | Ga0068858_100025469 | Ga0068858_1000254693 | 322 |
| 104 | 3300005843 | Ga0068860_100030238 | Ga0068860_1000302383 | 322 |
| 105 | 3300005843 | Ga0068860_100066642 | Ga0068860_1000666424 | 322 |
| 106 | 3300005844 | Ga0068862_100091380 | Ga0068862_1000913803 | 322 |
| 107 | 3300006237 | Ga0097621_100138055 | Ga0097621_1001380553 | 322 |
| 108 | 3300006237 | Ga0097621_100487954 | Ga0097621_1004879541 | 322 |
| 109 | 3300006358 | Ga0068871_100267251 | Ga0068871_1002672512 | 322 |
| 110 | 3300006931 | Ga0097620_100012143 | Ga0097620_1000121439 | 322 |
| 111 | 3300006931 | Ga0097620_100121146 | Ga0097620_1001211462 | 322 |
| 112 | 3300006931 | Ga0097620_100247267 | Ga0097620_1002472672 | 322 |
| 113 | 3300009176 | Ga0105242_10064603 | Ga0105242_100646034 | 322 |
| 114 | 3300009177 | Ga0105248_10120767 | Ga0105248_101207672 | 322 |
| 115 | 3300009553 | Ga0105249_10040676 | Ga0105249_100406763 | 322 |
| 116 | 3300009553 | Ga0105249_10055853 | Ga0105249_100558531 | 322 |
| 117 | 3300010375 | Ga0105239_10009920 | Ga0105239_100099209 | 322 |
| 118 | 3300010375 | Ga0105239_10534575 | Ga0105239_105345752 | 322 |
| 119 | 3300013100 | Ga0157373_10355010 | Ga0157373_103550101 | 322 |
| 120 | 3300013105 | Ga0157369_10110734 | Ga0157369_101107344 | 322 |
| 121 | 3300013297 | Ga0157378_10069379 | Ga0157378_100693791 | 322 |
| 122 | 3300013306 | Ga0163162_10207008 | Ga0163162_102070082 | 322 |
| 123 | 3300013306 | Ga0163162_10498837 | Ga0163162_104988371 | 322 |
| 124 | 3300013307 | Ga0157372_10038819 | Ga0157372_100388195 | 322 |
| 125 | 3300013307 | Ga0157372_10453656 | Ga0157372_104536562 | 322 |
| 126 | 3300013307 | Ga0157372_10471442 | Ga0157372_104714422 | 322 |
| 127 | 3300013308 | Ga0157375_10025012 | Ga0157375_100250122 | 322 |
| 128 | 3300013308 | Ga0157375_10081534 | Ga0157375_100815343 | 322 |
| 129 | 3300014325 | Ga0163163_10007699 | Ga0163163_100076994 | 322 |
| 130 | 3300014325 | Ga0163163_10063178 | Ga0163163_100631783 | 322 |
| 131 | 3300014326 | Ga0157380_10172688 | Ga0157380_101726882 | 322 |
| 132 | 3300014968 | Ga0157379_10221789 | Ga0157379_102217892 | 322 |
| 133 | 3300017792 | Ga0163161_10018515 | Ga0163161_100185154 | 322 |
| 134 | 3300017792 | Ga0163161_10034425 | Ga0163161_100344252 | 322 |
| 135 | 3300017792 | Ga0163161_10071175 | Ga0163161_100711752 | 322 |
| 136 | 3300025912 | Ga0207707_10005199 | Ga0207707_100051996 | 322 |
| 137 | 3300025912 | Ga0207707_10054256 | Ga0207707_100542563 | 322 |
| 138 | 3300025919 | Ga0207657_10207187 | Ga0207657_102071872 | 322 |
| 139 | 3300025921 | Ga0207652_10098302 | Ga0207652_100983023 | 322 |
| 140 | 3300025925 | Ga0207650_10062495 | Ga0207650_100624952 | 322 |
| 141 | 3300025926 | Ga0207659_10166437 | Ga0207659_101664372 | 322 |
| 142 | 3300025933 | Ga0207706_10028747 | Ga0207706_100287474 | 322 |
| 143 | 3300025934 | Ga0207686_10071294 | Ga0207686_100712942 | 322 |
| 144 | 3300025937 | Ga0207669_10064187 | Ga0207669_100641872 | 322 |
| 145 | 3300025940 | Ga0207691_10202415 | Ga0207691_102024152 | 322 |
| 146 | 3300025941 | Ga0207711_10045197 | Ga0207711_100451975 | 322 |
| 147 | 3300025941 | Ga0207711_10125535 | Ga0207711_101255352 | 322 |
| 148 | 3300025945 | Ga0207679_10066910 | Ga0207679_100669104 | 322 |
| 149 | 3300025949 | Ga0207667_10035971 | Ga0207667_100359716 | 322 |
| 150 | 3300025960 | Ga0207651_10048977 | Ga0207651_100489772 | 322 |
| 151 | 3300025960 | Ga0207651_10113420 | Ga0207651_101134202 | 322 |
| 152 | 3300025961 | Ga0207712_10007967 | Ga0207712_100079674 | 322 |
| 153 | 3300025961 | Ga0207712_10101434 | Ga0207712_101014342 | 322 |
| 154 | 3300025981 | Ga0207640_10119946 | Ga0207640_101199462 | 322 |
| 155 | 3300025981 | Ga0207640_10167095 | Ga0207640_101670952 | 322 |
| 156 | 3300025986 | Ga0207658_10008601 | Ga0207658_100086014 | 322 |
| 157 | 3300025986 | Ga0207658_10097816 | Ga0207658_100978162 | 322 |
| 158 | 3300026088 | Ga0207641_10063081 | Ga0207641_100630813 | 322 |
| 159 | 3300026088 | Ga0207641_10133050 | Ga0207641_101330502 | 322 |
| 160 | 3300026095 | Ga0207676_10006084 | Ga0207676_100060846 | 322 |
| 161 | 3300026095 | Ga0207676_10074586 | Ga0207676_100745863 | 322 |
| 162 | 3300026121 | Ga0207683_10023519 | Ga0207683_100235193 | 322 |
| 163 | 3300026121 | Ga0207683_10192923 | Ga0207683_101929232 | 322 |
| 164 | 3300028380 | Ga0268265_10045264 | Ga0268265_100452643 | 322 |
| 165 | 3300028381 | Ga0268264_10013110 | Ga0268264_100131105 | 322 |
| 166 | 3300028381 | Ga0268264_10051732 | Ga0268264_100517322 | 322 |
| 167 | 3300028381 | Ga0268264_10411490 | Ga0268264_104114901 | 322 |
| 168 | 3300031548 | Ga0307408_100065525 | Ga0307408_1000655254 | 322 |
| 169 | 3300031548 | Ga0307408_100077209 | Ga0307408_1000772092 | 322 |
| 170 | 3300031548 | Ga0307408_100120961 | Ga0307408_1001209611 | 322 |
| 171 | 3300031731 | Ga0307405_10015059 | Ga0307405_100150592 | 322 |
| 172 | 3300031731 | Ga0307405_10053119 | Ga0307405_100531191 | 322 |
| 173 | 3300031824 | Ga0307413_10031326 | Ga0307413_100313262 | 322 |
| 174 | 3300031824 | Ga0307413_10093860 | Ga0307413_100938602 | 322 |
| 175 | 3300031824 | Ga0307413_10123079 | Ga0307413_101230792 | 322 |
| 176 | 3300031852 | Ga0307410_10001672 | Ga0307410_100016724 | 322 |
| 177 | 3300031852 | Ga0307410_10002195 | Ga0307410_100021952 | 322 |
| 178 | 3300031852 | Ga0307410_10037540 | Ga0307410_100375403 | 322 |
| 179 | 3300031901 | Ga0307406_10036550 | Ga0307406_100365503 | 322 |
| 180 | 3300031901 | Ga0307406_10092244 | Ga0307406_100922441 | 322 |
| 181 | 3300031901 | Ga0307406_10193680 | Ga0307406_101936802 | 322 |
| 182 | 3300031901 | Ga0307406_10437287 | Ga0307406_104372871 | 322 |
| 183 | 3300031903 | Ga0307407_10001250 | Ga0307407_100012502 | 322 |
| 184 | 3300031903 | Ga0307407_10001410 | Ga0307407_100014102 | 322 |
| 185 | 3300031903 | Ga0307407_10016425 | Ga0307407_100164253 | 322 |
| 186 | 3300031911 | Ga0307412_10072984 | Ga0307412_100729842 | 322 |
| 187 | 3300031911 | Ga0307412_10161189 | Ga0307412_101611892 | 322 |
| 188 | 3300031995 | Ga0307409_100004310 | Ga0307409_1000043108 | 322 |
| 189 | 3300031995 | Ga0307409_100047011 | Ga0307409_1000470111 | 322 |
| 190 | 3300031995 | Ga0307409_100085848 | Ga0307409_1000858483 | 322 |
| 191 | 3300031995 | Ga0307409_100134291 | Ga0307409_1001342913 | 322 |
| 192 | 3300031995 | Ga0307409_100367537 | Ga0307409_1003675371 | 322 |
| 193 | 3300032002 | Ga0307416_100029184 | Ga0307416_1000291845 | 322 |
| 194 | 3300032002 | Ga0307416_100054128 | Ga0307416_1000541284 | 322 |
| 195 | 3300032004 | Ga0307414_10012889 | Ga0307414_100128893 | 322 |
| 196 | 3300032005 | Ga0307411_10005863 | Ga0307411_100058633 | 322 |
| 197 | 3300032005 | Ga0307411_10005901 | Ga0307411_100059018 | 322 |
| 198 | 3300032005 | Ga0307411_10247879 | Ga0307411_102478792 | 322 |
| 199 | 3300046616 | Ga0495668_0008270 | Ga0495668_0008270_2775_3743 | 322 |
| 200 | 3300049588 | Ga0501072_0016435 | Ga0501072_0016435_3694_4662 | 322 |
| 201 | 3300049705 | Ga0501225_0025592 | Ga0501225_0025592_289_1257 | 322 |
| 202 | 3300054114 | Ga0501084_0194521 | Ga0501084_0194521_196_1164 | 322 |
| 203 | 3300005356 | Ga0070674_100370456 | Ga0070674_1003704561 | 323 |
| 204 | 3300005471 | Ga0070698_100198715 | Ga0070698_1001987152 | 323 |
| 205 | 3300005539 | Ga0068853_100003250 | Ga0068853_10000325010 | 323 |
| 206 | 3300005719 | Ga0068861_100130505 | Ga0068861_1001305051 | 323 |
| 207 | 3300009147 | Ga0114129_10159511 | Ga0114129_101595112 | 323 |
| 208 | 3300009177 | Ga0105248_10328385 | Ga0105248_103283852 | 323 |
| 209 | 3300013105 | Ga0157369_10078113 | Ga0157369_100781131 | 323 |
| 210 | 3300013306 | Ga0163162_10407352 | Ga0163162_104073522 | 323 |
| 211 | 3300013308 | Ga0157375_10034072 | Ga0157375_100340726 | 323 |
| 212 | 3300021384 | Ga0213876_10010703 | Ga0213876_100107034 | 323 |
| 213 | 3300025909 | Ga0207705_10009008 | Ga0207705_100090083 | 323 |
| 214 | 3300025913 | Ga0207695_10186960 | Ga0207695_101869602 | 323 |
| 215 | 3300026041 | Ga0207639_10002398 | Ga0207639_100023982 | 323 |
| 216 | 3300031548 | Ga0307408_100167565 | Ga0307408_1001675652 | 323 |
| 217 | 3300031852 | Ga0307410_10140393 | Ga0307410_101403931 | 323 |
| 218 | 3300031995 | Ga0307409_100185577 | Ga0307409_1001855772 | 323 |
| 219 | 3300032005 | Ga0307411_10216705 | Ga0307411_102167051 | 323 |
| 220 | 3300039437 | Ga0436365_1540433 | Ga0436365_1540433_3787_4764 | 323 |
| 221 | 3300046519 | Ga0495632_0035227 | Ga0495632_0035227_1085_2062 | 323 |
| 222 | 3300003203 | JGI25406J46586_10000855 | JGI25406J46586_1000085513 | 324 |
| 223 | 3300005295 | Ga0065707_10117943 | Ga0065707_101179432 | 324 |
| 224 | 3300005331 | Ga0070670_100085062 | Ga0070670_1000850622 | 324 |
| 225 | 3300005364 | Ga0070673_100366546 | Ga0070673_1003665462 | 324 |
| 226 | 3300005617 | Ga0068859_100109200 | Ga0068859_1001092002 | 324 |
| 227 | 3300005618 | Ga0068864_100174530 | Ga0068864_1001745302 | 324 |
| 228 | 3300005985 | Ga0081539_10001016 | Ga0081539_1000101642 | 324 |
| 229 | 3300005985 | Ga0081539_10001250 | Ga0081539_1000125023 | 324 |
| 230 | 3300006931 | Ga0097620_100109201 | Ga0097620_1001092012 | 324 |
| 231 | 3300009148 | Ga0105243_10120094 | Ga0105243_101200942 | 324 |
| 232 | 3300009553 | Ga0105249_10117782 | Ga0105249_101177822 | 324 |
| 233 | 3300009553 | Ga0105249_10217997 | Ga0105249_102179972 | 324 |
| 234 | 3300013306 | Ga0163162_10303769 | Ga0163162_103037692 | 324 |
| 235 | 3300013307 | Ga0157372_10250124 | Ga0157372_102501242 | 324 |
| 236 | 3300013307 | Ga0157372_10291591 | Ga0157372_102915912 | 324 |
| 237 | 3300014326 | Ga0157380_10602344 | Ga0157380_106023442 | 324 |
| 238 | 3300014745 | Ga0157377_10016856 | Ga0157377_100168563 | 324 |
| 239 | 3300025920 | Ga0207649_10127473 | Ga0207649_101274731 | 324 |
| 240 | 3300025925 | Ga0207650_10098293 | Ga0207650_100982931 | 324 |
| 241 | 3300025931 | Ga0207644_10062290 | Ga0207644_100622902 | 324 |
| 242 | 3300025940 | Ga0207691_10184354 | Ga0207691_101843543 | 324 |
| 243 | 3300025945 | Ga0207679_10069282 | Ga0207679_100692822 | 324 |
| 244 | 3300025961 | Ga0207712_10239835 | Ga0207712_102398351 | 324 |
| 245 | 3300031456 | Ga0307513_10008476 | Ga0307513_100084763 | 324 |
| 246 | 3300031731 | Ga0307405_10093325 | Ga0307405_100933252 | 324 |
| 247 | 3300031824 | Ga0307413_10130988 | Ga0307413_101309882 | 324 |
| 248 | 3300031852 | Ga0307410_10041105 | Ga0307410_100411052 | 324 |
| 249 | 3300031852 | Ga0307410_10079015 | Ga0307410_100790152 | 324 |
| 250 | 3300031903 | Ga0307407_10017349 | Ga0307407_100173492 | 324 |
| 251 | 3300031995 | Ga0307409_100100901 | Ga0307409_1001009012 | 324 |
| 252 | 3300032005 | Ga0307411_10011255 | Ga0307411_100112552 | 324 |
| 253 | 3300032126 | Ga0307415_100018753 | Ga0307415_1000187532 | 324 |
| 254 | 3300049679 | Ga0501249_012228 | Ga0501249_012228_294_1268 | 324 |
| 255 | 3300053142 | Ga0500577_0000972 | Ga0500577_0000972_3931_4905 | 324 |
| 256 | 3300000549 | LJQas_1000102 | LJQas_10001025 | 325 |
| 257 | 3300003578 | Ga0006562J51391_1009572 | Ga0006562J51391_10095722 | 325 |
| 258 | 3300005295 | Ga0065707_10094889 | Ga0065707_100948892 | 325 |
| 259 | 3300005434 | Ga0070709_10000001 | Ga0070709_1000000131 | 325 |
| 260 | 3300005439 | Ga0070711_100000020 | Ga0070711_10000002068 | 325 |
| 261 | 3300005440 | Ga0070705_100000038 | Ga0070705_10000003811 | 325 |
| 262 | 3300005467 | Ga0070706_100000007 | Ga0070706_100000007115 | 325 |
| 263 | 3300005518 | Ga0070699_100000420 | Ga0070699_10000042030 | 325 |
| 264 | 3300005536 | Ga0070697_100000071 | Ga0070697_10000007144 | 325 |
| 265 | 3300005546 | Ga0070696_100000117 | Ga0070696_10000011730 | 325 |
| 266 | 3300005547 | Ga0070693_100014877 | Ga0070693_1000148772 | 325 |
| 267 | 3300005549 | Ga0070704_100019701 | Ga0070704_1000197012 | 325 |
| 268 | 3300005577 | Ga0068857_100469526 | Ga0068857_1004695261 | 325 |
| 269 | 3300005842 | Ga0068858_100107080 | Ga0068858_1001070803 | 325 |
| 270 | 3300006852 | Ga0075433_10256525 | Ga0075433_102565251 | 325 |
| 271 | 3300006880 | Ga0075429_100017885 | Ga0075429_1000178855 | 325 |
| 272 | 3300006914 | Ga0075436_100000161 | Ga0075436_1000001617 | 325 |
| 273 | 3300006914 | Ga0075436_100173724 | Ga0075436_1001737241 | 325 |
| 274 | 3300009094 | Ga0111539_10115266 | Ga0111539_101152661 | 325 |
| 275 | 3300009147 | Ga0114129_10025325 | Ga0114129_100253252 | 325 |
| 276 | 3300009147 | Ga0114129_10027692 | Ga0114129_100276929 | 325 |
| 277 | 3300009147 | Ga0114129_10090244 | Ga0114129_100902443 | 325 |
| 278 | 3300009147 | Ga0114129_10756682 | Ga0114129_107566821 | 325 |
| 279 | 3300009147 | Ga0114129_10837144 | Ga0114129_108371441 | 325 |
| 280 | 3300013297 | Ga0157378_10119126 | Ga0157378_101191263 | 325 |
| 281 | 3300014326 | Ga0157380_10016098 | Ga0157380_100160983 | 325 |
| 282 | 3300014968 | Ga0157379_10067664 | Ga0157379_100676643 | 325 |
| 283 | 3300025229 | Ga0209147_100050 | Ga0209147_10005095 | 325 |
| 284 | 3300025885 | Ga0207653_10000064 | Ga0207653_1000006444 | 325 |
| 285 | 3300025906 | Ga0207699_10000004 | Ga0207699_10000004356 | 325 |
| 286 | 3300025910 | Ga0207684_10006625 | Ga0207684_100066253 | 325 |
| 287 | 3300025916 | Ga0207663_10000202 | Ga0207663_100002026 | 325 |
| 288 | 3300025939 | Ga0207665_10059625 | Ga0207665_100596251 | 325 |
| 289 | 3300026075 | Ga0207708_10335333 | Ga0207708_103353331 | 325 |
| 290 | 3300026116 | Ga0207674_10461368 | Ga0207674_104613681 | 325 |
| 291 | 3300031548 | Ga0307408_100030470 | Ga0307408_1000304702 | 325 |
| 292 | 3300031731 | Ga0307405_10131692 | Ga0307405_101316922 | 325 |
| 293 | 3300031911 | Ga0307412_10157555 | Ga0307412_101575552 | 325 |
| 294 | 3300032002 | Ga0307416_100040723 | Ga0307416_1000407231 | 325 |
| 295 | 3300032002 | Ga0307416_100067915 | Ga0307416_1000679152 | 325 |
| 296 | 3300046810 | Ga0495660_0067308 | Ga0495660_0067308_727_1758 | 325 |
| 297 | 3300047321 | Ga0495676_0211428 | Ga0495676_0211428_107_1144 | 325 |
| 298 | 3300048905 | Ga0496102_0187768 | Ga0496102_0187768_136_1167 | 325 |
| 299 | 3300048915 | Ga0496112_0483907 | Ga0496112_0483907_79_1116 | 325 |
| 300 | 3300049577 | Ga0501041_0019911 | Ga0501041_0019911_143_1135 | 325 |
| 301 | 3300049578 | Ga0501042_0018747 | Ga0501042_0018747_403_1395 | 325 |
| 302 | 3300049580 | Ga0501046_0191567 | Ga0501046_0191567_471_1463 | 325 |
| 303 | 3300049588 | Ga0501072_0135685 | Ga0501072_0135685_464_1456 | 325 |
| 304 | 3300049591 | Ga0501075_0005685 | Ga0501075_0005685_4687_5679 | 325 |
| 305 | 3300049592 | Ga0501076_0401880 | Ga0501076_0401880_122_1114 | 325 |
| 306 | 3300049593 | Ga0501077_0020978 | Ga0501077_0020978_375_1367 | 325 |
| 307 | 3300049661 | Ga0501217_011286 | Ga0501217_011286_852_1892 | 325 |
| 308 | 3300049743 | Ga0501081_0020913 | Ga0501081_0020913_1915_2907 | 325 |
| 309 | 3300050507 | nmdc:mga05p37_125144_c1 | nmdc:mga05p37_125144_c1_1169_2167 | 325 |
| 310 | 3300050507 | nmdc:mga05p37_169491_c1 | nmdc:mga05p37_169491_c1_1111_2109 | 325 |
| 311 | 3300050507 | nmdc:mga05p37_3771_c1 | nmdc:mga05p37_3771_c1_119_1114 | 325 |
| 312 | 3300050508 | nmdc:mga09592_32211_c1 | nmdc:mga09592_32211_c1_2337_3335 | 325 |
| 313 | 3300050511 | nmdc:mga08y16_234716_c1 | nmdc:mga08y16_234716_c1_634_1707 | 325 |
| 314 | 3300050514 | nmdc:mga08x19_33_c1 | nmdc:mga08x19_33_c1_62237_63232 | 325 |
| 315 | 3300050515 | nmdc:mga0a205_38328_c1 | nmdc:mga0a205_38328_c1_133_1128 | 325 |
| 316 | 3300050515 | nmdc:mga0a205_411510_c1 | nmdc:mga0a205_411510_c1_97_1092 | 325 |
| 317 | 3300053153 | Ga0500616_0000961 | Ga0500616_0000961_29459_30442 | 325 |
| 318 | 3300060353 | Ga0501082_0013491 | Ga0501082_0013491_353_1345 | 325 |
| 319 | iso_pu_bacteria | 2510917027 | 2511177707 | 325 |
| 320 | iso_pu_bacteria | 2512564013 | 2512640213 | 325 |
| 321 | iso_pu_bacteria | 2738541295 | 2738812712 | 325 |
| 322 | iso_pu_bacteria | 2857460504 | 2857462463 | 325 |
| 323 | iso_pu_bacteria | 2857465823 | 2857472630 | 325 |
| 324 | iso_pu_bacteria | 2857591370 | 2857593499 | 325 |
| 325 | iso_pu_bacteria | 2915597211 | 2915600311 | 325 |
| 326 | iso_pu_bacteria | 2915606848 | 2915609874 | 325 |
| 327 | iso_pu_bacteria | 2919414237 | 2919419164 | 325 |
| 328 | iso_pu_bacteria | 2929183550 | 2929185492 | 325 |
| 329 | iso_pu_bacteria | 2936361878 | 2936365061 | 325 |
| 330 | iso_pu_bacteria | 2964375228 | 2964375662 | 325 |
| 331 | iso_pu_bacteria | 2977254563 | 2977258529 | 325 |
| 332 | iso_pu_bacteria | 2990275345 | 2990279567 | 325 |
| 333 | iso_pu_bacteria | 3001892409 | 3001893706 | 325 |
| 334 | iso_pu_bacteria | 3006978542 | 3006978983 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9144 | 2 | 191 |
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9008 | 2 | 191 |
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.8574 | 1 | 195 |
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.8533 | 1 | 195 |
| 4l2i-assembly1.cif.gz_A | electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation | 0.8343 | 2 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9626 | 195 | 320 | 3.40.50.1220 |
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9446 | 196 | 325 | 3.40.50.1220 |
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9337 | 195 | 320 | 3.40.50.1220 |
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9238 | 196 | 325 | 3.40.50.1220 |
| af_Q46907_159_286_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9216 | 199 | 325 | 3.40.50.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0S2B0-F1-model_v4 | Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein | 0.9897 | 202 | 324 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A7J3P607-F1-model_v4 | Electron transfer flavoprotein subunit alpha/FixB family protein | 0.9831 | 224 | 325 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A644ZYC3-F1-model_v4 | Protein FixB | 0.9829 | 202 | 320 |
GO:0005506
GO:0009055 GO:0033539 GO:0050660 |
| AF-A0A7C5VM81-F1-model_v4 | Electron transfer flavoprotein subunit alpha/FixB family protein | 0.9824 | 235 | 323 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A1C5DSN9-F1-model_v4 | Electron transfer flavoprotein alpha subunit apoprotein | 0.982 | 201 | 325 |
GO:0009055
GO:0033539 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar