F411641

General Info

Members Datasets Scaffolds Average Seq Length
334 204 313 326

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100085062|Ga0070670_1000850622
Length 366
Sequence MRFGPGHVFAMSRPFCHTFPSVFSALMSDILVFIEHRNCVLNKTSLEAIAAAQSIAKDLGLKASAVIPCDKDCSLAQDISGYDLEKVIVVKNPKLATYTPDAYADAWEQIIKSESPKYVVMSHTYQVRDFAPKVAARLGREVVGDCIRYRTTPSAEAAATPPATGGEPKKLVLTRRIFLGKLDADVTIGGDAPYFVTFQSGSFRGDNAAKGSASVESVDVTVGDVRMTPEEPFQEAKASVDLTKSEIIVAVGRGIKSQENIALAQQLADALGADLAASRPICDADWLPIDRQIGSSGQTVAPKVYIALGISGAIQHIVGMKNAGTIIAINKDAEAPIFDIADYGVAGDLFEAVPVMIEEIKKAKGN

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
5 2738541295 Bacillus sp. OK085 Isolate Unclassified
6 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
7 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
8 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
9 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
10 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
11 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
12 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
13 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
14 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
15 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
16 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
17 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
18 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
19 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
20 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
21 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 0.3
Isolates 6.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0.9
Rhizoplane 4.49
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000102 3300000549 Bacteria 14977
2 JGI25406J46586_10000855 3300003203 Bacteria 14349
3 Ga0006562J51391_1009572 3300003578 Bacteria 3810
4 Ga0065715_10160330 3300005293 Bacteria 1636
5 Ga0065715_10172605 3300005293 Bacteria 1535
6 Ga0065707_10094889 3300005295 Bacteria 3439
7 Ga0065707_10117943 3300005295 Bacteria 2198
8 Ga0070676_10152549 3300005328 Bacteria 1480
9 Ga0070690_100012457 3300005330 Bacteria 5002
10 Ga0070670_100025579 3300005331 Bacteria 5078
11 Ga0070670_100048835 3300005331 Unclassified 3641
12 Ga0070670_100085062 3300005331 Unclassified 2717
13 Ga0068869_100337751 3300005334 Bacteria 1225
14 Ga0070680_100270506 3300005336 Bacteria 1439
15 Ga0068868_100238195 3300005338 Bacteria 1528
16 Ga0070660_100097964 3300005339 Bacteria 2320
17 Ga0070661_100095408 3300005344 Bacteria 2206
18 Ga0070668_100069167 3300005347 Bacteria 2746
19 Ga0070668_100155334 3300005347 Bacteria 1853
20 Ga0070675_100009774 3300005354 Bacteria 7472
21 Ga0070675_100249721 3300005354 Bacteria 1552
22 Ga0070674_100024943 3300005356 Bacteria 3885
23 Ga0070674_100370456 3300005356 Bacteria 1162
24 Ga0070673_100014248 3300005364 Bacteria 5530
25 Ga0070673_100298319 3300005364 Bacteria 1418
26 Ga0070673_100366546 3300005364 Unclassified 1282
27 Ga0070659_100366028 3300005366 Bacteria 1212
28 Ga0070667_100007147 3300005367 Bacteria 9279
29 Ga0070667_100082849 3300005367 Bacteria 2747
30 Ga0070667_100160031 3300005367 Bacteria 1983
31 Ga0070703_10000104 3300005406 Bacteria 43743
32 Ga0070709_10000001 3300005434 Bacteria 412391
33 Ga0070711_100000020 3300005439 Bacteria 127708
34 Ga0070705_100000038 3300005440 Bacteria 66622
35 Ga0070663_100042251 3300005455 Bacteria 3203
36 Ga0070678_100004297 3300005456 Bacteria 8055
37 Ga0070678_100157673 3300005456 Bacteria 1835
38 Ga0070681_10009095 3300005458 Bacteria 9761
39 Ga0070681_10043353 3300005458 Bacteria 4508
40 Ga0070706_100000007 3300005467 Bacteria 228014
41 Ga0070698_100198715 3300005471 Bacteria 1941
42 Ga0070699_100000420 3300005518 Bacteria 40683
43 Ga0070679_100116708 3300005530 Unclassified 2654
44 Ga0070697_100000071 3300005536 Bacteria 80945
45 Ga0068853_100003250 3300005539 Bacteria 12421
46 Ga0068853_100025323 3300005539 Bacteria 4978
47 Ga0070672_100191647 3300005543 Bacteria 1707
48 Ga0070672_100349603 3300005543 Bacteria 1260
49 Ga0070696_100000117 3300005546 Bacteria 41248
50 Ga0070693_100014877 3300005547 Bacteria 3998
51 Ga0070693_100113905 3300005547 Bacteria 1668
52 Ga0070704_100019701 3300005549 Bacteria 4340
53 Ga0070664_100006021 3300005564 Bacteria 9805
54 Ga0070664_100431808 3300005564 Bacteria 1207
55 Ga0068857_100469526 3300005577 Bacteria 1178
56 Ga0068859_100012143 3300005617 Bacteria 8656
57 Ga0068859_100109200 3300005617 Unclassified 2827
58 Ga0068859_100121148 3300005617 Bacteria 2682
59 Ga0068859_100247267 3300005617 Unclassified 1873
60 Ga0068864_100029960 3300005618 Bacteria 4612
61 Ga0068864_100032244 3300005618 Bacteria 4450
62 Ga0068864_100134861 3300005618 Unclassified 2222
63 Ga0068864_100174530 3300005618 Unclassified 1961
64 Ga0068866_10072108 3300005718 Bacteria 1829
65 Ga0068861_100130505 3300005719 Bacteria 2039
66 Ga0068851_10086068 3300005834 Bacteria 1648
67 Ga0068863_100396055 3300005841 Bacteria 1350
68 Ga0068858_100025469 3300005842 Bacteria 5504
69 Ga0068858_100107080 3300005842 Unclassified 2609
70 Ga0068860_100030238 3300005843 Bacteria 5208
71 Ga0068860_100066642 3300005843 Bacteria 3420
72 Ga0068862_100091380 3300005844 Bacteria 2651
73 Ga0081539_10001016 3300005985 Bacteria 51656
74 Ga0081539_10001250 3300005985 Bacteria 45064
75 Ga0097621_100138055 3300006237 Bacteria 2081
76 Ga0097621_100487954 3300006237 Bacteria 1114
77 Ga0068871_100267251 3300006358 Bacteria 1493
78 Ga0075433_10256525 3300006852 Unclassified 1551
79 Ga0075429_100017885 3300006880 Bacteria 6129
80 Ga0075436_100000161 3300006914 Bacteria 41699
81 Ga0075436_100173724 3300006914 Bacteria 1521
82 Ga0097620_100012143 3300006931 Bacteria 8656
83 Ga0097620_100109201 3300006931 Unclassified 2827
84 Ga0097620_100121146 3300006931 Bacteria 2682
85 Ga0097620_100247267 3300006931 Unclassified 1873
86 Ga0111539_10115266 3300009094 Bacteria 3151
87 Ga0114129_10025325 3300009147 Bacteria 8406
88 Ga0114129_10027692 3300009147 Bacteria 8023
89 Ga0114129_10090244 3300009147 Bacteria 4248
90 Ga0114129_10159511 3300009147 Bacteria 3083
91 Ga0114129_10756682 3300009147 Bacteria 1243
92 Ga0114129_10837144 3300009147 Bacteria 1171
93 Ga0105243_10120094 3300009148 Unclassified 2214
94 Ga0105242_10064603 3300009176 Bacteria 3018
95 Ga0105248_10120767 3300009177 Bacteria 2956
96 Ga0105248_10328385 3300009177 Bacteria 1723
97 Ga0105249_10040676 3300009553 Bacteria 4223
98 Ga0105249_10055853 3300009553 Bacteria 3614
99 Ga0105249_10117782 3300009553 Bacteria 2519
100 Ga0105249_10217997 3300009553 Unclassified 1876
101 Ga0105239_10009920 3300010375 Bacteria 10696
102 Ga0105239_10534575 3300010375 Bacteria 1334
103 Ga0157373_10355010 3300013100 Bacteria 1046
104 Ga0157369_10078113 3300013105 Bacteria 3547
105 Ga0157369_10110734 3300013105 Bacteria 2919
106 Ga0157378_10069379 3300013297 Bacteria 3162
107 Ga0157378_10119126 3300013297 Bacteria 2431
108 Ga0163162_10000890 3300013306 Bacteria 27792
109 Ga0163162_10207008 3300013306 Bacteria 2091
110 Ga0163162_10303769 3300013306 Bacteria 1728
111 Ga0163162_10407352 3300013306 Unclassified 1493
112 Ga0163162_10498837 3300013306 Bacteria 1348
113 Ga0157372_10038819 3300013307 Bacteria 5254
114 Ga0157372_10250124 3300013307 Bacteria 2057
115 Ga0157372_10291591 3300013307 Archaea 1897
116 Ga0157372_10453656 3300013307 Bacteria 1494
117 Ga0157372_10471442 3300013307 Bacteria 1463
118 Ga0157375_10013631 3300013308 Bacteria 7245
119 Ga0157375_10025012 3300013308 Bacteria 5538
120 Ga0157375_10034072 3300013308 Bacteria 4847
121 Ga0157375_10081534 3300013308 Bacteria 3275
122 Ga0163163_10007699 3300014325 Bacteria 9518
123 Ga0163163_10063178 3300014325 Bacteria 3671
124 Ga0157380_10016098 3300014326 Bacteria 5509
125 Ga0157380_10172688 3300014326 Bacteria 1890
126 Ga0157380_10602344 3300014326 Bacteria 1087
127 Ga0157377_10016856 3300014745 Unclassified 3767
128 Ga0157379_10067664 3300014968 Unclassified 3192
129 Ga0157379_10221789 3300014968 Bacteria 1713
130 Ga0163161_10018515 3300017792 Bacteria 4879
131 Ga0163161_10034425 3300017792 Bacteria 3624
132 Ga0163161_10071175 3300017792 Bacteria 2544
133 Ga0213876_10010703 3300021384 Bacteria 4914
134 Ga0209147_100050 3300025229 Bacteria 274639
135 Ga0207653_10000064 3300025885 Bacteria 81445
136 Ga0207699_10000004 3300025906 Bacteria 567333
137 Ga0207705_10009008 3300025909 Bacteria 7270
138 Ga0207684_10006625 3300025910 Bacteria 10529
139 Ga0207707_10005199 3300025912 Bacteria 11406
140 Ga0207707_10054256 3300025912 Bacteria 3489
141 Ga0207695_10186960 3300025913 Bacteria 1990
142 Ga0207663_10000202 3300025916 Bacteria 26671
143 Ga0207657_10207187 3300025919 Bacteria 1575
144 Ga0207649_10127473 3300025920 Bacteria 1724
145 Ga0207652_10098302 3300025921 Bacteria 2581
146 Ga0207650_10062495 3300025925 Unclassified 2782
147 Ga0207650_10098293 3300025925 Unclassified 2248
148 Ga0207659_10153334 3300025926 Bacteria 1801
149 Ga0207659_10166437 3300025926 Bacteria 1735
150 Ga0207644_10062290 3300025931 Unclassified 2705
151 Ga0207706_10028747 3300025933 Bacteria 4963
152 Ga0207686_10071294 3300025934 Bacteria 2235
153 Ga0207669_10064187 3300025937 Bacteria 2271
154 Ga0207665_10059625 3300025939 Bacteria 2583
155 Ga0207691_10184354 3300025940 Bacteria 1822
156 Ga0207691_10202415 3300025940 Bacteria 1727
157 Ga0207711_10045197 3300025941 Bacteria 3763
158 Ga0207711_10125535 3300025941 Bacteria 2295
159 Ga0207679_10066910 3300025945 Bacteria 2694
160 Ga0207679_10069282 3300025945 Bacteria 2654
161 Ga0207667_10035971 3300025949 Bacteria 5310
162 Ga0207651_10048977 3300025960 Bacteria 2860
163 Ga0207651_10113420 3300025960 Unclassified 2040
164 Ga0207712_10007967 3300025961 Bacteria 6697
165 Ga0207712_10101434 3300025961 Bacteria 2140
166 Ga0207712_10239835 3300025961 Unclassified 1460
167 Ga0207640_10119946 3300025981 Bacteria 1882
168 Ga0207640_10167095 3300025981 Bacteria 1635
169 Ga0207658_10008601 3300025986 Bacteria 6946
170 Ga0207658_10097816 3300025986 Bacteria 2292
171 Ga0207639_10002398 3300026041 Bacteria 12573
172 Ga0207678_10076548 3300026067 Bacteria 2866
173 Ga0207708_10335333 3300026075 Bacteria 1237
174 Ga0207641_10063081 3300026088 Bacteria 3164
175 Ga0207641_10133050 3300026088 Bacteria 2235
176 Ga0207676_10006084 3300026095 Bacteria 8517
177 Ga0207676_10074586 3300026095 Bacteria 2734
178 Ga0207674_10461368 3300026116 Bacteria 1228
179 Ga0207683_10023519 3300026121 Bacteria 5301
180 Ga0207683_10192923 3300026121 Bacteria 1850
181 Ga0207683_10204172 3300026121 Bacteria 1797
182 Ga0268265_10045264 3300028380 Bacteria 3283
183 Ga0268264_10013110 3300028381 Bacteria 6817
184 Ga0268264_10051732 3300028381 Bacteria 3424
185 Ga0268264_10411490 3300028381 Bacteria 1302
186 Ga0307513_10008476 3300031456 Bacteria 13139
187 Ga0307408_100030470 3300031548 Bacteria 3746
188 Ga0307408_100065525 3300031548 Bacteria 2664
189 Ga0307408_100077209 3300031548 Bacteria 2480
190 Ga0307408_100120961 3300031548 Bacteria 2028
191 Ga0307408_100167565 3300031548 Bacteria 1751
192 Ga0307405_10015059 3300031731 Bacteria 4176
193 Ga0307405_10053119 3300031731 Bacteria 2522
194 Ga0307405_10093325 3300031731 Bacteria 1999
195 Ga0307405_10131692 3300031731 Bacteria 1729
196 Ga0307413_10031326 3300031824 Bacteria 3000
197 Ga0307413_10093860 3300031824 Bacteria 1962
198 Ga0307413_10123079 3300031824 Unclassified 1761
199 Ga0307413_10130988 3300031824 Bacteria 1716
200 Ga0307410_10001672 3300031852 Bacteria 10211
201 Ga0307410_10002195 3300031852 Bacteria 9293
202 Ga0307410_10037540 3300031852 Bacteria 3165
203 Ga0307410_10041105 3300031852 Bacteria 3047
204 Ga0307410_10079015 3300031852 Bacteria 2304
205 Ga0307410_10140393 3300031852 Bacteria 1787
206 Ga0307406_10036550 3300031901 Bacteria 3027
207 Ga0307406_10092244 3300031901 Bacteria 2042
208 Ga0307406_10193680 3300031901 Archaea 1490
209 Ga0307406_10437287 3300031901 Bacteria 1046
210 Ga0307407_10001250 3300031903 Bacteria 9055
211 Ga0307407_10001410 3300031903 Bacteria 8678
212 Ga0307407_10016425 3300031903 Bacteria 3685
213 Ga0307407_10017349 3300031903 Bacteria 3609
214 Ga0307412_10072984 3300031911 Bacteria 2347
215 Ga0307412_10157555 3300031911 Bacteria 1683
216 Ga0307412_10161189 3300031911 Bacteria 1667
217 Ga0307409_100004310 3300031995 Bacteria 7964
218 Ga0307409_100047011 3300031995 Bacteria 3271
219 Ga0307409_100085848 3300031995 Bacteria 2560
220 Ga0307409_100100901 3300031995 Bacteria 2393
221 Ga0307409_100134291 3300031995 Bacteria 2120
222 Ga0307409_100185577 3300031995 Bacteria 1846
223 Ga0307409_100367537 3300031995 Bacteria 1363
224 Ga0307416_100029184 3300032002 Bacteria 4116
225 Ga0307416_100040723 3300032002 Bacteria 3612
226 Ga0307416_100054128 3300032002 Bacteria 3224
227 Ga0307416_100067915 3300032002 Bacteria 2943
228 Ga0307414_10012889 3300032004 Bacteria 4962
229 Ga0307411_10005863 3300032005 Bacteria 6089
230 Ga0307411_10005901 3300032005 Bacteria 6076
231 Ga0307411_10011255 3300032005 Bacteria 4817
232 Ga0307411_10216705 3300032005 Bacteria 1482
233 Ga0307411_10247879 3300032005 Bacteria 1399
234 Ga0307415_100018753 3300032126 Bacteria 4186
235 Ga0395905_0000024 3300037471 Bacteria 318806
236 Ga0436365_1540433 3300039437 Bacteria 5153
237 Ga0495592_0218714 3300046454 Bacteria 1275
238 Ga0495603_0112282 3300046455 Bacteria 1589
239 Ga0495638_0000812 3300046460 Bacteria 32935
240 Ga0495580_0005813 3300046472 Bacteria 10126
241 Ga0495605_0001075 3300046474 Bacteria 18197
242 Ga0495664_0054870 3300046477 Bacteria 2370
243 Ga0495583_0025482 3300046506 Bacteria 2954
244 Ga0495583_0026969 3300046506 Bacteria 2840
245 Ga0495616_0061695 3300046513 Bacteria 1838
246 Ga0495632_0035227 3300046519 Bacteria 2556
247 Ga0495665_0029915 3300046531 Bacteria 2916
248 Ga0495665_0035706 3300046531 Bacteria 2655
249 Ga0495645_0008242 3300046543 Bacteria 7268
250 Ga0495668_0008270 3300046616 Bacteria 6517
251 Ga0495668_0212096 3300046616 Bacteria 1060
252 Ga0495670_0001264 3300046691 Bacteria 12378
253 Ga0495671_0026291 3300046692 Bacteria 3019
254 Ga0495589_0000541 3300046794 Bacteria 26355
255 Ga0495660_0067308 3300046810 Bacteria 1908
256 Ga0495660_0129143 3300046810 Bacteria 1270
257 Ga0495604_0056491 3300047317 Bacteria 3021
258 Ga0495674_0009895 3300047319 Bacteria 9047
259 Ga0495674_0011375 3300047319 Bacteria 8399
260 Ga0495672_0015341 3300047320 Bacteria 5205
261 Ga0495676_0211428 3300047321 Unclassified 1342
262 Ga0495683_0036869 3300047323 Bacteria 2481
263 Ga0495687_057372 3300047443 Bacteria 1619
264 Ga0495677_0055039 3300047445 Bacteria 1468
265 Ga0495685_020530 3300047447 Bacteria 2271
266 Ga0495673_0047349 3300047469 Bacteria 1900
267 Ga0495626_0019575 3300048091 Bacteria 3385
268 Ga0495626_0039946 3300048091 Bacteria 2218
269 Ga0496100_0006304 3300048903 Bacteria 6462
270 Ga0496100_0025577 3300048903 Bacteria 3612
271 Ga0496101_0012993 3300048904 Bacteria 5569
272 Ga0496102_0070775 3300048905 Bacteria 3203
273 Ga0496102_0187768 3300048905 Bacteria 1948
274 Ga0496102_0254255 3300048905 Bacteria 1656
275 Ga0496104_0106754 3300048907 Bacteria 2683
276 Ga0496104_0117740 3300048907 Bacteria 2550
277 Ga0496105_0019494 3300048908 Bacteria 5471
278 Ga0496105_0097319 3300048908 Bacteria 2431
279 Ga0496106_0037606 3300048909 Bacteria 3622
280 Ga0496107_0058271 3300048910 Bacteria 2793
281 Ga0496109_0009678 3300048912 Bacteria 8225
282 Ga0496111_0067282 3300048914 Bacteria 2603
283 Ga0496112_0483907 3300048915 Unclassified 1174
284 Ga0496121_0021961 3300048924 Bacteria 6222
285 Ga0496121_0044446 3300048924 Bacteria 3831
286 Ga0495678_041493 3300049459 Bacteria 1841
287 Ga0495682_0048418 3300049460 Bacteria 1549
288 Ga0501041_0019911 3300049577 Bacteria 4009
289 Ga0501042_0018747 3300049578 Bacteria 4796
290 Ga0501046_0191567 3300049580 Bacteria 1525
291 Ga0501072_0016435 3300049588 Bacteria 5682
292 Ga0501072_0135685 3300049588 Bacteria 1962
293 Ga0501075_0005685 3300049591 Bacteria 8536
294 Ga0501076_0401880 3300049592 Bacteria 1126
295 Ga0501077_0020978 3300049593 Bacteria 4134
296 Ga0501217_011286 3300049661 Bacteria 1974
297 Ga0501249_012228 3300049679 Bacteria 1812
298 Ga0501225_0025592 3300049705 Bacteria 1623
299 Ga0501081_0020913 3300049743 Bacteria 4367
300 Ga0501035_0202085 3300049822 Bacteria 1704
301 nmdc:mga05p37_125144_c1 3300050507 Bacteria 3157
302 nmdc:mga05p37_169491_c1 3300050507 Bacteria 2663
303 nmdc:mga05p37_3771_c1 3300050507 Bacteria 17740
304 nmdc:mga09592_32211_c1 3300050508 Bacteria 4370
305 nmdc:mga08y16_234716_c1 3300050511 Unclassified 1897
306 nmdc:mga08x19_33_c1 3300050514 Bacteria 203200
307 nmdc:mga0a205_337920_c1 3300050515 Unclassified 1375
308 nmdc:mga0a205_38328_c1 3300050515 Bacteria 4610
309 nmdc:mga0a205_411510_c1 3300050515 Bacteria 1215
310 Ga0500577_0000972 3300053142 Bacteria 7392
311 Ga0500616_0000961 3300053153 Bacteria 31238
312 Ga0501084_0194521 3300054114 Unclassified 1711
313 Ga0501082_0013491 3300060353 Bacteria 7020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0054870 Ga0495664_0054870_1521_2360 276
2 3300046455 Ga0495603_0112282 Ga0495603_0112282_23_931 299
3 3300048910 Ga0496107_0058271 Ga0496107_0058271_1848_2756 299
4 3300049460 Ga0495682_0048418 Ga0495682_0048418_603_1511 299
5 iso_pu_bacteria 2513237166 2514050341 309
6 iso_pu_bacteria 642555112 642597664 309
7 3300048912 Ga0496109_0009678 Ga0496109_0009678_2384_3319 310
8 3300048914 Ga0496111_0067282 Ga0496111_0067282_1288_2223 310
9 3300005336 Ga0070680_100270506 Ga0070680_1002705061 312
10 3300005406 Ga0070703_10000104 Ga0070703_1000010411 312
11 3300050515 nmdc:mga0a205_337920_c1 nmdc:mga0a205_337920_c1_108_1061 312
12 iso_pu_bacteria 2711768613 2713476207 312
13 iso_pu_bacteria 2751185846 2753568269 312
14 iso_pu_bacteria 2904615490 2904616365 312
15 3300037471 Ga0395905_0000024 Ga0395905_0000024_117043_117993 313
16 3300005347 Ga0070668_100069167 Ga0070668_1000691672 316
17 3300005367 Ga0070667_100082849 Ga0070667_1000828493 316
18 3300005455 Ga0070663_100042251 Ga0070663_1000422513 316
19 3300005456 Ga0070678_100157673 Ga0070678_1001576732 316
20 3300013306 Ga0163162_10000890 Ga0163162_100008905 316
21 3300013308 Ga0157375_10013631 Ga0157375_100136313 316
22 3300025926 Ga0207659_10153334 Ga0207659_101533342 316
23 3300026067 Ga0207678_10076548 Ga0207678_100765483 316
24 3300026121 Ga0207683_10204172 Ga0207683_102041722 316
25 3300046454 Ga0495592_0218714 Ga0495592_0218714_205_1164 316
26 3300046460 Ga0495638_0000812 Ga0495638_0000812_28565_29524 316
27 3300046472 Ga0495580_0005813 Ga0495580_0005813_6081_7040 316
28 3300046474 Ga0495605_0001075 Ga0495605_0001075_12879_13838 316
29 3300046506 Ga0495583_0025482 Ga0495583_0025482_330_1289 316
30 3300046506 Ga0495583_0026969 Ga0495583_0026969_1711_2670 316
31 3300046513 Ga0495616_0061695 Ga0495616_0061695_176_1135 316
32 3300046531 Ga0495665_0029915 Ga0495665_0029915_1415_2374 316
33 3300046531 Ga0495665_0035706 Ga0495665_0035706_950_1909 316
34 3300046543 Ga0495645_0008242 Ga0495645_0008242_2375_3334 316
35 3300046616 Ga0495668_0212096 Ga0495668_0212096_32_991 316
36 3300046691 Ga0495670_0001264 Ga0495670_0001264_3637_4596 316
37 3300046692 Ga0495671_0026291 Ga0495671_0026291_1571_2530 316
38 3300046794 Ga0495589_0000541 Ga0495589_0000541_11757_12716 316
39 3300046810 Ga0495660_0129143 Ga0495660_0129143_87_1046 316
40 3300047317 Ga0495604_0056491 Ga0495604_0056491_970_1929 316
41 3300047319 Ga0495674_0009895 Ga0495674_0009895_4638_5597 316
42 3300047319 Ga0495674_0011375 Ga0495674_0011375_5529_6488 316
43 3300047320 Ga0495672_0015341 Ga0495672_0015341_1031_1990 316
44 3300047323 Ga0495683_0036869 Ga0495683_0036869_812_1771 316
45 3300047443 Ga0495687_057372 Ga0495687_057372_116_1075 316
46 3300047445 Ga0495677_0055039 Ga0495677_0055039_65_1024 316
47 3300047447 Ga0495685_020530 Ga0495685_020530_521_1480 316
48 3300047469 Ga0495673_0047349 Ga0495673_0047349_611_1570 316
49 3300048091 Ga0495626_0019575 Ga0495626_0019575_659_1618 316
50 3300048091 Ga0495626_0039946 Ga0495626_0039946_544_1503 316
51 3300048903 Ga0496100_0006304 Ga0496100_0006304_3483_4442 316
52 3300048903 Ga0496100_0025577 Ga0496100_0025577_1482_2441 316
53 3300048904 Ga0496101_0012993 Ga0496101_0012993_1705_2664 316
54 3300048905 Ga0496102_0070775 Ga0496102_0070775_538_1497 316
55 3300048905 Ga0496102_0254255 Ga0496102_0254255_595_1554 316
56 3300048907 Ga0496104_0106754 Ga0496104_0106754_1476_2435 316
57 3300048907 Ga0496104_0117740 Ga0496104_0117740_1376_2335 316
58 3300048908 Ga0496105_0019494 Ga0496105_0019494_1907_2866 316
59 3300048908 Ga0496105_0097319 Ga0496105_0097319_461_1420 316
60 3300048909 Ga0496106_0037606 Ga0496106_0037606_2016_2975 316
61 3300048924 Ga0496121_0021961 Ga0496121_0021961_249_1208 316
62 3300048924 Ga0496121_0044446 Ga0496121_0044446_1679_2638 316
63 3300049459 Ga0495678_041493 Ga0495678_041493_504_1463 316
64 3300049822 Ga0501035_0202085 Ga0501035_0202085_494_1456 317
65 3300005293 Ga0065715_10160330 Ga0065715_101603301 322
66 3300005293 Ga0065715_10172605 Ga0065715_101726052 322
67 3300005328 Ga0070676_10152549 Ga0070676_101525492 322
68 3300005330 Ga0070690_100012457 Ga0070690_1000124573 322
69 3300005331 Ga0070670_100025579 Ga0070670_1000255795 322
70 3300005331 Ga0070670_100048835 Ga0070670_1000488353 322
71 3300005334 Ga0068869_100337751 Ga0068869_1003377511 322
72 3300005338 Ga0068868_100238195 Ga0068868_1002381952 322
73 3300005339 Ga0070660_100097964 Ga0070660_1000979642 322
74 3300005344 Ga0070661_100095408 Ga0070661_1000954083 322
75 3300005347 Ga0070668_100155334 Ga0070668_1001553342 322
76 3300005354 Ga0070675_100009774 Ga0070675_1000097749 322
77 3300005354 Ga0070675_100249721 Ga0070675_1002497211 322
78 3300005356 Ga0070674_100024943 Ga0070674_1000249435 322
79 3300005364 Ga0070673_100014248 Ga0070673_1000142482 322
80 3300005364 Ga0070673_100298319 Ga0070673_1002983192 322
81 3300005366 Ga0070659_100366028 Ga0070659_1003660281 322
82 3300005367 Ga0070667_100007147 Ga0070667_1000071474 322
83 3300005367 Ga0070667_100160031 Ga0070667_1001600312 322
84 3300005456 Ga0070678_100004297 Ga0070678_1000042978 322
85 3300005458 Ga0070681_10009095 Ga0070681_100090956 322
86 3300005458 Ga0070681_10043353 Ga0070681_100433533 322
87 3300005530 Ga0070679_100116708 Ga0070679_1001167082 322
88 3300005539 Ga0068853_100025323 Ga0068853_1000253235 322
89 3300005543 Ga0070672_100191647 Ga0070672_1001916472 322
90 3300005543 Ga0070672_100349603 Ga0070672_1003496032 322
91 3300005547 Ga0070693_100113905 Ga0070693_1001139052 322
92 3300005564 Ga0070664_100006021 Ga0070664_1000060214 322
93 3300005564 Ga0070664_100431808 Ga0070664_1004318081 322
94 3300005617 Ga0068859_100012143 Ga0068859_1000121439 322
95 3300005617 Ga0068859_100121148 Ga0068859_1001211482 322
96 3300005617 Ga0068859_100247267 Ga0068859_1002472672 322
97 3300005618 Ga0068864_100029960 Ga0068864_1000299602 322
98 3300005618 Ga0068864_100032244 Ga0068864_1000322443 322
99 3300005618 Ga0068864_100134861 Ga0068864_1001348612 322
100 3300005718 Ga0068866_10072108 Ga0068866_100721082 322
101 3300005834 Ga0068851_10086068 Ga0068851_100860682 322
102 3300005841 Ga0068863_100396055 Ga0068863_1003960552 322
103 3300005842 Ga0068858_100025469 Ga0068858_1000254693 322
104 3300005843 Ga0068860_100030238 Ga0068860_1000302383 322
105 3300005843 Ga0068860_100066642 Ga0068860_1000666424 322
106 3300005844 Ga0068862_100091380 Ga0068862_1000913803 322
107 3300006237 Ga0097621_100138055 Ga0097621_1001380553 322
108 3300006237 Ga0097621_100487954 Ga0097621_1004879541 322
109 3300006358 Ga0068871_100267251 Ga0068871_1002672512 322
110 3300006931 Ga0097620_100012143 Ga0097620_1000121439 322
111 3300006931 Ga0097620_100121146 Ga0097620_1001211462 322
112 3300006931 Ga0097620_100247267 Ga0097620_1002472672 322
113 3300009176 Ga0105242_10064603 Ga0105242_100646034 322
114 3300009177 Ga0105248_10120767 Ga0105248_101207672 322
115 3300009553 Ga0105249_10040676 Ga0105249_100406763 322
116 3300009553 Ga0105249_10055853 Ga0105249_100558531 322
117 3300010375 Ga0105239_10009920 Ga0105239_100099209 322
118 3300010375 Ga0105239_10534575 Ga0105239_105345752 322
119 3300013100 Ga0157373_10355010 Ga0157373_103550101 322
120 3300013105 Ga0157369_10110734 Ga0157369_101107344 322
121 3300013297 Ga0157378_10069379 Ga0157378_100693791 322
122 3300013306 Ga0163162_10207008 Ga0163162_102070082 322
123 3300013306 Ga0163162_10498837 Ga0163162_104988371 322
124 3300013307 Ga0157372_10038819 Ga0157372_100388195 322
125 3300013307 Ga0157372_10453656 Ga0157372_104536562 322
126 3300013307 Ga0157372_10471442 Ga0157372_104714422 322
127 3300013308 Ga0157375_10025012 Ga0157375_100250122 322
128 3300013308 Ga0157375_10081534 Ga0157375_100815343 322
129 3300014325 Ga0163163_10007699 Ga0163163_100076994 322
130 3300014325 Ga0163163_10063178 Ga0163163_100631783 322
131 3300014326 Ga0157380_10172688 Ga0157380_101726882 322
132 3300014968 Ga0157379_10221789 Ga0157379_102217892 322
133 3300017792 Ga0163161_10018515 Ga0163161_100185154 322
134 3300017792 Ga0163161_10034425 Ga0163161_100344252 322
135 3300017792 Ga0163161_10071175 Ga0163161_100711752 322
136 3300025912 Ga0207707_10005199 Ga0207707_100051996 322
137 3300025912 Ga0207707_10054256 Ga0207707_100542563 322
138 3300025919 Ga0207657_10207187 Ga0207657_102071872 322
139 3300025921 Ga0207652_10098302 Ga0207652_100983023 322
140 3300025925 Ga0207650_10062495 Ga0207650_100624952 322
141 3300025926 Ga0207659_10166437 Ga0207659_101664372 322
142 3300025933 Ga0207706_10028747 Ga0207706_100287474 322
143 3300025934 Ga0207686_10071294 Ga0207686_100712942 322
144 3300025937 Ga0207669_10064187 Ga0207669_100641872 322
145 3300025940 Ga0207691_10202415 Ga0207691_102024152 322
146 3300025941 Ga0207711_10045197 Ga0207711_100451975 322
147 3300025941 Ga0207711_10125535 Ga0207711_101255352 322
148 3300025945 Ga0207679_10066910 Ga0207679_100669104 322
149 3300025949 Ga0207667_10035971 Ga0207667_100359716 322
150 3300025960 Ga0207651_10048977 Ga0207651_100489772 322
151 3300025960 Ga0207651_10113420 Ga0207651_101134202 322
152 3300025961 Ga0207712_10007967 Ga0207712_100079674 322
153 3300025961 Ga0207712_10101434 Ga0207712_101014342 322
154 3300025981 Ga0207640_10119946 Ga0207640_101199462 322
155 3300025981 Ga0207640_10167095 Ga0207640_101670952 322
156 3300025986 Ga0207658_10008601 Ga0207658_100086014 322
157 3300025986 Ga0207658_10097816 Ga0207658_100978162 322
158 3300026088 Ga0207641_10063081 Ga0207641_100630813 322
159 3300026088 Ga0207641_10133050 Ga0207641_101330502 322
160 3300026095 Ga0207676_10006084 Ga0207676_100060846 322
161 3300026095 Ga0207676_10074586 Ga0207676_100745863 322
162 3300026121 Ga0207683_10023519 Ga0207683_100235193 322
163 3300026121 Ga0207683_10192923 Ga0207683_101929232 322
164 3300028380 Ga0268265_10045264 Ga0268265_100452643 322
165 3300028381 Ga0268264_10013110 Ga0268264_100131105 322
166 3300028381 Ga0268264_10051732 Ga0268264_100517322 322
167 3300028381 Ga0268264_10411490 Ga0268264_104114901 322
168 3300031548 Ga0307408_100065525 Ga0307408_1000655254 322
169 3300031548 Ga0307408_100077209 Ga0307408_1000772092 322
170 3300031548 Ga0307408_100120961 Ga0307408_1001209611 322
171 3300031731 Ga0307405_10015059 Ga0307405_100150592 322
172 3300031731 Ga0307405_10053119 Ga0307405_100531191 322
173 3300031824 Ga0307413_10031326 Ga0307413_100313262 322
174 3300031824 Ga0307413_10093860 Ga0307413_100938602 322
175 3300031824 Ga0307413_10123079 Ga0307413_101230792 322
176 3300031852 Ga0307410_10001672 Ga0307410_100016724 322
177 3300031852 Ga0307410_10002195 Ga0307410_100021952 322
178 3300031852 Ga0307410_10037540 Ga0307410_100375403 322
179 3300031901 Ga0307406_10036550 Ga0307406_100365503 322
180 3300031901 Ga0307406_10092244 Ga0307406_100922441 322
181 3300031901 Ga0307406_10193680 Ga0307406_101936802 322
182 3300031901 Ga0307406_10437287 Ga0307406_104372871 322
183 3300031903 Ga0307407_10001250 Ga0307407_100012502 322
184 3300031903 Ga0307407_10001410 Ga0307407_100014102 322
185 3300031903 Ga0307407_10016425 Ga0307407_100164253 322
186 3300031911 Ga0307412_10072984 Ga0307412_100729842 322
187 3300031911 Ga0307412_10161189 Ga0307412_101611892 322
188 3300031995 Ga0307409_100004310 Ga0307409_1000043108 322
189 3300031995 Ga0307409_100047011 Ga0307409_1000470111 322
190 3300031995 Ga0307409_100085848 Ga0307409_1000858483 322
191 3300031995 Ga0307409_100134291 Ga0307409_1001342913 322
192 3300031995 Ga0307409_100367537 Ga0307409_1003675371 322
193 3300032002 Ga0307416_100029184 Ga0307416_1000291845 322
194 3300032002 Ga0307416_100054128 Ga0307416_1000541284 322
195 3300032004 Ga0307414_10012889 Ga0307414_100128893 322
196 3300032005 Ga0307411_10005863 Ga0307411_100058633 322
197 3300032005 Ga0307411_10005901 Ga0307411_100059018 322
198 3300032005 Ga0307411_10247879 Ga0307411_102478792 322
199 3300046616 Ga0495668_0008270 Ga0495668_0008270_2775_3743 322
200 3300049588 Ga0501072_0016435 Ga0501072_0016435_3694_4662 322
201 3300049705 Ga0501225_0025592 Ga0501225_0025592_289_1257 322
202 3300054114 Ga0501084_0194521 Ga0501084_0194521_196_1164 322
203 3300005356 Ga0070674_100370456 Ga0070674_1003704561 323
204 3300005471 Ga0070698_100198715 Ga0070698_1001987152 323
205 3300005539 Ga0068853_100003250 Ga0068853_10000325010 323
206 3300005719 Ga0068861_100130505 Ga0068861_1001305051 323
207 3300009147 Ga0114129_10159511 Ga0114129_101595112 323
208 3300009177 Ga0105248_10328385 Ga0105248_103283852 323
209 3300013105 Ga0157369_10078113 Ga0157369_100781131 323
210 3300013306 Ga0163162_10407352 Ga0163162_104073522 323
211 3300013308 Ga0157375_10034072 Ga0157375_100340726 323
212 3300021384 Ga0213876_10010703 Ga0213876_100107034 323
213 3300025909 Ga0207705_10009008 Ga0207705_100090083 323
214 3300025913 Ga0207695_10186960 Ga0207695_101869602 323
215 3300026041 Ga0207639_10002398 Ga0207639_100023982 323
216 3300031548 Ga0307408_100167565 Ga0307408_1001675652 323
217 3300031852 Ga0307410_10140393 Ga0307410_101403931 323
218 3300031995 Ga0307409_100185577 Ga0307409_1001855772 323
219 3300032005 Ga0307411_10216705 Ga0307411_102167051 323
220 3300039437 Ga0436365_1540433 Ga0436365_1540433_3787_4764 323
221 3300046519 Ga0495632_0035227 Ga0495632_0035227_1085_2062 323
222 3300003203 JGI25406J46586_10000855 JGI25406J46586_1000085513 324
223 3300005295 Ga0065707_10117943 Ga0065707_101179432 324
224 3300005331 Ga0070670_100085062 Ga0070670_1000850622 324
225 3300005364 Ga0070673_100366546 Ga0070673_1003665462 324
226 3300005617 Ga0068859_100109200 Ga0068859_1001092002 324
227 3300005618 Ga0068864_100174530 Ga0068864_1001745302 324
228 3300005985 Ga0081539_10001016 Ga0081539_1000101642 324
229 3300005985 Ga0081539_10001250 Ga0081539_1000125023 324
230 3300006931 Ga0097620_100109201 Ga0097620_1001092012 324
231 3300009148 Ga0105243_10120094 Ga0105243_101200942 324
232 3300009553 Ga0105249_10117782 Ga0105249_101177822 324
233 3300009553 Ga0105249_10217997 Ga0105249_102179972 324
234 3300013306 Ga0163162_10303769 Ga0163162_103037692 324
235 3300013307 Ga0157372_10250124 Ga0157372_102501242 324
236 3300013307 Ga0157372_10291591 Ga0157372_102915912 324
237 3300014326 Ga0157380_10602344 Ga0157380_106023442 324
238 3300014745 Ga0157377_10016856 Ga0157377_100168563 324
239 3300025920 Ga0207649_10127473 Ga0207649_101274731 324
240 3300025925 Ga0207650_10098293 Ga0207650_100982931 324
241 3300025931 Ga0207644_10062290 Ga0207644_100622902 324
242 3300025940 Ga0207691_10184354 Ga0207691_101843543 324
243 3300025945 Ga0207679_10069282 Ga0207679_100692822 324
244 3300025961 Ga0207712_10239835 Ga0207712_102398351 324
245 3300031456 Ga0307513_10008476 Ga0307513_100084763 324
246 3300031731 Ga0307405_10093325 Ga0307405_100933252 324
247 3300031824 Ga0307413_10130988 Ga0307413_101309882 324
248 3300031852 Ga0307410_10041105 Ga0307410_100411052 324
249 3300031852 Ga0307410_10079015 Ga0307410_100790152 324
250 3300031903 Ga0307407_10017349 Ga0307407_100173492 324
251 3300031995 Ga0307409_100100901 Ga0307409_1001009012 324
252 3300032005 Ga0307411_10011255 Ga0307411_100112552 324
253 3300032126 Ga0307415_100018753 Ga0307415_1000187532 324
254 3300049679 Ga0501249_012228 Ga0501249_012228_294_1268 324
255 3300053142 Ga0500577_0000972 Ga0500577_0000972_3931_4905 324
256 3300000549 LJQas_1000102 LJQas_10001025 325
257 3300003578 Ga0006562J51391_1009572 Ga0006562J51391_10095722 325
258 3300005295 Ga0065707_10094889 Ga0065707_100948892 325
259 3300005434 Ga0070709_10000001 Ga0070709_1000000131 325
260 3300005439 Ga0070711_100000020 Ga0070711_10000002068 325
261 3300005440 Ga0070705_100000038 Ga0070705_10000003811 325
262 3300005467 Ga0070706_100000007 Ga0070706_100000007115 325
263 3300005518 Ga0070699_100000420 Ga0070699_10000042030 325
264 3300005536 Ga0070697_100000071 Ga0070697_10000007144 325
265 3300005546 Ga0070696_100000117 Ga0070696_10000011730 325
266 3300005547 Ga0070693_100014877 Ga0070693_1000148772 325
267 3300005549 Ga0070704_100019701 Ga0070704_1000197012 325
268 3300005577 Ga0068857_100469526 Ga0068857_1004695261 325
269 3300005842 Ga0068858_100107080 Ga0068858_1001070803 325
270 3300006852 Ga0075433_10256525 Ga0075433_102565251 325
271 3300006880 Ga0075429_100017885 Ga0075429_1000178855 325
272 3300006914 Ga0075436_100000161 Ga0075436_1000001617 325
273 3300006914 Ga0075436_100173724 Ga0075436_1001737241 325
274 3300009094 Ga0111539_10115266 Ga0111539_101152661 325
275 3300009147 Ga0114129_10025325 Ga0114129_100253252 325
276 3300009147 Ga0114129_10027692 Ga0114129_100276929 325
277 3300009147 Ga0114129_10090244 Ga0114129_100902443 325
278 3300009147 Ga0114129_10756682 Ga0114129_107566821 325
279 3300009147 Ga0114129_10837144 Ga0114129_108371441 325
280 3300013297 Ga0157378_10119126 Ga0157378_101191263 325
281 3300014326 Ga0157380_10016098 Ga0157380_100160983 325
282 3300014968 Ga0157379_10067664 Ga0157379_100676643 325
283 3300025229 Ga0209147_100050 Ga0209147_10005095 325
284 3300025885 Ga0207653_10000064 Ga0207653_1000006444 325
285 3300025906 Ga0207699_10000004 Ga0207699_10000004356 325
286 3300025910 Ga0207684_10006625 Ga0207684_100066253 325
287 3300025916 Ga0207663_10000202 Ga0207663_100002026 325
288 3300025939 Ga0207665_10059625 Ga0207665_100596251 325
289 3300026075 Ga0207708_10335333 Ga0207708_103353331 325
290 3300026116 Ga0207674_10461368 Ga0207674_104613681 325
291 3300031548 Ga0307408_100030470 Ga0307408_1000304702 325
292 3300031731 Ga0307405_10131692 Ga0307405_101316922 325
293 3300031911 Ga0307412_10157555 Ga0307412_101575552 325
294 3300032002 Ga0307416_100040723 Ga0307416_1000407231 325
295 3300032002 Ga0307416_100067915 Ga0307416_1000679152 325
296 3300046810 Ga0495660_0067308 Ga0495660_0067308_727_1758 325
297 3300047321 Ga0495676_0211428 Ga0495676_0211428_107_1144 325
298 3300048905 Ga0496102_0187768 Ga0496102_0187768_136_1167 325
299 3300048915 Ga0496112_0483907 Ga0496112_0483907_79_1116 325
300 3300049577 Ga0501041_0019911 Ga0501041_0019911_143_1135 325
301 3300049578 Ga0501042_0018747 Ga0501042_0018747_403_1395 325
302 3300049580 Ga0501046_0191567 Ga0501046_0191567_471_1463 325
303 3300049588 Ga0501072_0135685 Ga0501072_0135685_464_1456 325
304 3300049591 Ga0501075_0005685 Ga0501075_0005685_4687_5679 325
305 3300049592 Ga0501076_0401880 Ga0501076_0401880_122_1114 325
306 3300049593 Ga0501077_0020978 Ga0501077_0020978_375_1367 325
307 3300049661 Ga0501217_011286 Ga0501217_011286_852_1892 325
308 3300049743 Ga0501081_0020913 Ga0501081_0020913_1915_2907 325
309 3300050507 nmdc:mga05p37_125144_c1 nmdc:mga05p37_125144_c1_1169_2167 325
310 3300050507 nmdc:mga05p37_169491_c1 nmdc:mga05p37_169491_c1_1111_2109 325
311 3300050507 nmdc:mga05p37_3771_c1 nmdc:mga05p37_3771_c1_119_1114 325
312 3300050508 nmdc:mga09592_32211_c1 nmdc:mga09592_32211_c1_2337_3335 325
313 3300050511 nmdc:mga08y16_234716_c1 nmdc:mga08y16_234716_c1_634_1707 325
314 3300050514 nmdc:mga08x19_33_c1 nmdc:mga08x19_33_c1_62237_63232 325
315 3300050515 nmdc:mga0a205_38328_c1 nmdc:mga0a205_38328_c1_133_1128 325
316 3300050515 nmdc:mga0a205_411510_c1 nmdc:mga0a205_411510_c1_97_1092 325
317 3300053153 Ga0500616_0000961 Ga0500616_0000961_29459_30442 325
318 3300060353 Ga0501082_0013491 Ga0501082_0013491_353_1345 325
319 iso_pu_bacteria 2510917027 2511177707 325
320 iso_pu_bacteria 2512564013 2512640213 325
321 iso_pu_bacteria 2738541295 2738812712 325
322 iso_pu_bacteria 2857460504 2857462463 325
323 iso_pu_bacteria 2857465823 2857472630 325
324 iso_pu_bacteria 2857591370 2857593499 325
325 iso_pu_bacteria 2915597211 2915600311 325
326 iso_pu_bacteria 2915606848 2915609874 325
327 iso_pu_bacteria 2919414237 2919419164 325
328 iso_pu_bacteria 2929183550 2929185492 325
329 iso_pu_bacteria 2936361878 2936365061 325
330 iso_pu_bacteria 2964375228 2964375662 325
331 iso_pu_bacteria 2977254563 2977258529 325
332 iso_pu_bacteria 2990275345 2990279567 325
333 iso_pu_bacteria 3001892409 3001893706 325
334 iso_pu_bacteria 3006978542 3006978983 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

241

321

0.99

PF01012

ETF

Electron transfer flavoprotein domain

30

223

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9144 2 191
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9008 2 191
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8574 1 195
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8533 1 195
4l2i-assembly1.cif.gz_A electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation 0.8343 2 325
ID Description Score Start End Superfamily
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9626 195 320 3.40.50.1220
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9446 196 325 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9337 195 320 3.40.50.1220
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9238 196 325 3.40.50.1220
af_Q46907_159_286_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9216 199 325 3.40.50.1220
ID Description Score Start End GO Terms
AF-X0S2B0-F1-model_v4 Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein 0.9897 202 324 GO:0009055
GO:0033539
GO:0050660
AF-A0A7J3P607-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9831 224 325 GO:0009055
GO:0033539
GO:0050660
AF-A0A644ZYC3-F1-model_v4 Protein FixB 0.9829 202 320 GO:0005506
GO:0009055
GO:0033539
GO:0050660
AF-A0A7C5VM81-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.9824 235 323 GO:0009055
GO:0033539
GO:0050660
AF-A0A1C5DSN9-F1-model_v4 Electron transfer flavoprotein alpha subunit apoprotein 0.982 201 325 GO:0009055
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
90.13 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map