F411545

General Info

Members Datasets Scaffolds Average Seq Length
333 181 666 329

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0009163|Ga0501069_0009163_418_1581
Length 387
Sequence VKGRLLRGTMRARWLRCRRSMDSQYAVATDALPSHPPGAARDAAPPRIEAQALSVRDLSVSYDGTPAVVGADLDLAEGRVLAVLGPSGCGKSTLLRAIAGLEPATGRVCWHDDDVSAVPTHRRGFALMFQDGQLFPQLTVGHNVGYPLRLRRTPRARVAERVAELLGLVGLTGFADRLPSTLSGGERQRVALARALAAAPRLLLLDEPLSALDAGLRQRLAEDLRRILVEAGTTAVMVTHDHEEAFAVADDLAVMRAGRLVQSGPIADVWREPADAETALFLGYARVVEGPPAASLLRAAGLPDAPRVAVRRSALAVADGGPLSGRVLEVRTTPGQLRLLLDTELGELDAVASLDRRLGPGDDVRLRVEPTRMAVLAGGSGRPSVGP

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2643221561 Nocardioides sp. Root151 Isolate Unclassified
159 2643221576 Nocardioides sp. Root614 Isolate Unclassified
160 2643221590 Nocardioides sp. Root682 Isolate Unclassified
161 2643221604 Nocardioides sp. Root190 Isolate Unclassified
162 2643221615 Nocardioides sp. Root224 Isolate Unclassified
163 2643221617 Nocardioides sp. Root79 Isolate Unclassified
164 2643221620 Nocardioides sp. Root240 Isolate Unclassified
165 2643221641 Nocardioides sp. Root122 Isolate Unclassified
166 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
167 2643221696 Nocardioides sp. Root140 Isolate Unclassified
168 2738541305 Nocardioides sp. CF167 Isolate Unclassified
169 2739367898 Nocardioides sp. CF479 Isolate Unclassified
170 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
171 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
172 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
173 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
174 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
175 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
176 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
177 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
178 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
179 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
180 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
181 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 15.02
Nodule 0.3
Rhizoplane 7.21
Rhizosphere 70.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0009163 3300049585 Bacteria 5226
2 Ga0070658_10028273 3300005327 Bacteria 4501
3 Ga0070683_100036425 3300005329 Bacteria 4501
4 Ga0070683_100068509 3300005329 Bacteria 3306
5 Ga0070682_100013581 3300005337 Bacteria 4690
6 Ga0070682_100269717 3300005337 Bacteria 1236
7 Ga0068868_100056788 3300005338 Bacteria 3092
8 Ga0070660_100005216 3300005339 Bacteria 8984
9 Ga0070660_100059099 3300005339 Bacteria 2973
10 Ga0070692_10001975 3300005345 Bacteria 7764
11 Ga0070668_100369155 3300005347 Bacteria 1219
12 Ga0070659_100001658 3300005366 Bacteria 16043
13 Ga0070667_100079580 3300005367 Bacteria 2802
14 Ga0070701_10005749 3300005438 Bacteria 5157
15 Ga0070700_100010578 3300005441 Bacteria 5097
16 Ga0070708_100143518 3300005445 Bacteria 2216
17 Ga0070663_100049734 3300005455 Bacteria 2979
18 Ga0070681_10078249 3300005458 Bacteria 3264
19 Ga0068867_100005118 3300005459 Bacteria 9266
20 Ga0070685_10115520 3300005466 Bacteria 1660
21 Ga0070707_100361419 3300005468 Bacteria 1410
22 Ga0070698_100001937 3300005471 Bacteria 22997
23 Ga0070684_100030708 3300005535 Bacteria 4568
24 Ga0068853_100045287 3300005539 Bacteria 3767
25 Ga0070672_100016887 3300005543 Bacteria 5237
26 Ga0070665_100001178 3300005548 Bacteria 32035
27 Ga0070664_100012467 3300005564 Bacteria 6911
28 Ga0068854_100103331 3300005578 Bacteria 2139
29 Ga0068856_100064860 3300005614 Bacteria 3609
30 Ga0070702_100006030 3300005615 Bacteria 5706
31 Ga0070702_100029041 3300005615 Bacteria 3003
32 Ga0068852_100053664 3300005616 Bacteria 3471
33 Ga0068852_100143537 3300005616 Bacteria 2212
34 Ga0068861_100143814 3300005719 Bacteria 1950
35 Ga0068870_10012498 3300005840 Bacteria 3969
36 Ga0068860_100000578 3300005843 Bacteria 44029
37 Ga0075365_10021368 3300006038 Bacteria 4037
38 Ga0075365_10024168 3300006038 Bacteria 3829
39 Ga0075365_10140459 3300006038 Bacteria 1676
40 Ga0075365_10145119 3300006038 Bacteria 1649
41 Ga0075365_10182504 3300006038 Bacteria 1467
42 Ga0075368_10003832 3300006042 Bacteria 5058
43 Ga0075368_10022623 3300006042 Bacteria 2394
44 Ga0075368_10029248 3300006042 Bacteria 2130
45 Ga0075363_100003098 3300006048 Bacteria 6979
46 Ga0075363_100005391 3300006048 Bacteria 5684
47 Ga0075364_10014817 3300006051 Bacteria 4823
48 Ga0075364_10074544 3300006051 Bacteria 2238
49 Ga0075364_10112639 3300006051 Bacteria 1816
50 Ga0075364_10142974 3300006051 Bacteria 1610
51 Ga0075367_10024675 3300006178 Bacteria 3392
52 Ga0075367_10060780 3300006178 Bacteria 2253
53 Ga0075370_10006523 3300006353 Bacteria 5875
54 Ga0075370_10056107 3300006353 Bacteria 2238
55 Ga0075370_10185211 3300006353 Bacteria 1226
56 Ga0068865_100013250 3300006881 Bacteria 5208
57 Ga0068865_100018053 3300006881 Bacteria 4548
58 Ga0105243_10043231 3300009148 Bacteria 3531
59 Ga0105243_10117846 3300009148 Bacteria 2233
60 Ga0105243_10253647 3300009148 Bacteria 1572
61 Ga0105242_10047666 3300009176 Bacteria 3480
62 Ga0105242_10429745 3300009176 Bacteria 1240
63 Ga0105237_10083073 3300009545 Bacteria 3194
64 Ga0105237_10250585 3300009545 Bacteria 1773
65 Ga0105249_10158248 3300009553 Bacteria 2187
66 Ga0105249_10334566 3300009553 Bacteria 1529
67 Ga0105239_10004448 3300010375 Bacteria 16756
68 Ga0157369_10086489 3300013105 Bacteria 3348
69 Ga0163162_10028384 3300013306 Bacteria 5536
70 Ga0157372_10146581 3300013307 Bacteria 2722
71 Ga0163163_10022488 3300014325 Bacteria 5972
72 Ga0163163_10077596 3300014325 Bacteria 3317
73 Ga0163163_10078038 3300014325 Bacteria 3308
74 Ga0163163_10415695 3300014325 Bacteria 1404
75 Ga0163163_10571450 3300014325 Bacteria 1193
76 Ga0157380_10008296 3300014326 Bacteria 7403
77 Ga0182008_10107865 3300014497 Bacteria 1379
78 Ga0157377_10067169 3300014745 Bacteria 2064
79 Ga0163161_10037444 3300017792 Bacteria 3478
80 Ga0163161_10137805 3300017792 Bacteria 1846
81 Ga0207688_10019901 3300025901 Bacteria 3660
82 Ga0207643_10016985 3300025908 Bacteria 3972
83 Ga0207707_10129412 3300025912 Bacteria 2208
84 Ga0207706_10037587 3300025933 Bacteria 4298
85 Ga0207669_10062090 3300025937 Bacteria 2300
86 Ga0207691_10004844 3300025940 Bacteria 13015
87 Ga0207661_10117370 3300025944 Bacteria 2260
88 Ga0207679_10181529 3300025945 Bacteria 1741
89 Ga0207658_10036626 3300025986 Bacteria 3519
90 Ga0207658_10041005 3300025986 Bacteria 3350
91 Ga0207678_10103654 3300026067 Bacteria 2428
92 Ga0207708_10005055 3300026075 Bacteria 9732
93 Ga0207648_10007851 3300026089 Bacteria 10409
94 Ga0207676_10098343 3300026095 Bacteria 2419
95 Ga0207674_10147739 3300026116 Bacteria 2308
96 Ga0207675_100040245 3300026118 Bacteria 4364
97 Ga0207428_10137555 3300027907 Bacteria 1867
98 Ga0268266_10003092 3300028379 Bacteria 16976
99 Ga0268264_10000226 3300028381 Bacteria 109817
100 Ga0316176_1203608 3300030732 Bacteria 1460
101 Ga0307408_100145686 3300031548 Bacteria 1864
102 Ga0307405_10013411 3300031731 Bacteria 4370
103 Ga0307405_10026852 3300031731 Bacteria 3329
104 Ga0307413_10071036 3300031824 Bacteria 2192
105 Ga0307410_10041922 3300031852 Bacteria 3021
106 Ga0307410_10060878 3300031852 Bacteria 2582
107 Ga0307406_10069885 3300031901 Bacteria 2297
108 Ga0307407_10050202 3300031903 Bacteria 2386
109 Ga0307407_10082602 3300031903 Bacteria 1947
110 Ga0307409_100038973 3300031995 Bacteria 3521
111 Ga0307409_100052253 3300031995 Bacteria 3131
112 Ga0307409_100099444 3300031995 Bacteria 2409
113 Ga0307416_100000602 3300032002 Bacteria 18517
114 Ga0307416_100024665 3300032002 Bacteria 4395
115 Ga0307414_10082188 3300032004 Bacteria 2361
116 Ga0307415_100000040 3300032126 Bacteria 56119
117 Ga0307415_100270970 3300032126 Bacteria 1390
118 Ga0395899_0172174 3300037312 Bacteria 1524
119 Ga0395900_0068174 3300037418 Bacteria 3655
120 Ga0395898_0011311 3300037466 Bacteria 9277
121 Ga0395901_0012833 3300038443 Bacteria 8500
122 Ga0395901_0044659 3300038443 Bacteria 4596
123 Ga0395901_0091673 3300038443 Bacteria 3181
124 Ga0439436_0026129 3300041404 Bacteria 1713
125 Ga0466969_0028389 3300044656 Bacteria 2860
126 Ga0466972_0012521 3300044658 Bacteria 4263
127 Ga0466972_0035719 3300044658 Bacteria 2433
128 Ga0466972_0064246 3300044658 Bacteria 1757
129 Ga0466965_0003959 3300044683 Bacteria 6562
130 Ga0466965_0020971 3300044683 Bacteria 3144
131 Ga0466965_0034027 3300044683 Bacteria 2492
132 Ga0466965_0042039 3300044683 Bacteria 2253
133 Ga0466965_0046130 3300044683 Bacteria 2157
134 Ga0466966_0007807 3300044684 Bacteria 7083
135 Ga0466966_0082072 3300044684 Bacteria 2006
136 Ga0466961_0022383 3300044693 Bacteria 4066
137 Ga0466961_0024837 3300044693 Bacteria 3854
138 Ga0466961_0123737 3300044693 Bacteria 1623
139 Ga0466963_0003209 3300044694 Bacteria 9301
140 Ga0466963_0069637 3300044694 Bacteria 2365
141 Ga0466963_0124973 3300044694 Bacteria 1773
142 Ga0466963_0195925 3300044694 Bacteria 1412
143 Ga0466970_0012646 3300044765 Bacteria 4318
144 Ga0466970_0020648 3300044765 Bacteria 3424
145 Ga0466970_0037497 3300044765 Bacteria 2569
146 Ga0466970_0055620 3300044765 Bacteria 2113
147 Ga0466970_0110596 3300044765 Bacteria 1500
148 Ga0466957_0003079 3300044842 Bacteria 9078
149 Ga0466957_0016653 3300044842 Bacteria 4301
150 Ga0466957_0031111 3300044842 Bacteria 3188
151 Ga0466957_0079743 3300044842 Bacteria 2037
152 Ga0466957_0219750 3300044842 Bacteria 1254
153 Ga0466960_0004153 3300044901 Bacteria 5638
154 Ga0466960_0006246 3300044901 Bacteria 4771
155 Ga0466960_0012609 3300044901 Bacteria 3572
156 Ga0466960_0029424 3300044901 Bacteria 2521
157 Ga0466960_0113092 3300044901 Bacteria 1413
158 Ga0466960_0176120 3300044901 Bacteria 1157
159 Ga0466959_0016597 3300045049 Bacteria 5384
160 Ga0466958_0034880 3300045836 Bacteria 3003
161 Ga0466958_0038399 3300045836 Bacteria 2873
162 Ga0466967_0004576 3300045976 Bacteria 9372
163 Ga0466967_0055908 3300045976 Bacteria 3477
164 Ga0466967_0073408 3300045976 Bacteria 3069
165 Ga0466967_0074537 3300045976 Bacteria 3048
166 Ga0466967_0119175 3300045976 Bacteria 2435
167 Ga0466967_0146544 3300045976 Bacteria 2203
168 Ga0466967_0233773 3300045976 Bacteria 1751
169 Ga0466967_0303343 3300045976 Bacteria 1537
170 Ga0495653_0247639 3300046463 Bacteria 1184
171 Ga0495664_0048152 3300046477 Bacteria 2530
172 Ga0496100_0065372 3300048903 Bacteria 2410
173 Ga0496100_0160462 3300048903 Bacteria 1611
174 Ga0496102_0074939 3300048905 Bacteria 3111
175 Ga0496102_0242260 3300048905 Bacteria 1700
176 Ga0496102_0300683 3300048905 Bacteria 1512
177 Ga0496104_0002997 3300048907 Bacteria 14550
178 Ga0496105_0005659 3300048908 Bacteria 9509
179 Ga0496106_0207891 3300048909 Bacteria 1559
180 Ga0496107_0021132 3300048910 Bacteria 4600
181 Ga0496108_0113946 3300048911 Bacteria 2314
182 Ga0496109_0030512 3300048912 Bacteria 4832
183 Ga0496109_0066302 3300048912 Bacteria 3306
184 Ga0496109_0108913 3300048912 Bacteria 2575
185 Ga0496109_0123986 3300048912 Bacteria 2408
186 Ga0496110_0014390 3300048913 Bacteria 6568
187 Ga0496110_0148114 3300048913 Bacteria 2124
188 Ga0496110_0182964 3300048913 Bacteria 1903
189 Ga0496110_0216930 3300048913 Bacteria 1740
190 Ga0496112_0132038 3300048915 Bacteria 2468
191 Ga0496114_0006395 3300048917 Bacteria 9277
192 Ga0496114_0018634 3300048917 Bacteria 5615
193 Ga0496114_0125303 3300048917 Bacteria 2214
194 Ga0496114_0252274 3300048917 Bacteria 1553
195 Ga0496115_0002856 3300048918 Bacteria 12439
196 Ga0501031_0004866 3300049568 Bacteria 8731
197 Ga0501031_0016187 3300049568 Bacteria 4844
198 Ga0501031_0106091 3300049568 Bacteria 1834
199 Ga0501032_0018077 3300049569 Bacteria 4944
200 Ga0501032_0125836 3300049569 Bacteria 1693
201 Ga0501033_0003293 3300049570 Bacteria 13349
202 Ga0501033_0231783 3300049570 Bacteria 1312
203 Ga0501034_0008850 3300049571 Bacteria 10586
204 Ga0501034_0037289 3300049571 Bacteria 4922
205 Ga0501034_0042339 3300049571 Bacteria 4610
206 Ga0501036_0005812 3300049572 Bacteria 9990
207 Ga0501036_0010461 3300049572 Bacteria 7664
208 Ga0501036_0066092 3300049572 Bacteria 3059
209 Ga0501036_0258482 3300049572 Bacteria 1459
210 Ga0501037_0004898 3300049573 Bacteria 9741
211 Ga0501037_0063770 3300049573 Bacteria 2686
212 Ga0501037_0106738 3300049573 Bacteria 2018
213 Ga0501038_0073733 3300049574 Bacteria 2889
214 Ga0501038_0077816 3300049574 Bacteria 2799
215 Ga0501038_0183423 3300049574 Bacteria 1688
216 Ga0501039_0054282 3300049575 Bacteria 3101
217 Ga0501039_0246443 3300049575 Bacteria 1405
218 Ga0501040_0209846 3300049576 Bacteria 1385
219 Ga0501042_0058340 3300049578 Bacteria 2755
220 Ga0501043_0005295 3300049579 Bacteria 10429
221 Ga0501043_0134277 3300049579 Bacteria 1938
222 Ga0501043_0302952 3300049579 Bacteria 1221
223 Ga0501046_0000399 3300049580 Bacteria 43497
224 Ga0501046_0002438 3300049580 Bacteria 17432
225 Ga0501047_0087571 3300049581 Bacteria 2991
226 Ga0501047_0287819 3300049581 Bacteria 1487
227 Ga0501048_0004479 3300049582 Bacteria 10632
228 Ga0501048_0020701 3300049582 Bacteria 4822
229 Ga0501048_0122764 3300049582 Bacteria 1836
230 Ga0501048_0212474 3300049582 Bacteria 1372
231 Ga0501067_0004318 3300049583 Bacteria 7831
232 Ga0501067_0038975 3300049583 Bacteria 2638
233 Ga0501067_0111222 3300049583 Bacteria 1523
234 Ga0501068_0022316 3300049584 Bacteria 3700
235 Ga0501068_0031162 3300049584 Bacteria 3167
236 Ga0501068_0058890 3300049584 Bacteria 2331
237 Ga0501069_0022141 3300049585 Bacteria 3454
238 Ga0501069_0063005 3300049585 Bacteria 2071
239 Ga0501070_0003386 3300049586 Bacteria 13832
240 Ga0501070_0012345 3300049586 Bacteria 7207
241 Ga0501070_0078063 3300049586 Bacteria 2740
242 Ga0501071_0017320 3300049587 Bacteria 4966
243 Ga0501071_0019699 3300049587 Bacteria 4683
244 Ga0501071_0215058 3300049587 Bacteria 1446
245 Ga0501071_0352825 3300049587 Bacteria 1120
246 Ga0501072_0018753 3300049588 Bacteria 5335
247 Ga0501072_0034440 3300049588 Bacteria 3970
248 Ga0501072_0035610 3300049588 Bacteria 3900
249 Ga0501072_0039197 3300049588 Bacteria 3721
250 Ga0501073_0004509 3300049589 Bacteria 10465
251 Ga0501073_0032272 3300049589 Bacteria 3733
252 Ga0501073_0048953 3300049589 Bacteria 2965
253 Ga0501074_0001368 3300049590 Bacteria 16174
254 Ga0501074_0009053 3300049590 Bacteria 7230
255 Ga0501074_0028683 3300049590 Bacteria 4034
256 Ga0501074_0086270 3300049590 Bacteria 2249
257 Ga0501076_0177895 3300049592 Bacteria 1734
258 Ga0501079_0010830 3300049741 Bacteria 6946
259 Ga0501079_0065108 3300049741 Bacteria 2812
260 Ga0501079_0175315 3300049741 Bacteria 1672
261 Ga0501080_0004256 3300049742 Bacteria 12703
262 Ga0501080_0016091 3300049742 Bacteria 6904
263 Ga0501080_0061367 3300049742 Bacteria 3500
264 Ga0501080_0233574 3300049742 Bacteria 1680
265 Ga0501080_0484530 3300049742 Bacteria 1106
266 Ga0501083_0005594 3300049744 Bacteria 8896
267 Ga0501083_0034037 3300049744 Bacteria 3485
268 Ga0501044_0016738 3300049823 Bacteria 7870
269 Ga0501045_0064791 3300049824 Bacteria 2683
270 Ga0501045_0172701 3300049824 Bacteria 1610
271 Ga0501045_0172720 3300049824 Bacteria 1610
272 nmdc:mga03n38_112828_c1 3300050490 Bacteria 1326
273 nmdc:mga03n38_1558_c1 3300050490 Bacteria 6651
274 nmdc:mga03n38_5027_c1 3300050490 Bacteria 4457
275 nmdc:mga03n38_83197_c1 3300050490 Bacteria 1508
276 nmdc:mga03n38_93618_c1 3300050490 Bacteria 1436
277 nmdc:mga00v17_12017_c1 3300050491 Bacteria 4765
278 nmdc:mga00v17_154472_c1 3300050491 Bacteria 1475
279 nmdc:mga00v17_48619_c1 3300050491 Bacteria 2571
280 nmdc:mga0yw44_233895_c1 3300050492 Bacteria 1220
281 nmdc:mga0yw44_290081_c1 3300050492 Bacteria 1095
282 nmdc:mga0yw44_50918_c1 3300050492 Bacteria 2506
283 nmdc:mga0yw44_58696_c1 3300050492 Bacteria 2351
284 nmdc:mga06z11_106640_c1 3300050494 Bacteria 1545
285 nmdc:mga06z11_8009_c1 3300050494 Bacteria 4381
286 nmdc:mga06z11_91967_c1 3300050494 Bacteria 1649
287 nmdc:mga06z11_98626_c1 3300050494 Bacteria 1599
288 nmdc:mga04h51_21070_c1 3300050495 Bacteria 1956
289 nmdc:mga07m45_13867_c1 3300050496 Bacteria 4283
290 nmdc:mga07m45_45762_c1 3300050496 Bacteria 2457
291 nmdc:mga08y16_17027_c1 3300050511 Bacteria 7653
292 Ga0495601_0266184 3300053077 Bacteria 1118
293 Ga0495595_0033752 3300053084 Bacteria 2311
294 Ga0495619_0074838 3300053085 Bacteria 2272
295 Ga0500644_0000192 3300053088 Bacteria 37965
296 Ga0500650_0020988 3300053098 Bacteria 2872
297 Ga0500556_0002815 3300053104 Bacteria 5325
298 Ga0500559_0005441 3300053136 Bacteria 5855
299 Ga0500559_0023006 3300053136 Bacteria 2645
300 Ga0500559_0034012 3300053136 Bacteria 2197
301 Ga0500573_0001644 3300053140 Bacteria 10820
302 Ga0500573_0036841 3300053140 Bacteria 2825
303 Ga0500573_0046181 3300053140 Bacteria 2510
304 Ga0500573_0057631 3300053140 Bacteria 2228
305 Ga0500573_0183800 3300053140 Bacteria 1122
306 Ga0500577_0006399 3300053142 Bacteria 3247
307 Ga0501084_0160700 3300054114 Bacteria 1895
308 Ga0501082_0002800 3300060353 Bacteria 15221
309 Ga0466962_0010076 3300061719 Bacteria 4535
310 2643824786 2643221561 Bacteria 4984412
311 2643892745 2643221576 Bacteria 5214352
312 2643962194 2643221590 Bacteria 5214697
313 2644032149 2643221604 Bacteria 5014917
314 2644093209 2643221615 Bacteria 5487866
315 2644100058 2643221617 Bacteria 5139111
316 2644117664 2643221620 Bacteria 5134593
317 2644229584 2643221641 Bacteria 4490190
318 2644322820 2643221657 Bacteria 5490246
319 2644536037 2643221696 Bacteria 5431823
320 2738871088 2738541305 Bacteria 4910150
321 2740168386 2739367898 Bacteria 4367674
322 2774395746 2773857762 Bacteria 5971770
323 2809199066 2808606439 Bacteria 5952208
324 2812334954 2811994874 Bacteria 5367947
325 2812348146 2811994878 Bacteria 5992952
326 2855388029 2855386786 Bacteria 4752232
327 2857484696 2857481737 Bacteria 4761446
328 2870624044 2870622029 Bacteria 3643329
329 2891968485 2891968417 Bacteria 5821697
330 2939658521 2939657138 Bacteria 3740283
331 2984578867 2984576629 Bacteria 4248407
332 2990257881 2990256926 Bacteria 4252839
333 8054614219 8054609563 Bacteria 5170090
334 Ga0501069_0009163
335 Ga0070658_10028273
336 Ga0070683_100036425
337 Ga0070683_100068509
338 Ga0070682_100013581
339 Ga0070682_100269717
340 Ga0068868_100056788
341 Ga0070660_100005216
342 Ga0070660_100059099
343 Ga0070692_10001975
344 Ga0070668_100369155
345 Ga0070659_100001658
346 Ga0070667_100079580
347 Ga0070701_10005749
348 Ga0070700_100010578
349 Ga0070708_100143518
350 Ga0070663_100049734
351 Ga0070681_10078249
352 Ga0068867_100005118
353 Ga0070685_10115520
354 Ga0070707_100361419
355 Ga0070698_100001937
356 Ga0070684_100030708
357 Ga0068853_100045287
358 Ga0070672_100016887
359 Ga0070665_100001178
360 Ga0070664_100012467
361 Ga0068854_100103331
362 Ga0068856_100064860
363 Ga0070702_100006030
364 Ga0070702_100029041
365 Ga0068852_100053664
366 Ga0068852_100143537
367 Ga0068861_100143814
368 Ga0068870_10012498
369 Ga0068860_100000578
370 Ga0075365_10021368
371 Ga0075365_10024168
372 Ga0075365_10140459
373 Ga0075365_10145119
374 Ga0075365_10182504
375 Ga0075368_10003832
376 Ga0075368_10022623
377 Ga0075368_10029248
378 Ga0075363_100003098
379 Ga0075363_100005391
380 Ga0075364_10014817
381 Ga0075364_10074544
382 Ga0075364_10112639
383 Ga0075364_10142974
384 Ga0075367_10024675
385 Ga0075367_10060780
386 Ga0075370_10006523
387 Ga0075370_10056107
388 Ga0075370_10185211
389 Ga0068865_100013250
390 Ga0068865_100018053
391 Ga0105243_10043231
392 Ga0105243_10117846
393 Ga0105243_10253647
394 Ga0105242_10047666
395 Ga0105242_10429745
396 Ga0105237_10083073
397 Ga0105237_10250585
398 Ga0105249_10158248
399 Ga0105249_10334566
400 Ga0105239_10004448
401 Ga0157369_10086489
402 Ga0163162_10028384
403 Ga0157372_10146581
404 Ga0163163_10022488
405 Ga0163163_10077596
406 Ga0163163_10078038
407 Ga0163163_10415695
408 Ga0163163_10571450
409 Ga0157380_10008296
410 Ga0182008_10107865
411 Ga0157377_10067169
412 Ga0163161_10037444
413 Ga0163161_10137805
414 Ga0207688_10019901
415 Ga0207643_10016985
416 Ga0207707_10129412
417 Ga0207706_10037587
418 Ga0207669_10062090
419 Ga0207691_10004844
420 Ga0207661_10117370
421 Ga0207679_10181529
422 Ga0207658_10036626
423 Ga0207658_10041005
424 Ga0207678_10103654
425 Ga0207708_10005055
426 Ga0207648_10007851
427 Ga0207676_10098343
428 Ga0207674_10147739
429 Ga0207675_100040245
430 Ga0207428_10137555
431 Ga0268266_10003092
432 Ga0268264_10000226
433 Ga0316176_1203608
434 Ga0307408_100145686
435 Ga0307405_10013411
436 Ga0307405_10026852
437 Ga0307413_10071036
438 Ga0307410_10041922
439 Ga0307410_10060878
440 Ga0307406_10069885
441 Ga0307407_10050202
442 Ga0307407_10082602
443 Ga0307409_100038973
444 Ga0307409_100052253
445 Ga0307409_100099444
446 Ga0307416_100000602
447 Ga0307416_100024665
448 Ga0307414_10082188
449 Ga0307415_100000040
450 Ga0307415_100270970
451 Ga0395899_0172174
452 Ga0395900_0068174
453 Ga0395898_0011311
454 Ga0395901_0012833
455 Ga0395901_0044659
456 Ga0395901_0091673
457 Ga0439436_0026129
458 Ga0466969_0028389
459 Ga0466972_0012521
460 Ga0466972_0035719
461 Ga0466972_0064246
462 Ga0466965_0003959
463 Ga0466965_0020971
464 Ga0466965_0034027
465 Ga0466965_0042039
466 Ga0466965_0046130
467 Ga0466966_0007807
468 Ga0466966_0082072
469 Ga0466961_0022383
470 Ga0466961_0024837
471 Ga0466961_0123737
472 Ga0466963_0003209
473 Ga0466963_0069637
474 Ga0466963_0124973
475 Ga0466963_0195925
476 Ga0466970_0012646
477 Ga0466970_0020648
478 Ga0466970_0037497
479 Ga0466970_0055620
480 Ga0466970_0110596
481 Ga0466957_0003079
482 Ga0466957_0016653
483 Ga0466957_0031111
484 Ga0466957_0079743
485 Ga0466957_0219750
486 Ga0466960_0004153
487 Ga0466960_0006246
488 Ga0466960_0012609
489 Ga0466960_0029424
490 Ga0466960_0113092
491 Ga0466960_0176120
492 Ga0466959_0016597
493 Ga0466958_0034880
494 Ga0466958_0038399
495 Ga0466967_0004576
496 Ga0466967_0055908
497 Ga0466967_0073408
498 Ga0466967_0074537
499 Ga0466967_0119175
500 Ga0466967_0146544
501 Ga0466967_0233773
502 Ga0466967_0303343
503 Ga0495653_0247639
504 Ga0495664_0048152
505 Ga0496100_0065372
506 Ga0496100_0160462
507 Ga0496102_0074939
508 Ga0496102_0242260
509 Ga0496102_0300683
510 Ga0496104_0002997
511 Ga0496105_0005659
512 Ga0496106_0207891
513 Ga0496107_0021132
514 Ga0496108_0113946
515 Ga0496109_0030512
516 Ga0496109_0066302
517 Ga0496109_0108913
518 Ga0496109_0123986
519 Ga0496110_0014390
520 Ga0496110_0148114
521 Ga0496110_0182964
522 Ga0496110_0216930
523 Ga0496112_0132038
524 Ga0496114_0006395
525 Ga0496114_0018634
526 Ga0496114_0125303
527 Ga0496114_0252274
528 Ga0496115_0002856
529 Ga0501031_0004866
530 Ga0501031_0016187
531 Ga0501031_0106091
532 Ga0501032_0018077
533 Ga0501032_0125836
534 Ga0501033_0003293
535 Ga0501033_0231783
536 Ga0501034_0008850
537 Ga0501034_0037289
538 Ga0501034_0042339
539 Ga0501036_0005812
540 Ga0501036_0010461
541 Ga0501036_0066092
542 Ga0501036_0258482
543 Ga0501037_0004898
544 Ga0501037_0063770
545 Ga0501037_0106738
546 Ga0501038_0073733
547 Ga0501038_0077816
548 Ga0501038_0183423
549 Ga0501039_0054282
550 Ga0501039_0246443
551 Ga0501040_0209846
552 Ga0501042_0058340
553 Ga0501043_0005295
554 Ga0501043_0134277
555 Ga0501043_0302952
556 Ga0501046_0000399
557 Ga0501046_0002438
558 Ga0501047_0087571
559 Ga0501047_0287819
560 Ga0501048_0004479
561 Ga0501048_0020701
562 Ga0501048_0122764
563 Ga0501048_0212474
564 Ga0501067_0004318
565 Ga0501067_0038975
566 Ga0501067_0111222
567 Ga0501068_0022316
568 Ga0501068_0031162
569 Ga0501068_0058890
570 Ga0501069_0022141
571 Ga0501069_0063005
572 Ga0501070_0003386
573 Ga0501070_0012345
574 Ga0501070_0078063
575 Ga0501071_0017320
576 Ga0501071_0019699
577 Ga0501071_0215058
578 Ga0501071_0352825
579 Ga0501072_0018753
580 Ga0501072_0034440
581 Ga0501072_0035610
582 Ga0501072_0039197
583 Ga0501073_0004509
584 Ga0501073_0032272
585 Ga0501073_0048953
586 Ga0501074_0001368
587 Ga0501074_0009053
588 Ga0501074_0028683
589 Ga0501074_0086270
590 Ga0501076_0177895
591 Ga0501079_0010830
592 Ga0501079_0065108
593 Ga0501079_0175315
594 Ga0501080_0004256
595 Ga0501080_0016091
596 Ga0501080_0061367
597 Ga0501080_0233574
598 Ga0501080_0484530
599 Ga0501083_0005594
600 Ga0501083_0034037
601 Ga0501044_0016738
602 Ga0501045_0064791
603 Ga0501045_0172701
604 Ga0501045_0172720
605 nmdc:mga03n38_112828_c1
606 nmdc:mga03n38_1558_c1
607 nmdc:mga03n38_5027_c1
608 nmdc:mga03n38_83197_c1
609 nmdc:mga03n38_93618_c1
610 nmdc:mga00v17_12017_c1
611 nmdc:mga00v17_154472_c1
612 nmdc:mga00v17_48619_c1
613 nmdc:mga0yw44_233895_c1
614 nmdc:mga0yw44_290081_c1
615 nmdc:mga0yw44_50918_c1
616 nmdc:mga0yw44_58696_c1
617 nmdc:mga06z11_106640_c1
618 nmdc:mga06z11_8009_c1
619 nmdc:mga06z11_91967_c1
620 nmdc:mga06z11_98626_c1
621 nmdc:mga04h51_21070_c1
622 nmdc:mga07m45_13867_c1
623 nmdc:mga07m45_45762_c1
624 nmdc:mga08y16_17027_c1
625 Ga0495601_0266184
626 Ga0495595_0033752
627 Ga0495619_0074838
628 Ga0500644_0000192
629 Ga0500650_0020988
630 Ga0500556_0002815
631 Ga0500559_0005441
632 Ga0500559_0023006
633 Ga0500559_0034012
634 Ga0500573_0001644
635 Ga0500573_0036841
636 Ga0500573_0046181
637 Ga0500573_0057631
638 Ga0500573_0183800
639 Ga0500577_0006399
640 Ga0501084_0160700
641 Ga0501082_0002800
642 Ga0466962_0010076
643 2643824786
644 2643892745
645 2643962194
646 2644032149
647 2644093209
648 2644100058
649 2644117664
650 2644229584
651 2644322820
652 2644536037
653 2738871088
654 2740168386
655 2774395746
656 2809199066
657 2812334954
658 2812348146
659 2855388029
660 2857484696
661 2870624044
662 2891968485
663 2939658521
664 2984578867
665 2990257881
666 8054614219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

68

210

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.9293 3 222
6aio-assembly2.cif.gz_B crystal structure of p-nitrophenol 4-monooxygenase pnpa from pseudomonas putida dll-e4 0.9273 269 297
8bmr-assembly1.cif.gz_A cryo-em structure of the wild-type solitary ecf module in msp2n2 lipid nanodiscs in the atpase open and nucleotide-free conformation 0.9269 1 215
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9268 4 210
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9251 1 226
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9655 1 208 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.965 4 227 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9597 4 225 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9531 4 229 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9521 18 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A524B8W3-F1-model_v4 ABC transporter 0.98 3 199 GO:0005524
GO:0016887
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9721 1 189 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A2N5A791-F1-model_v4 Fe3+/spermidine/putrescine ABC transporter ATP-binding protein 0.9713 1 204 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9711 1 209 GO:0005524
GO:0016887
GO:0055052
AF-A0A357RUW9-F1-model_v4 deleted 0.9695 1 202

Map