F411492

General Info

Members Datasets Scaffolds Average Seq Length
333 198 666 113

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0016346|Ga0495606_0016346_3237_3644
Length 135
Sequence MIAVIFEVEPAPGKRQDYLDAAAALRPELEAIDGFISIERFTSLARPGKMLSLSFWRDEEAVKRWRTLPAHRAMQAAGRAGIFAGYRLRVAAVVRDYGLHERDEVPPDLVTPCGHSLISGSTSCVSSCSDSCQPR

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
29 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
80 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
81 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
82 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
83 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
158 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
195 2643221556 Massilia sp. Root1485 Isolate Unclassified
196 2643221684 Massilia sp. Root133 Isolate Unclassified
197 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
198 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 2.4
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0016346 3300046507 Bacteria 5664
2 Ga0055525_1000009 3300003759 Bacteria 596899
3 Ga0065165_1000677 3300005262 Bacteria 49085
4 Ga0070658_10195724 3300005327 Bacteria 1704
5 Ga0070658_11723822 3300005327 Bacteria 542
6 Ga0070683_100605836 3300005329 Bacteria 1048
7 Ga0070689_100090938 3300005340 Bacteria 2406
8 Ga0070661_101055111 3300005344 Bacteria 676
9 Ga0070659_100008329 3300005366 Bacteria 7569
10 Ga0070710_10155360 3300005437 Bacteria 1414
11 Ga0070711_101459386 3300005439 Bacteria 596
12 Ga0070705_100469059 3300005440 Bacteria 949
13 Ga0070662_101075172 3300005457 Bacteria 690
14 Ga0070679_101969511 3300005530 Bacteria 533
15 Ga0070684_100936961 3300005535 Bacteria 812
16 Ga0070693_101237243 3300005547 Unclassified 575
17 Ga0070704_100008112 3300005549 Bacteria 6278
18 Ga0068855_100551598 3300005563 Bacteria 1247
19 Ga0068852_100130208 3300005616 Bacteria 2316
20 Ga0070716_100158192 3300006173 Bacteria 1465
21 Ga0075428_100107628 3300006844 Bacteria 3038
22 Ga0075431_100056346 3300006847 Bacteria 4054
23 Ga0075429_100309855 3300006880 Bacteria 1382
24 Ga0068865_100017988 3300006881 Bacteria 4554
25 Ga0099795_10288089 3300007788 Bacteria 719
26 Ga0105245_11044241 3300009098 Bacteria 862
27 Ga0105245_11244701 3300009098 Bacteria 792
28 Ga0114129_10171114 3300009147 Bacteria 2961
29 Ga0105241_11289231 3300009174 Bacteria 695
30 Ga0105033_127836 3300009986 Bacteria 520
31 Ga0099796_10300930 3300010159 Bacteria 680
32 Ga0157373_10222270 3300013100 Bacteria 1332
33 Ga0157373_10907790 3300013100 Bacteria 654
34 Ga0157370_11467207 3300013104 Bacteria 613
35 Ga0157369_10710327 3300013105 Bacteria 1035
36 Ga0157372_10380459 3300013307 Bacteria 1645
37 Ga0157372_10712299 3300013307 Bacteria 1168
38 Ga0163163_12379138 3300014325 Bacteria 588
39 Ga0209563_100015 3300025230 Bacteria 879901
40 Ga0209677_102627 3300025253 Bacteria 6528
41 Ga0209130_1000126 3300025284 Bacteria 123694
42 Ga0207426_1000046 3300025302 Bacteria 422271
43 Ga0207680_10931502 3300025903 Bacteria 623
44 Ga0207705_10185547 3300025909 Bacteria 1571
45 Ga0207707_10017261 3300025912 Bacteria 6290
46 Ga0207660_10506061 3300025917 Bacteria 980
47 Ga0207657_10002915 3300025919 Bacteria 18364
48 Ga0207649_11132240 3300025920 Bacteria 618
49 Ga0207652_10432678 3300025921 Bacteria 1186
50 Ga0207687_10618807 3300025927 Bacteria 914
51 Ga0207690_10070333 3300025932 Bacteria 2410
52 Ga0207706_10948855 3300025933 Bacteria 725
53 Ga0207670_10056059 3300025936 Bacteria 2666
54 Ga0207704_10001023 3300025938 Bacteria 12414
55 Ga0207689_10105611 3300025942 Bacteria 2314
56 Ga0207667_10292958 3300025949 Bacteria 1663
57 Ga0207651_10090917 3300025960 Bacteria 2233
58 Ga0207641_10824321 3300026088 Bacteria 919
59 Ga0207648_11916032 3300026089 Bacteria 554
60 Ga0207676_10496117 3300026095 Bacteria 1159
61 Ga0207683_10417004 3300026121 Bacteria 1236
62 Ga0207698_10027748 3300026142 Bacteria 4025
63 Ga0207698_12135938 3300026142 Bacteria 573
64 Ga0209969_1011867 3300027360 Bacteria 1253
65 Ga0209981_1005749 3300027378 Bacteria 1652
66 Ga0210000_1003356 3300027462 Bacteria 2309
67 Ga0209968_1062463 3300027526 Bacteria 657
68 Ga0209588_1077052 3300027671 Bacteria 1078
69 Ga0307408_100616373 3300031548 Bacteria 966
70 Ga0307408_101617600 3300031548 Bacteria 615
71 Ga0307405_11058573 3300031731 Bacteria 695
72 Ga0307412_10197382 3300031911 Bacteria 1526
73 Ga0307409_102196424 3300031995 Bacteria 581
74 Ga0307415_100904115 3300032126 Bacteria 814
75 Ga0307415_101905483 3300032126 Bacteria 577
76 Ga0373955_0602463 3300035172 Unclassified 673
77 Ga0373931_1172248 3300035691 Bacteria 525
78 Ga0373937_0046232 3300036401 Unclassified 3980
79 Ga0373937_0536035 3300036401 Bacteria 1112
80 Ga0373937_1323700 3300036401 Bacteria 668
81 Ga0395899_0014025 3300037312 Bacteria 6118
82 Ga0395899_0017644 3300037312 Bacteria 5435
83 Ga0395899_0416839 3300037312 Bacteria 885
84 Ga0395900_0000615 3300037418 Bacteria 48234
85 Ga0395900_0001536 3300037418 Bacteria 27436
86 Ga0395900_0054062 3300037418 Bacteria 4133
87 Ga0395900_0101123 3300037418 Bacteria 2960
88 Ga0395900_0111237 3300037418 Bacteria 2813
89 Ga0395900_0363870 3300037418 Bacteria 1417
90 Ga0395900_0653860 3300037418 Bacteria 987
91 Ga0395900_0735881 3300037418 Bacteria 917
92 Ga0395900_1381337 3300037418 Bacteria 617
93 Ga0395898_0310355 3300037466 Bacteria 1504
94 Ga0395898_0410758 3300037466 Bacteria 1290
95 Ga0395898_1559142 3300037466 Bacteria 585
96 Ga0395905_0827674 3300037471 Bacteria 828
97 Ga0395905_1268182 3300037471 Bacteria 641
98 Ga0395901_0000084 3300038443 Bacteria 127737
99 Ga0395901_0129900 3300038443 Bacteria 2647
100 Ga0395901_0297485 3300038443 Bacteria 1673
101 Ga0395901_0698609 3300038443 Bacteria 1012
102 Ga0439448_0033500 3300042005 Bacteria 1639
103 Ga0439448_0159273 3300042005 Bacteria 785
104 Ga0439449_0389170 3300042007 Bacteria 529
105 Ga0439450_074011 3300042008 Bacteria 839
106 Ga0439455_0048295 3300042012 Bacteria 1107
107 Ga0450911_011756 3300042115 Bacteria 1192
108 Ga0450894_036044 3300042131 Bacteria 701
109 Ga0450907_063461 3300042146 Bacteria 638
110 Ga0439446_0057892 3300042156 Bacteria 1167
111 Ga0439434_0000954 3300042435 Bacteria 8337
112 Ga0439435_0002272 3300042436 Bacteria 3777
113 Ga0466969_0014035 3300044656 Bacteria 4215
114 Ga0466969_0120988 3300044656 Bacteria 1219
115 Ga0466972_0018823 3300044658 Bacteria 3451
116 Ga0466972_0237912 3300044658 Bacteria 852
117 Ga0466972_0305673 3300044658 Bacteria 743
118 Ga0466965_0077853 3300044683 Bacteria 1674
119 Ga0466965_0185203 3300044683 Bacteria 1099
120 Ga0466965_0476777 3300044683 Bacteria 697
121 Ga0466966_0008254 3300044684 Bacteria 6907
122 Ga0466966_0016238 3300044684 Bacteria 4922
123 Ga0466966_0030270 3300044684 Bacteria 3514
124 Ga0466966_0052728 3300044684 Bacteria 2582
125 Ga0466966_0277658 3300044684 Bacteria 1008
126 Ga0466966_0443176 3300044684 Bacteria 780
127 Ga0466961_0140615 3300044693 Bacteria 1511
128 Ga0466964_0002478 3300044706 Bacteria 6561
129 Ga0466971_0088368 3300044719 Bacteria 1417
130 Ga0466971_0262221 3300044719 Bacteria 825
131 Ga0466968_0003311 3300044735 Bacteria 5942
132 Ga0466970_0037518 3300044765 Bacteria 2569
133 Ga0466970_0124801 3300044765 Bacteria 1411
134 Ga0466957_0479344 3300044842 Bacteria 860
135 Ga0466960_0029263 3300044901 Bacteria 2527
136 Ga0466960_0294938 3300044901 Bacteria 912
137 Ga0466959_0088292 3300045049 Bacteria 2229
138 Ga0466959_0106036 3300045049 Bacteria 2009
139 Ga0466959_0472112 3300045049 Bacteria 849
140 Ga0466959_0519075 3300045049 Bacteria 804
141 Ga0466958_0109677 3300045836 Bacteria 1722
142 Ga0466958_0124692 3300045836 Bacteria 1614
143 Ga0466958_0206467 3300045836 Bacteria 1251
144 Ga0466967_0354133 3300045976 Bacteria 1421
145 Ga0495617_001687 3300046452 Bacteria 9492
146 Ga0495590_0000044 3300046457 Bacteria 119833
147 Ga0495590_0006826 3300046457 Bacteria 4436
148 Ga0495590_0277933 3300046457 Bacteria 627
149 Ga0495591_000052 3300046458 Bacteria 136101
150 Ga0495638_0073821 3300046460 Bacteria 2081
151 Ga0495651_0533980 3300046462 Bacteria 747
152 Ga0495580_0193639 3300046472 Bacteria 1402
153 Ga0495605_0000087 3300046474 Bacteria 120256
154 Ga0495605_0001548 3300046474 Bacteria 14939
155 Ga0495584_0000460 3300046491 Bacteria 28068
156 Ga0495584_0005971 3300046491 Bacteria 6414
157 Ga0495584_0361253 3300046491 Bacteria 737
158 Ga0495585_0012879 3300046492 Bacteria 4915
159 Ga0495585_0173016 3300046492 Bacteria 1114
160 Ga0495585_0188180 3300046492 Bacteria 1057
161 Ga0495596_0012153 3300046500 Bacteria 3691
162 Ga0495607_0002567 3300046501 Bacteria 14672
163 Ga0495607_0002657 3300046501 Bacteria 14336
164 Ga0495607_0006163 3300046501 Bacteria 8478
165 Ga0495607_0146225 3300046501 Bacteria 1214
166 Ga0495583_0001408 3300046506 Bacteria 24506
167 Ga0495583_0010073 3300046506 Bacteria 5562
168 Ga0495583_0083922 3300046506 Bacteria 1381
169 Ga0495606_0027922 3300046507 Bacteria 3990
170 Ga0495606_0461615 3300046507 Bacteria 648
171 Ga0495610_0000506 3300046512 Bacteria 39776
172 Ga0495610_0051355 3300046512 Bacteria 2007
173 Ga0495610_0097295 3300046512 Bacteria 1324
174 Ga0495616_0055064 3300046513 Bacteria 1971
175 Ga0495616_0057921 3300046513 Bacteria 1909
176 Ga0495616_0098430 3300046513 Bacteria 1374
177 Ga0495631_0013645 3300046518 Bacteria 3938
178 Ga0495631_0041410 3300046518 Bacteria 2038
179 Ga0495631_0233813 3300046518 Bacteria 784
180 Ga0495632_0003421 3300046519 Bacteria 11277
181 Ga0495632_0112212 3300046519 Bacteria 1279
182 Ga0495637_0000006 3300046520 Bacteria 435763
183 Ga0495637_0110583 3300046520 Bacteria 1065
184 Ga0495643_0009197 3300046522 Bacteria 6165
185 Ga0495643_0061392 3300046522 Bacteria 1993
186 Ga0495643_0141075 3300046522 Bacteria 1201
187 Ga0495644_0005459 3300046523 Bacteria 4967
188 Ga0495644_0007508 3300046523 Bacteria 4202
189 Ga0495648_0007560 3300046524 Bacteria 8685
190 Ga0495648_0014398 3300046524 Bacteria 5792
191 Ga0495642_0002336 3300046528 Bacteria 7736
192 Ga0495642_0062429 3300046528 Bacteria 1547
193 Ga0495642_0131693 3300046528 Bacteria 1076
194 Ga0495654_0097881 3300046530 Bacteria 1354
195 Ga0495665_0030454 3300046531 Plasmid 2888
196 Ga0495640_0226416 3300046533 Bacteria 1177
197 Ga0495609_0012026 3300046538 Bacteria 4108
198 Ga0495609_0081980 3300046538 Bacteria 1409
199 Ga0495597_0059615 3300046542 Bacteria 1666
200 Ga0495633_0001152 3300046558 Bacteria 21220
201 Ga0495633_0208230 3300046558 Bacteria 897
202 Ga0495611_0000476 3300046648 Bacteria 23975
203 Ga0495611_0010580 3300046648 Bacteria 3902
204 Ga0495611_0231542 3300046648 Bacteria 858
205 Ga0495661_0011411 3300046665 Bacteria 6031
206 Ga0495661_0024341 3300046665 Bacteria 3920
207 Ga0495661_0041408 3300046665 Bacteria 2850
208 Ga0495661_0154933 3300046665 Bacteria 1234
209 Ga0495588_0000070 3300046674 Bacteria 227611
210 Ga0495588_0302508 3300046674 Bacteria 842
211 Ga0495669_0049578 3300046684 Bacteria 1880
212 Ga0495669_0132285 3300046684 Bacteria 1174
213 Ga0495669_0139675 3300046684 Bacteria 1143
214 Ga0495670_0008059 3300046691 Bacteria 5178
215 Ga0495670_0009775 3300046691 Bacteria 4715
216 Ga0495649_0112749 3300046694 Bacteria 1441
217 Ga0495649_0513506 3300046694 Bacteria 595
218 Ga0495589_0000092 3300046794 Bacteria 85372
219 Ga0495589_0002703 3300046794 Bacteria 9802
220 Ga0495589_0128145 3300046794 Bacteria 1219
221 Ga0495660_0000117 3300046810 Bacteria 85237
222 Ga0495660_0007330 3300046810 Bacteria 6482
223 Ga0495660_0065939 3300046810 Bacteria 1931
224 Ga0495672_0000086 3300047320 Bacteria 155010
225 Ga0495672_0002183 3300047320 Bacteria 18230
226 Ga0495672_0026319 3300047320 Bacteria 3713
227 Ga0495683_0000080 3300047323 Bacteria 95388
228 Ga0495683_0189696 3300047323 Bacteria 933
229 Ga0495687_000403 3300047443 Bacteria 53439
230 Ga0495687_002852 3300047443 Bacteria 13266
231 Ga0495687_050799 3300047443 Bacteria 1764
232 Ga0495677_0001397 3300047445 Bacteria 9674
233 Ga0495677_0001432 3300047445 Bacteria 9568
234 Ga0495677_0012349 3300047445 Bacteria 3115
235 Ga0495677_0094181 3300047445 Bacteria 1130
236 Ga0495677_0127912 3300047445 Bacteria 971
237 Ga0495679_009746 3300047446 Bacteria 3819
238 Ga0495679_027132 3300047446 Bacteria 1894
239 Ga0495685_001153 3300047447 Bacteria 8068
240 Ga0495681_0006591 3300047470 Bacteria 7603
241 Ga0495686_0011588 3300047472 Bacteria 6207
242 Ga0495626_0000006 3300048091 Bacteria 284977
243 Ga0495626_0061669 3300048091 Bacteria 1704
244 Ga0496102_0085972 3300048905 Bacteria 2904
245 Ga0496102_1419570 3300048905 Bacteria 613
246 Ga0496104_0229213 3300048907 Bacteria 1770
247 Ga0496105_0502242 3300048908 Bacteria 952
248 Ga0496107_0151025 3300048910 Bacteria 1718
249 Ga0496108_0548743 3300048911 Bacteria 1008
250 Ga0496110_0308785 3300048913 Bacteria 1441
251 Ga0496113_0053763 3300048916 Bacteria 3011
252 Ga0496121_0140219 3300048924 Bacteria 1795
253 Ga0496122_0024476 3300048925 Bacteria 5282
254 Ga0496122_0453319 3300048925 Bacteria 636
255 Ga0496123_0229106 3300048926 Bacteria 931
256 Ga0496124_0081928 3300048927 Bacteria 2650
257 Ga0496124_0112065 3300048927 Bacteria 2194
258 Ga0496124_0424418 3300048927 Bacteria 915
259 Ga0496125_0119691 3300048928 Bacteria 1882
260 Ga0496125_0261207 3300048928 Bacteria 1085
261 Ga0495682_0014011 3300049460 Bacteria 3044
262 Ga0495682_0145407 3300049460 Bacteria 846
263 Ga0501290_045907 3300049513 Bacteria 668
264 Ga0501031_0018585 3300049568 Bacteria 4527
265 Ga0501031_0911047 3300049568 Bacteria 563
266 Ga0501032_0106189 3300049569 Bacteria 1860
267 Ga0501033_0013137 3300049570 Bacteria 6308
268 Ga0501034_0192865 3300049571 Bacteria 1999
269 Ga0501036_0353254 3300049572 Bacteria 1227
270 Ga0501038_0006366 3300049574 Bacteria 10928
271 Ga0501038_0169730 3300049574 Bacteria 1767
272 Ga0501038_0444506 3300049574 Bacteria 998
273 Ga0501039_0037714 3300049575 Bacteria 3731
274 Ga0501039_0224584 3300049575 Bacteria 1476
275 Ga0501039_0450051 3300049575 Bacteria 1011
276 Ga0501040_0000589 3300049576 Bacteria 22156
277 Ga0501040_0237459 3300049576 Bacteria 1299
278 Ga0501041_0000542 3300049577 Bacteria 19525
279 Ga0501041_0127402 3300049577 Bacteria 1585
280 Ga0501041_0939378 3300049577 Bacteria 556
281 Ga0501042_0003164 3300049578 Bacteria 10264
282 Ga0501042_0564138 3300049578 Bacteria 827
283 Ga0501042_0872934 3300049578 Bacteria 655
284 Ga0501043_0014262 3300049579 Bacteria 6219
285 Ga0501046_0004322 3300049580 Bacteria 12931
286 Ga0501048_0003209 3300049582 Bacteria 12458
287 Ga0501068_0192961 3300049584 Bacteria 1290
288 Ga0501070_0029866 3300049586 Bacteria 4567
289 Ga0501071_0003745 3300049587 Bacteria 9549
290 Ga0501071_0070182 3300049587 Bacteria 2552
291 Ga0501071_0166883 3300049587 Bacteria 1647
292 Ga0501071_0512154 3300049587 Bacteria 920
293 Ga0501072_0036692 3300049588 Bacteria 3843
294 Ga0501072_0046298 3300049588 Bacteria 3423
295 Ga0501072_0236077 3300049588 Bacteria 1456
296 Ga0501074_0044702 3300049590 Bacteria 3205
297 Ga0501075_0003047 3300049591 Bacteria 11195
298 Ga0501075_0129698 3300049591 Bacteria 1921
299 Ga0501075_0340853 3300049591 Bacteria 1142
300 Ga0501076_0004688 3300049592 Bacteria 9746
301 Ga0501076_0069671 3300049592 Bacteria 2811
302 Ga0501076_0252076 3300049592 Bacteria 1444
303 Ga0501077_0001702 3300049593 Bacteria 13261
304 Ga0501079_0010650 3300049741 Bacteria 7000
305 Ga0501079_0041686 3300049741 Bacteria 3545
306 Ga0501079_0061849 3300049741 Bacteria 2888
307 Ga0501080_0012088 3300049742 Bacteria 7908
308 Ga0501080_0032088 3300049742 Bacteria 4897
309 Ga0501080_0271263 3300049742 Bacteria 1544
310 Ga0501081_0000846 3300049743 Bacteria 18080
311 Ga0501081_0080598 3300049743 Bacteria 2278
312 Ga0501283_017203 3300049779 Bacteria 1129
313 Ga0501035_0039543 3300049822 Bacteria 4268
314 Ga0501035_0774712 3300049822 Bacteria 768
315 Ga0501044_0115116 3300049823 Bacteria 2694
316 Ga0501044_0229389 3300049823 Bacteria 1805
317 Ga0501045_0001470 3300049824 Bacteria 15660
318 Ga0501045_0102661 3300049824 Bacteria 2117
319 nmdc:mga09592_155968_c1 3300050508 Bacteria 1971
320 nmdc:mga0n895_1032354_c1 3300050512 Bacteria 802
321 nmdc:mga08x19_824025_c1 3300050514 Bacteria 659
322 Ga0501084_0019692 3300054114 Bacteria 5622
323 Ga0501084_0251786 3300054114 Bacteria 1491
324 Ga0501084_0622672 3300054114 Bacteria 911
325 Ga0501082_0047763 3300060353 Bacteria 3688
326 Ga0466962_0036273 3300061719 Bacteria 2359
327 Ga0466962_0191322 3300061719 Bacteria 998
328 Ga0530510_0001647 3300061734 Bacteria 15107
329 2585256942 2582581304 Bacteria 5831370
330 2643797729 2643221556 Bacteria 7251154
331 2644470489 2643221684 Bacteria 7145183
332 8005247033 8005246636 Bacteria 4933972
333 8047679035 8047673197 Bacteria 7395230
334 Ga0495606_0016346
335 Ga0055525_1000009
336 Ga0065165_1000677
337 Ga0070658_10195724
338 Ga0070658_11723822
339 Ga0070683_100605836
340 Ga0070689_100090938
341 Ga0070661_101055111
342 Ga0070659_100008329
343 Ga0070710_10155360
344 Ga0070711_101459386
345 Ga0070705_100469059
346 Ga0070662_101075172
347 Ga0070679_101969511
348 Ga0070684_100936961
349 Ga0070693_101237243
350 Ga0070704_100008112
351 Ga0068855_100551598
352 Ga0068852_100130208
353 Ga0070716_100158192
354 Ga0075428_100107628
355 Ga0075431_100056346
356 Ga0075429_100309855
357 Ga0068865_100017988
358 Ga0099795_10288089
359 Ga0105245_11044241
360 Ga0105245_11244701
361 Ga0114129_10171114
362 Ga0105241_11289231
363 Ga0105033_127836
364 Ga0099796_10300930
365 Ga0157373_10222270
366 Ga0157373_10907790
367 Ga0157370_11467207
368 Ga0157369_10710327
369 Ga0157372_10380459
370 Ga0157372_10712299
371 Ga0163163_12379138
372 Ga0209563_100015
373 Ga0209677_102627
374 Ga0209130_1000126
375 Ga0207426_1000046
376 Ga0207680_10931502
377 Ga0207705_10185547
378 Ga0207707_10017261
379 Ga0207660_10506061
380 Ga0207657_10002915
381 Ga0207649_11132240
382 Ga0207652_10432678
383 Ga0207687_10618807
384 Ga0207690_10070333
385 Ga0207706_10948855
386 Ga0207670_10056059
387 Ga0207704_10001023
388 Ga0207689_10105611
389 Ga0207667_10292958
390 Ga0207651_10090917
391 Ga0207641_10824321
392 Ga0207648_11916032
393 Ga0207676_10496117
394 Ga0207683_10417004
395 Ga0207698_10027748
396 Ga0207698_12135938
397 Ga0209969_1011867
398 Ga0209981_1005749
399 Ga0210000_1003356
400 Ga0209968_1062463
401 Ga0209588_1077052
402 Ga0307408_100616373
403 Ga0307408_101617600
404 Ga0307405_11058573
405 Ga0307412_10197382
406 Ga0307409_102196424
407 Ga0307415_100904115
408 Ga0307415_101905483
409 Ga0373955_0602463
410 Ga0373931_1172248
411 Ga0373937_0046232
412 Ga0373937_0536035
413 Ga0373937_1323700
414 Ga0395899_0014025
415 Ga0395899_0017644
416 Ga0395899_0416839
417 Ga0395900_0000615
418 Ga0395900_0001536
419 Ga0395900_0054062
420 Ga0395900_0101123
421 Ga0395900_0111237
422 Ga0395900_0363870
423 Ga0395900_0653860
424 Ga0395900_0735881
425 Ga0395900_1381337
426 Ga0395898_0310355
427 Ga0395898_0410758
428 Ga0395898_1559142
429 Ga0395905_0827674
430 Ga0395905_1268182
431 Ga0395901_0000084
432 Ga0395901_0129900
433 Ga0395901_0297485
434 Ga0395901_0698609
435 Ga0439448_0033500
436 Ga0439448_0159273
437 Ga0439449_0389170
438 Ga0439450_074011
439 Ga0439455_0048295
440 Ga0450911_011756
441 Ga0450894_036044
442 Ga0450907_063461
443 Ga0439446_0057892
444 Ga0439434_0000954
445 Ga0439435_0002272
446 Ga0466969_0014035
447 Ga0466969_0120988
448 Ga0466972_0018823
449 Ga0466972_0237912
450 Ga0466972_0305673
451 Ga0466965_0077853
452 Ga0466965_0185203
453 Ga0466965_0476777
454 Ga0466966_0008254
455 Ga0466966_0016238
456 Ga0466966_0030270
457 Ga0466966_0052728
458 Ga0466966_0277658
459 Ga0466966_0443176
460 Ga0466961_0140615
461 Ga0466964_0002478
462 Ga0466971_0088368
463 Ga0466971_0262221
464 Ga0466968_0003311
465 Ga0466970_0037518
466 Ga0466970_0124801
467 Ga0466957_0479344
468 Ga0466960_0029263
469 Ga0466960_0294938
470 Ga0466959_0088292
471 Ga0466959_0106036
472 Ga0466959_0472112
473 Ga0466959_0519075
474 Ga0466958_0109677
475 Ga0466958_0124692
476 Ga0466958_0206467
477 Ga0466967_0354133
478 Ga0495617_001687
479 Ga0495590_0000044
480 Ga0495590_0006826
481 Ga0495590_0277933
482 Ga0495591_000052
483 Ga0495638_0073821
484 Ga0495651_0533980
485 Ga0495580_0193639
486 Ga0495605_0000087
487 Ga0495605_0001548
488 Ga0495584_0000460
489 Ga0495584_0005971
490 Ga0495584_0361253
491 Ga0495585_0012879
492 Ga0495585_0173016
493 Ga0495585_0188180
494 Ga0495596_0012153
495 Ga0495607_0002567
496 Ga0495607_0002657
497 Ga0495607_0006163
498 Ga0495607_0146225
499 Ga0495583_0001408
500 Ga0495583_0010073
501 Ga0495583_0083922
502 Ga0495606_0027922
503 Ga0495606_0461615
504 Ga0495610_0000506
505 Ga0495610_0051355
506 Ga0495610_0097295
507 Ga0495616_0055064
508 Ga0495616_0057921
509 Ga0495616_0098430
510 Ga0495631_0013645
511 Ga0495631_0041410
512 Ga0495631_0233813
513 Ga0495632_0003421
514 Ga0495632_0112212
515 Ga0495637_0000006
516 Ga0495637_0110583
517 Ga0495643_0009197
518 Ga0495643_0061392
519 Ga0495643_0141075
520 Ga0495644_0005459
521 Ga0495644_0007508
522 Ga0495648_0007560
523 Ga0495648_0014398
524 Ga0495642_0002336
525 Ga0495642_0062429
526 Ga0495642_0131693
527 Ga0495654_0097881
528 Ga0495665_0030454
529 Ga0495640_0226416
530 Ga0495609_0012026
531 Ga0495609_0081980
532 Ga0495597_0059615
533 Ga0495633_0001152
534 Ga0495633_0208230
535 Ga0495611_0000476
536 Ga0495611_0010580
537 Ga0495611_0231542
538 Ga0495661_0011411
539 Ga0495661_0024341
540 Ga0495661_0041408
541 Ga0495661_0154933
542 Ga0495588_0000070
543 Ga0495588_0302508
544 Ga0495669_0049578
545 Ga0495669_0132285
546 Ga0495669_0139675
547 Ga0495670_0008059
548 Ga0495670_0009775
549 Ga0495649_0112749
550 Ga0495649_0513506
551 Ga0495589_0000092
552 Ga0495589_0002703
553 Ga0495589_0128145
554 Ga0495660_0000117
555 Ga0495660_0007330
556 Ga0495660_0065939
557 Ga0495672_0000086
558 Ga0495672_0002183
559 Ga0495672_0026319
560 Ga0495683_0000080
561 Ga0495683_0189696
562 Ga0495687_000403
563 Ga0495687_002852
564 Ga0495687_050799
565 Ga0495677_0001397
566 Ga0495677_0001432
567 Ga0495677_0012349
568 Ga0495677_0094181
569 Ga0495677_0127912
570 Ga0495679_009746
571 Ga0495679_027132
572 Ga0495685_001153
573 Ga0495681_0006591
574 Ga0495686_0011588
575 Ga0495626_0000006
576 Ga0495626_0061669
577 Ga0496102_0085972
578 Ga0496102_1419570
579 Ga0496104_0229213
580 Ga0496105_0502242
581 Ga0496107_0151025
582 Ga0496108_0548743
583 Ga0496110_0308785
584 Ga0496113_0053763
585 Ga0496121_0140219
586 Ga0496122_0024476
587 Ga0496122_0453319
588 Ga0496123_0229106
589 Ga0496124_0081928
590 Ga0496124_0112065
591 Ga0496124_0424418
592 Ga0496125_0119691
593 Ga0496125_0261207
594 Ga0495682_0014011
595 Ga0495682_0145407
596 Ga0501290_045907
597 Ga0501031_0018585
598 Ga0501031_0911047
599 Ga0501032_0106189
600 Ga0501033_0013137
601 Ga0501034_0192865
602 Ga0501036_0353254
603 Ga0501038_0006366
604 Ga0501038_0169730
605 Ga0501038_0444506
606 Ga0501039_0037714
607 Ga0501039_0224584
608 Ga0501039_0450051
609 Ga0501040_0000589
610 Ga0501040_0237459
611 Ga0501041_0000542
612 Ga0501041_0127402
613 Ga0501041_0939378
614 Ga0501042_0003164
615 Ga0501042_0564138
616 Ga0501042_0872934
617 Ga0501043_0014262
618 Ga0501046_0004322
619 Ga0501048_0003209
620 Ga0501068_0192961
621 Ga0501070_0029866
622 Ga0501071_0003745
623 Ga0501071_0070182
624 Ga0501071_0166883
625 Ga0501071_0512154
626 Ga0501072_0036692
627 Ga0501072_0046298
628 Ga0501072_0236077
629 Ga0501074_0044702
630 Ga0501075_0003047
631 Ga0501075_0129698
632 Ga0501075_0340853
633 Ga0501076_0004688
634 Ga0501076_0069671
635 Ga0501076_0252076
636 Ga0501077_0001702
637 Ga0501079_0010650
638 Ga0501079_0041686
639 Ga0501079_0061849
640 Ga0501080_0012088
641 Ga0501080_0032088
642 Ga0501080_0271263
643 Ga0501081_0000846
644 Ga0501081_0080598
645 Ga0501283_017203
646 Ga0501035_0039543
647 Ga0501035_0774712
648 Ga0501044_0115116
649 Ga0501044_0229389
650 Ga0501045_0001470
651 Ga0501045_0102661
652 nmdc:mga09592_155968_c1
653 nmdc:mga0n895_1032354_c1
654 nmdc:mga08x19_824025_c1
655 Ga0501084_0019692
656 Ga0501084_0251786
657 Ga0501084_0622672
658 Ga0501082_0047763
659 Ga0466962_0036273
660 Ga0466962_0191322
661 Ga0530510_0001647
662 2585256942
663 2643797729
664 2644470489
665 8005247033
666 8047679035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

1

77

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.9098 2 96
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.9083 2 95
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.9076 2 91
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9012 2 91
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.8988 1 94
ID Description Score Start End Superfamily
af_Q54J03_9_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9197 2 93 3.30.70.100
af_A0A1D8PRM8_52_147_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9128 2 93 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9114 2 93 3.30.70.100
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9098 2 96 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9076 2 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A8FSU1-F1-model_v4 ABM domain-containing protein 0.9897 1 98
AF-D4GME8-F1-model_v4 ABM domain-containing protein 0.9865 2 98
AF-A0A4U5JQA9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9831 1 98 GO:0004497
AF-A0A5C1BWG8-F1-model_v4 deleted 0.9822 1 98
AF-A0A0F6U0D8-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9803 1 98 GO:0004497

Map