F411460
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 159 | 320 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300042012|Ga0439455_0014051|Ga0439455_0014051_168_1172 |
| Length | 334 |
| Sequence | MTRALSQSDRIGLAIRSAPAPHRSTIMRTDLDHLPAAKQRDLERVVQIIFEEFEDALSLATQGWKKRGRIEKIILYGSYARGNWVDEPHTAKGYRSDFDLLIIVNDKRLTDRAAYWSKLDERLIRELTITKTIHAPVNFILHTLQEVNDGLAHGRYFFMDIKRDGIAVYQADDNELHEPKPKTPQQALAMAKGYFQEWFPAAGGREKLAKYAVQEGLLKHAAFEYHQTAETLYHCVLLVCTFYTPHVHNLAFLRSQAELIDRRLTHVWPWGSRRERAMFEKLKEAYVKARYSSRYQISSEELAWLGERVEELGRVVLEICNERIAALEQSARAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 3 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 4 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 5 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 6 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 7 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 125 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 126 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 127 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 140 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 141 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 142 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 143 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 144 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 152 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 157 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 158 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 159 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97 |
| Metatranscriptomes | 0 |
| Isolates | 3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.32 |
| Nodule | 0 |
| Rhizoplane | 3 |
| Rhizosphere | 70.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1011284 | 3300001904 | Bacteria | 1455 |
| 2 | JGI24739J22299_10046798 | 3300001989 | Bacteria | 1415 |
| 3 | JGI24737J22298_10001550 | 3300001990 | Bacteria | 8169 |
| 4 | JGI24737J22298_10003756 | 3300001990 | Bacteria | 5344 |
| 5 | JGI24737J22298_10028866 | 3300001990 | Bacteria | 1742 |
| 6 | JGI24737J22298_10038081 | 3300001990 | Bacteria | 1481 |
| 7 | JGI24737J22298_10055694 | 3300001990 | Bacteria | 1195 |
| 8 | JGI24735J21928_10008753 | 3300002067 | Bacteria | 3266 |
| 9 | JGI24735J21928_10034713 | 3300002067 | Bacteria | 1486 |
| 10 | JGI24735J21928_10043026 | 3300002067 | Bacteria | 1314 |
| 11 | JGI24738J21930_10004453 | 3300002075 | Bacteria | 3430 |
| 12 | JGI25165J46597_1000023 | 3300003214 | Bacteria | 338873 |
| 13 | JGI25165J46597_1000179 | 3300003214 | Bacteria | 97445 |
| 14 | JGI25165J46597_1000320 | 3300003214 | Bacteria | 57832 |
| 15 | Ga0055526_1000379 | 3300003771 | Bacteria | 36047 |
| 16 | Ga0055526_1016982 | 3300003771 | Bacteria | 2809 |
| 17 | Ga0055537_1000574 | 3300003773 | Bacteria | 20500 |
| 18 | Ga0055537_1000758 | 3300003773 | Bacteria | 16504 |
| 19 | Ga0055536_1000515 | 3300003781 | Bacteria | 26648 |
| 20 | Ga0055536_1000695 | 3300003781 | Bacteria | 22573 |
| 21 | Ga0055536_1001217 | 3300003781 | Bacteria | 15966 |
| 22 | Ga0055536_1003930 | 3300003781 | Bacteria | 7792 |
| 23 | Ga0055536_1014264 | 3300003781 | Bacteria | 2806 |
| 24 | Ga0055536_1015946 | 3300003781 | Bacteria | 2540 |
| 25 | Ga0055534_1008869 | 3300003784 | Bacteria | 2236 |
| 26 | Ga0055534_1011960 | 3300003784 | Unclassified | 1739 |
| 27 | Ga0055530_10000035 | 3300003791 | Bacteria | 117598 |
| 28 | Ga0055530_10000089 | 3300003791 | Bacteria | 78801 |
| 29 | Ga0055530_10000567 | 3300003791 | Bacteria | 32025 |
| 30 | Ga0055530_10001601 | 3300003791 | Bacteria | 16224 |
| 31 | Ga0055540_1000306 | 3300003792 | Bacteria | 43525 |
| 32 | Ga0055531_10000088 | 3300003794 | Bacteria | 100973 |
| 33 | Ga0055531_10000907 | 3300003794 | Bacteria | 24086 |
| 34 | Ga0055531_10008866 | 3300003794 | Bacteria | 5225 |
| 35 | Ga0065165_1000213 | 3300005262 | Bacteria | 100746 |
| 36 | Ga0070658_10004476 | 3300005327 | Bacteria | 11376 |
| 37 | Ga0070658_10078785 | 3300005327 | Bacteria | 2705 |
| 38 | Ga0070676_10000898 | 3300005328 | Bacteria | 14725 |
| 39 | Ga0070676_10114495 | 3300005328 | Bacteria | 1684 |
| 40 | Ga0070670_100014223 | 3300005331 | Bacteria | 6827 |
| 41 | Ga0070670_100151525 | 3300005331 | Bacteria | 2007 |
| 42 | Ga0070666_10204349 | 3300005335 | Bacteria | 1390 |
| 43 | Ga0070680_100036124 | 3300005336 | Bacteria | 3992 |
| 44 | Ga0068868_100000671 | 3300005338 | Bacteria | 22976 |
| 45 | Ga0070668_100045788 | 3300005347 | Bacteria | 3357 |
| 46 | Ga0070669_100000916 | 3300005353 | Bacteria | 21441 |
| 47 | Ga0070671_100010154 | 3300005355 | Bacteria | 7561 |
| 48 | Ga0070671_100045005 | 3300005355 | Bacteria | 3668 |
| 49 | Ga0070671_100049188 | 3300005355 | Bacteria | 3508 |
| 50 | Ga0070673_100000005 | 3300005364 | Bacteria | 193513 |
| 51 | Ga0070673_100000020 | 3300005364 | Bacteria | 102632 |
| 52 | Ga0070673_100051360 | 3300005364 | Bacteria | 3228 |
| 53 | Ga0070688_100240845 | 3300005365 | Bacteria | 1284 |
| 54 | Ga0070659_100017105 | 3300005366 | Bacteria | 5451 |
| 55 | Ga0070659_100054836 | 3300005366 | Bacteria | 3141 |
| 56 | Ga0070659_100220406 | 3300005366 | Bacteria | 1565 |
| 57 | Ga0070663_100068065 | 3300005455 | Bacteria | 2584 |
| 58 | Ga0070663_100350308 | 3300005455 | Bacteria | 1195 |
| 59 | Ga0070662_100099516 | 3300005457 | Bacteria | 2198 |
| 60 | Ga0068867_100000863 | 3300005459 | Bacteria | 20449 |
| 61 | Ga0068867_100037956 | 3300005459 | Bacteria | 3504 |
| 62 | Ga0070679_100000272 | 3300005530 | Bacteria | 43386 |
| 63 | Ga0070665_100001398 | 3300005548 | Bacteria | 28355 |
| 64 | Ga0068855_100000027 | 3300005563 | Bacteria | 173316 |
| 65 | Ga0068855_100003517 | 3300005563 | Bacteria | 19169 |
| 66 | Ga0068855_100313726 | 3300005563 | Bacteria | 1734 |
| 67 | Ga0068855_100380340 | 3300005563 | Bacteria | 1550 |
| 68 | Ga0068855_100459580 | 3300005563 | Bacteria | 1388 |
| 69 | Ga0070664_100275434 | 3300005564 | Bacteria | 1516 |
| 70 | Ga0068857_100020864 | 3300005577 | Bacteria | 5764 |
| 71 | Ga0068854_100000188 | 3300005578 | Bacteria | 41566 |
| 72 | Ga0068854_100000530 | 3300005578 | Bacteria | 23141 |
| 73 | Ga0068854_100030339 | 3300005578 | Bacteria | 3750 |
| 74 | Ga0068854_100039502 | 3300005578 | Bacteria | 3325 |
| 75 | Ga0068854_100164830 | 3300005578 | Bacteria | 1720 |
| 76 | Ga0068856_100009231 | 3300005614 | Bacteria | 9593 |
| 77 | Ga0068856_100390859 | 3300005614 | Bacteria | 1411 |
| 78 | Ga0068864_100014611 | 3300005618 | Bacteria | 6521 |
| 79 | Ga0068864_100391918 | 3300005618 | Bacteria | 1318 |
| 80 | Ga0068863_100046069 | 3300005841 | Bacteria | 4139 |
| 81 | Ga0068863_100109438 | 3300005841 | Bacteria | 2630 |
| 82 | Ga0075366_10148314 | 3300006195 | Bacteria | 1420 |
| 83 | Ga0097621_100025094 | 3300006237 | Bacteria | 4661 |
| 84 | Ga0105250_10003474 | 3300009092 | Bacteria | 7455 |
| 85 | Ga0105240_10006143 | 3300009093 | Bacteria | 17714 |
| 86 | Ga0105240_10417451 | 3300009093 | Bacteria | 1508 |
| 87 | Ga0105240_10453263 | 3300009093 | Bacteria | 1435 |
| 88 | Ga0105245_10227884 | 3300009098 | Bacteria | 1801 |
| 89 | Ga0105245_10391393 | 3300009098 | Bacteria | 1387 |
| 90 | Ga0105243_10053854 | 3300009148 | Bacteria | 3192 |
| 91 | Ga0105242_10000155 | 3300009176 | Bacteria | 50755 |
| 92 | Ga0105242_10029774 | 3300009176 | Bacteria | 4356 |
| 93 | Ga0105248_10059666 | 3300009177 | Bacteria | 4285 |
| 94 | Ga0105237_10039608 | 3300009545 | Bacteria | 4758 |
| 95 | Ga0105237_10079484 | 3300009545 | Bacteria | 3269 |
| 96 | Ga0105237_10093149 | 3300009545 | Bacteria | 3002 |
| 97 | Ga0105238_10040488 | 3300009551 | Bacteria | 4721 |
| 98 | Ga0105238_10489280 | 3300009551 | Bacteria | 1230 |
| 99 | Ga0105239_10014420 | 3300010375 | Bacteria | 8771 |
| 100 | Ga0105239_10522718 | 3300010375 | Bacteria | 1350 |
| 101 | Ga0105246_10015192 | 3300011119 | Bacteria | 4856 |
| 102 | Ga0105246_10045934 | 3300011119 | Bacteria | 2977 |
| 103 | Ga0157371_10029476 | 3300013102 | Bacteria | 3968 |
| 104 | Ga0157370_10037013 | 3300013104 | Bacteria | 4733 |
| 105 | Ga0157370_10293308 | 3300013104 | Bacteria | 1502 |
| 106 | Ga0157370_10330817 | 3300013104 | Bacteria | 1405 |
| 107 | Ga0157369_10001136 | 3300013105 | Bacteria | 33292 |
| 108 | Ga0157369_10001623 | 3300013105 | Bacteria | 27487 |
| 109 | Ga0157369_10103698 | 3300013105 | Bacteria | 3030 |
| 110 | Ga0157374_10001402 | 3300013296 | Bacteria | 20438 |
| 111 | Ga0157374_10019478 | 3300013296 | Bacteria | 6006 |
| 112 | Ga0157374_10080646 | 3300013296 | Bacteria | 3087 |
| 113 | Ga0157378_10072084 | 3300013297 | Bacteria | 3103 |
| 114 | Ga0157372_10000939 | 3300013307 | Bacteria | 31791 |
| 115 | Ga0157372_10001845 | 3300013307 | Bacteria | 22966 |
| 116 | Ga0157372_10243474 | 3300013307 | Bacteria | 2087 |
| 117 | Ga0157372_10653047 | 3300013307 | Bacteria | 1225 |
| 118 | Ga0157375_10001434 | 3300013308 | Bacteria | 20527 |
| 119 | Ga0157375_10039060 | 3300013308 | Bacteria | 4564 |
| 120 | Ga0157376_10006033 | 3300014969 | Bacteria | 8519 |
| 121 | Ga0157376_10170146 | 3300014969 | Bacteria | 1983 |
| 122 | Ga0207427_100211 | 3300025231 | Bacteria | 53121 |
| 123 | Ga0207427_101342 | 3300025231 | Bacteria | 9112 |
| 124 | Ga0207427_101613 | 3300025231 | Bacteria | 7672 |
| 125 | Ga0209026_1006099 | 3300025250 | Bacteria | 3051 |
| 126 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 127 | Ga0209233_1000041 | 3300025261 | Bacteria | 515463 |
| 128 | Ga0209233_1000278 | 3300025261 | Bacteria | 71989 |
| 129 | Ga0209565_1000245 | 3300025263 | Bacteria | 58278 |
| 130 | Ga0209565_1000264 | 3300025263 | Bacteria | 54985 |
| 131 | Ga0209673_1002400 | 3300025273 | Bacteria | 13106 |
| 132 | Ga0209675_1000126 | 3300025291 | Bacteria | 104792 |
| 133 | Ga0209675_1001955 | 3300025291 | Bacteria | 11123 |
| 134 | Ga0209676_1000288 | 3300025292 | Bacteria | 103217 |
| 135 | Ga0209676_1000566 | 3300025292 | Bacteria | 55814 |
| 136 | Ga0209676_1000824 | 3300025292 | Bacteria | 40329 |
| 137 | Ga0209676_1001055 | 3300025292 | Bacteria | 31590 |
| 138 | Ga0209676_1005880 | 3300025292 | Bacteria | 6238 |
| 139 | Ga0209025_1007766 | 3300025294 | Bacteria | 7899 |
| 140 | Ga0209564_1000378 | 3300025295 | Bacteria | 81676 |
| 141 | Ga0209564_1001239 | 3300025295 | Bacteria | 28706 |
| 142 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 143 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 144 | Ga0209050_1000688 | 3300025298 | Bacteria | 50791 |
| 145 | Ga0209050_1001634 | 3300025298 | Bacteria | 22943 |
| 146 | Ga0209050_1002864 | 3300025298 | Bacteria | 13664 |
| 147 | Ga0209051_1000209 | 3300025303 | Bacteria | 102832 |
| 148 | Ga0209257_1000111 | 3300025304 | Bacteria | 234809 |
| 149 | Ga0209257_1000826 | 3300025304 | Bacteria | 44769 |
| 150 | Ga0209257_1001744 | 3300025304 | Bacteria | 24138 |
| 151 | Ga0209257_1002880 | 3300025304 | Bacteria | 15992 |
| 152 | Ga0207697_10004536 | 3300025315 | Bacteria | 6618 |
| 153 | Ga0207656_10066260 | 3300025321 | Bacteria | 1596 |
| 154 | Ga0207696_1002099 | 3300025711 | Bacteria | 10032 |
| 155 | Ga0207680_10129031 | 3300025903 | Bacteria | 1664 |
| 156 | Ga0207680_10219424 | 3300025903 | Bacteria | 1303 |
| 157 | Ga0207647_10000393 | 3300025904 | Bacteria | 35865 |
| 158 | Ga0207647_10042722 | 3300025904 | Bacteria | 2841 |
| 159 | Ga0207647_10061867 | 3300025904 | Bacteria | 2282 |
| 160 | Ga0207647_10135406 | 3300025904 | Bacteria | 1446 |
| 161 | Ga0207647_10142014 | 3300025904 | Bacteria | 1407 |
| 162 | Ga0207645_10006527 | 3300025907 | Bacteria | 8355 |
| 163 | Ga0207645_10013297 | 3300025907 | Bacteria | 5553 |
| 164 | Ga0207705_10018814 | 3300025909 | Bacteria | 4941 |
| 165 | Ga0207705_10026824 | 3300025909 | Bacteria | 4106 |
| 166 | Ga0207705_10081175 | 3300025909 | Bacteria | 2364 |
| 167 | Ga0207705_10106538 | 3300025909 | Bacteria | 2068 |
| 168 | Ga0207705_10161621 | 3300025909 | Bacteria | 1683 |
| 169 | Ga0207695_10004085 | 3300025913 | Bacteria | 20052 |
| 170 | Ga0207695_10007311 | 3300025913 | Bacteria | 14101 |
| 171 | Ga0207695_10120020 | 3300025913 | Bacteria | 2599 |
| 172 | Ga0207671_10037382 | 3300025914 | Bacteria | 3600 |
| 173 | Ga0207671_10053796 | 3300025914 | Bacteria | 2983 |
| 174 | Ga0207671_10073221 | 3300025914 | Bacteria | 2558 |
| 175 | Ga0207671_10198498 | 3300025914 | Bacteria | 1566 |
| 176 | Ga0207660_10331961 | 3300025917 | Bacteria | 1216 |
| 177 | Ga0207657_10124921 | 3300025919 | Bacteria | 2114 |
| 178 | Ga0207649_10250401 | 3300025920 | Bacteria | 1276 |
| 179 | Ga0207649_10458672 | 3300025920 | Bacteria | 963 |
| 180 | Ga0207652_10000340 | 3300025921 | Bacteria | 48581 |
| 181 | Ga0207681_10023900 | 3300025923 | Bacteria | 3915 |
| 182 | Ga0207694_10040564 | 3300025924 | Bacteria | 3585 |
| 183 | Ga0207650_10055524 | 3300025925 | Bacteria | 2940 |
| 184 | Ga0207650_10315219 | 3300025925 | Bacteria | 1280 |
| 185 | Ga0207687_10301653 | 3300025927 | Bacteria | 1290 |
| 186 | Ga0207644_10010430 | 3300025931 | Bacteria | 6122 |
| 187 | Ga0207644_10205680 | 3300025931 | Bacteria | 1554 |
| 188 | Ga0207690_10004259 | 3300025932 | Bacteria | 8443 |
| 189 | Ga0207690_10030393 | 3300025932 | Bacteria | 3445 |
| 190 | Ga0207690_10040580 | 3300025932 | Bacteria | 3044 |
| 191 | Ga0207690_10163212 | 3300025932 | Bacteria | 1663 |
| 192 | Ga0207690_10380032 | 3300025932 | Bacteria | 1122 |
| 193 | Ga0207706_10017389 | 3300025933 | Bacteria | 6477 |
| 194 | Ga0207706_10174143 | 3300025933 | Bacteria | 1890 |
| 195 | Ga0207706_10254569 | 3300025933 | Bacteria | 1533 |
| 196 | Ga0207686_10000528 | 3300025934 | Bacteria | 24751 |
| 197 | Ga0207686_10002650 | 3300025934 | Bacteria | 9701 |
| 198 | Ga0207709_10003603 | 3300025935 | Bacteria | 9148 |
| 199 | Ga0207711_10051904 | 3300025941 | Bacteria | 3513 |
| 200 | Ga0207667_10000013 | 3300025949 | Bacteria | 435875 |
| 201 | Ga0207667_10003476 | 3300025949 | Bacteria | 19447 |
| 202 | Ga0207667_10048014 | 3300025949 | Bacteria | 4515 |
| 203 | Ga0207667_10071047 | 3300025949 | Bacteria | 3621 |
| 204 | Ga0207667_10077749 | 3300025949 | Bacteria | 3440 |
| 205 | Ga0207667_10277082 | 3300025949 | Bacteria | 1714 |
| 206 | Ga0207651_10000001 | 3300025960 | Bacteria | 516823 |
| 207 | Ga0207651_10000010 | 3300025960 | Bacteria | 193754 |
| 208 | Ga0207651_10092766 | 3300025960 | Bacteria | 2215 |
| 209 | Ga0207651_10277861 | 3300025960 | Bacteria | 1382 |
| 210 | Ga0207668_10175464 | 3300025972 | Bacteria | 1685 |
| 211 | Ga0207640_10000073 | 3300025981 | Bacteria | 79417 |
| 212 | Ga0207640_10000284 | 3300025981 | Bacteria | 34016 |
| 213 | Ga0207640_10060938 | 3300025981 | Bacteria | 2497 |
| 214 | Ga0207658_10007495 | 3300025986 | Bacteria | 7434 |
| 215 | Ga0207677_10000021 | 3300026023 | Bacteria | 131828 |
| 216 | Ga0207639_10174001 | 3300026041 | Bacteria | 1826 |
| 217 | Ga0207639_10193916 | 3300026041 | Bacteria | 1737 |
| 218 | Ga0207678_10033658 | 3300026067 | Bacteria | 4464 |
| 219 | Ga0207678_10051868 | 3300026067 | Bacteria | 3540 |
| 220 | Ga0207678_10333972 | 3300026067 | Bacteria | 1305 |
| 221 | Ga0207702_10005705 | 3300026078 | Bacteria | 10856 |
| 222 | Ga0207702_10025755 | 3300026078 | Bacteria | 4884 |
| 223 | Ga0207641_10053237 | 3300026088 | Bacteria | 3430 |
| 224 | Ga0207648_10002352 | 3300026089 | Bacteria | 20407 |
| 225 | Ga0207648_10014061 | 3300026089 | Bacteria | 7408 |
| 226 | Ga0207676_10006948 | 3300026095 | Bacteria | 8021 |
| 227 | Ga0207676_10136196 | 3300026095 | Bacteria | 2095 |
| 228 | Ga0207674_10003309 | 3300026116 | Bacteria | 19811 |
| 229 | Ga0207674_10057272 | 3300026116 | Bacteria | 3951 |
| 230 | Ga0207674_10059699 | 3300026116 | Bacteria | 3858 |
| 231 | Ga0207674_10069180 | 3300026116 | Bacteria | 3551 |
| 232 | Ga0207674_10291613 | 3300026116 | Bacteria | 1580 |
| 233 | Ga0207698_10098243 | 3300026142 | Bacteria | 2419 |
| 234 | Ga0209983_1023341 | 3300027665 | Bacteria | 1299 |
| 235 | Ga0209974_10013935 | 3300027876 | Bacteria | 2678 |
| 236 | Ga0268266_10008096 | 3300028379 | Bacteria | 9384 |
| 237 | Ga0268266_10391823 | 3300028379 | Bacteria | 1312 |
| 238 | Ga0307412_10001873 | 3300031911 | Bacteria | 11637 |
| 239 | Ga0307412_10003692 | 3300031911 | Bacteria | 8501 |
| 240 | Ga0307412_10051185 | 3300031911 | Bacteria | 2728 |
| 241 | Ga0307412_10070886 | 3300031911 | Bacteria | 2377 |
| 242 | Ga0307414_10000091 | 3300032004 | Bacteria | 72871 |
| 243 | Ga0395899_0000165 | 3300037312 | Bacteria | 102140 |
| 244 | Ga0395899_0018349 | 3300037312 | Bacteria | 5318 |
| 245 | Ga0395900_0000471 | 3300037418 | Bacteria | 57583 |
| 246 | Ga0395900_0021321 | 3300037418 | Bacteria | 6624 |
| 247 | Ga0395900_0028415 | 3300037418 | Bacteria | 5727 |
| 248 | Ga0395900_0054141 | 3300037418 | Bacteria | 4131 |
| 249 | Ga0395900_0057890 | 3300037418 | Bacteria | 3990 |
| 250 | Ga0395900_0064740 | 3300037418 | Bacteria | 3756 |
| 251 | Ga0395898_0021486 | 3300037466 | Bacteria | 6545 |
| 252 | Ga0395898_0108548 | 3300037466 | Bacteria | 2661 |
| 253 | Ga0395905_0007466 | 3300037471 | Bacteria | 10872 |
| 254 | Ga0395905_0026436 | 3300037471 | Bacteria | 5472 |
| 255 | Ga0395905_0070288 | 3300037471 | Bacteria | 3280 |
| 256 | Ga0395905_0127900 | 3300037471 | Bacteria | 2389 |
| 257 | Ga0395905_0178149 | 3300037471 | Bacteria | 1995 |
| 258 | Ga0395901_0000064 | 3300038443 | Bacteria | 147477 |
| 259 | Ga0395901_0003751 | 3300038443 | Bacteria | 15310 |
| 260 | Ga0395901_0021308 | 3300038443 | Bacteria | 6639 |
| 261 | Ga0395901_0088592 | 3300038443 | Bacteria | 3237 |
| 262 | Ga0395901_0202219 | 3300038443 | Bacteria | 2082 |
| 263 | Ga0395901_0214274 | 3300038443 | Bacteria | 2014 |
| 264 | Ga0395901_0234293 | 3300038443 | Bacteria | 1916 |
| 265 | Ga0237819_00523 | 3300038705 | Bacteria | 12858 |
| 266 | Ga0439455_0014051 | 3300042012 | Bacteria | 1823 |
| 267 | Ga0466967_0104007 | 3300045976 | Bacteria | 2599 |
| 268 | Ga0495596_0022983 | 3300046500 | Plasmid | 2533 |
| 269 | Ga0495654_0003117 | 3300046530 | Bacteria | 10296 |
| 270 | Ga0495609_0023669 | 3300046538 | Bacteria | 2822 |
| 271 | Ga0495625_0006016 | 3300046660 | Bacteria | 10902 |
| 272 | Ga0495670_0000008 | 3300046691 | Bacteria | 219555 |
| 273 | Ga0495670_0000042 | 3300046691 | Bacteria | 69501 |
| 274 | Ga0496108_0064704 | 3300048911 | Bacteria | 3081 |
| 275 | Ga0496109_0188193 | 3300048912 | Bacteria | 1939 |
| 276 | Ga0496112_0004504 | 3300048915 | Bacteria | 11824 |
| 277 | Ga0496112_0039275 | 3300048915 | Bacteria | 4625 |
| 278 | Ga0496113_0178451 | 3300048916 | Bacteria | 1683 |
| 279 | Ga0496115_0001733 | 3300048918 | Bacteria | 15643 |
| 280 | Ga0496115_0002755 | 3300048918 | Bacteria | 12634 |
| 281 | Ga0496116_0128271 | 3300048919 | Bacteria | 1451 |
| 282 | Ga0496121_0010848 | 3300048924 | Bacteria | 10189 |
| 283 | Ga0496121_0110159 | 3300048924 | Bacteria | 2101 |
| 284 | Ga0496122_0038478 | 3300048925 | Bacteria | 3832 |
| 285 | Ga0496122_0190925 | 3300048925 | Bacteria | 1209 |
| 286 | Ga0496123_0017409 | 3300048926 | Bacteria | 5784 |
| 287 | Ga0496123_0062173 | 3300048926 | Bacteria | 2394 |
| 288 | Ga0496123_0150750 | 3300048926 | Bacteria | 1255 |
| 289 | Ga0496124_0000501 | 3300048927 | Bacteria | 67326 |
| 290 | Ga0496124_0000731 | 3300048927 | Bacteria | 53888 |
| 291 | Ga0496124_0002194 | 3300048927 | Bacteria | 26062 |
| 292 | Ga0496124_0003757 | 3300048927 | Bacteria | 18267 |
| 293 | Ga0496124_0008526 | 3300048927 | Bacteria | 10700 |
| 294 | Ga0496124_0023610 | 3300048927 | Bacteria | 5610 |
| 295 | Ga0496124_0064037 | 3300048927 | Bacteria | 3070 |
| 296 | Ga0496124_0095966 | 3300048927 | Bacteria | 2409 |
| 297 | Ga0496124_0104573 | 3300048927 | Bacteria | 2289 |
| 298 | Ga0496125_0002167 | 3300048928 | Bacteria | 26252 |
| 299 | Ga0496125_0083773 | 3300048928 | Bacteria | 2424 |
| 300 | Ga0496125_0097176 | 3300048928 | Bacteria | 2183 |
| 301 | Ga0496125_0116031 | 3300048928 | Bacteria | 1924 |
| 302 | Ga0496126_0045987 | 3300048929 | Bacteria | 4008 |
| 303 | Ga0501032_0100058 | 3300049569 | Bacteria | 1921 |
| 304 | Ga0501033_0000573 | 3300049570 | Bacteria | 34229 |
| 305 | Ga0501034_0001427 | 3300049571 | Bacteria | 31925 |
| 306 | Ga0501036_0240673 | 3300049572 | Bacteria | 1518 |
| 307 | Ga0501037_0047447 | 3300049573 | Bacteria | 3148 |
| 308 | Ga0501043_0021961 | 3300049579 | Bacteria | 5006 |
| 309 | Ga0501047_0035515 | 3300049581 | Bacteria | 4816 |
| 310 | Ga0501047_0041886 | 3300049581 | Bacteria | 4425 |
| 311 | Ga0501206_006465 | 3300049653 | Bacteria | 1525 |
| 312 | Ga0501236_003981 | 3300049670 | Bacteria | 1741 |
| 313 | Ga0501225_0015024 | 3300049705 | Bacteria | 2160 |
| 314 | Ga0501035_0011778 | 3300049822 | Bacteria | 8097 |
| 315 | Ga0501044_0000949 | 3300049823 | Bacteria | 34811 |
| 316 | Ga0501044_0020396 | 3300049823 | Bacteria | 7077 |
| 317 | Ga0500643_015568 | 3300053087 | Bacteria | 2603 |
| 318 | Ga0500566_0000595 | 3300053094 | Bacteria | 20247 |
| 319 | Ga0500608_007112 | 3300053122 | Bacteria | 4604 |
| 320 | Ga0500573_0000021 | 3300053140 | Bacteria | 159093 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025920 | Ga0207649_10458672 | Ga0207649_104586721 | 269 |
| 2 | 3300026116 | Ga0207674_10069180 | Ga0207674_100691803 | 269 |
| 3 | 3300025909 | Ga0207705_10161621 | Ga0207705_101616213 | 272 |
| 4 | 3300005578 | Ga0068854_100164830 | Ga0068854_1001648303 | 273 |
| 5 | 3300025981 | Ga0207640_10060938 | Ga0207640_100609382 | 273 |
| 6 | 3300046538 | Ga0495609_0023669 | Ga0495609_0023669_216_1046 | 276 |
| 7 | 3300005530 | Ga0070679_100000272 | Ga0070679_10000027229 | 294 |
| 8 | 3300025921 | Ga0207652_10000340 | Ga0207652_1000034015 | 294 |
| 9 | 3300048928 | Ga0496125_0002167 | Ga0496125_0002167_21180_22094 | 294 |
| 10 | 3300013105 | Ga0157369_10001623 | Ga0157369_100016238 | 295 |
| 11 | 3300025931 | Ga0207644_10205680 | Ga0207644_102056801 | 296 |
| 12 | 3300005614 | Ga0068856_100009231 | Ga0068856_1000092316 | 297 |
| 13 | 3300026078 | Ga0207702_10025755 | Ga0207702_100257554 | 297 |
| 14 | 3300031911 | Ga0307412_10070886 | Ga0307412_100708863 | 299 |
| 15 | 3300013307 | Ga0157372_10000939 | Ga0157372_1000093915 | 302 |
| 16 | iso_pu_bacteria | 2599185359 | 2600224710 | 303 |
| 17 | iso_pu_bacteria | 2599185359 | 2600227266 | 303 |
| 18 | iso_pu_bacteria | 2599185359 | 2600228553 | 303 |
| 19 | iso_pu_bacteria | 2818991466 | 2819712875 | 303 |
| 20 | iso_pu_bacteria | 2852653556 | 2852653775 | 303 |
| 21 | iso_pu_bacteria | 2879163058 | 2879164231 | 303 |
| 22 | iso_pu_bacteria | 2928526807 | 2928529295 | 303 |
| 23 | iso_pu_bacteria | 2928526807 | 2928531300 | 303 |
| 24 | iso_pu_bacteria | 2928959182 | 2928962979 | 303 |
| 25 | 3300025298 | Ga0209050_1000688 | Ga0209050_100068816 | 304 |
| 26 | 3300025933 | Ga0207706_10254569 | Ga0207706_102545692 | 304 |
| 27 | 3300046500 | Ga0495596_0022983 | Ga0495596_0022983_477_1391 | 304 |
| 28 | 3300046660 | Ga0495625_0006016 | Ga0495625_0006016_5537_6451 | 304 |
| 29 | 3300048927 | Ga0496124_0000731 | Ga0496124_0000731_656_1570 | 304 |
| 30 | 3300053122 | Ga0500608_007112 | Ga0500608_007112_3604_4518 | 304 |
| 31 | iso_pu_bacteria | 2818991466 | 2819713830 | 304 |
| 32 | 3300003214 | JGI25165J46597_1000023 | JGI25165J46597_1000023351 | 305 |
| 33 | 3300005578 | Ga0068854_100000188 | Ga0068854_10000018831 | 305 |
| 34 | 3300006237 | Ga0097621_100025094 | Ga0097621_1000250941 | 305 |
| 35 | 3300013105 | Ga0157369_10001136 | Ga0157369_1000113615 | 305 |
| 36 | 3300013105 | Ga0157369_10103698 | Ga0157369_101036982 | 305 |
| 37 | 3300013296 | Ga0157374_10019478 | Ga0157374_100194784 | 305 |
| 38 | 3300025231 | Ga0207427_100211 | Ga0207427_10021145 | 305 |
| 39 | 3300025231 | Ga0207427_101342 | Ga0207427_1013426 | 305 |
| 40 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031186 | 305 |
| 41 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003226 | 305 |
| 42 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003618 | 305 |
| 43 | 3300025981 | Ga0207640_10000284 | Ga0207640_100002846 | 305 |
| 44 | 3300037418 | Ga0395900_0064740 | Ga0395900_0064740_1864_2847 | 305 |
| 45 | 3300025292 | Ga0209676_1005880 | Ga0209676_10058806 | 306 |
| 46 | 3300001904 | JGI24736J21556_1011284 | JGI24736J21556_10112841 | 307 |
| 47 | 3300001989 | JGI24739J22299_10046798 | JGI24739J22299_100467981 | 307 |
| 48 | 3300001990 | JGI24737J22298_10001550 | JGI24737J22298_100015502 | 307 |
| 49 | 3300001990 | JGI24737J22298_10003756 | JGI24737J22298_100037563 | 307 |
| 50 | 3300001990 | JGI24737J22298_10028866 | JGI24737J22298_100288662 | 307 |
| 51 | 3300001990 | JGI24737J22298_10038081 | JGI24737J22298_100380811 | 307 |
| 52 | 3300001990 | JGI24737J22298_10055694 | JGI24737J22298_100556941 | 307 |
| 53 | 3300002067 | JGI24735J21928_10008753 | JGI24735J21928_100087536 | 307 |
| 54 | 3300002067 | JGI24735J21928_10034713 | JGI24735J21928_100347131 | 307 |
| 55 | 3300002067 | JGI24735J21928_10043026 | JGI24735J21928_100430261 | 307 |
| 56 | 3300002075 | JGI24738J21930_10004453 | JGI24738J21930_100044532 | 307 |
| 57 | 3300003214 | JGI25165J46597_1000179 | JGI25165J46597_100017934 | 307 |
| 58 | 3300003214 | JGI25165J46597_1000320 | JGI25165J46597_100032052 | 307 |
| 59 | 3300003771 | Ga0055526_1000379 | Ga0055526_100037925 | 307 |
| 60 | 3300003771 | Ga0055526_1016982 | Ga0055526_10169823 | 307 |
| 61 | 3300003773 | Ga0055537_1000574 | Ga0055537_10005748 | 307 |
| 62 | 3300003773 | Ga0055537_1000758 | Ga0055537_100075814 | 307 |
| 63 | 3300003781 | Ga0055536_1000515 | Ga0055536_10005157 | 307 |
| 64 | 3300003781 | Ga0055536_1000695 | Ga0055536_100069516 | 307 |
| 65 | 3300003781 | Ga0055536_1001217 | Ga0055536_100121713 | 307 |
| 66 | 3300003781 | Ga0055536_1003930 | Ga0055536_100393011 | 307 |
| 67 | 3300003781 | Ga0055536_1014264 | Ga0055536_10142644 | 307 |
| 68 | 3300003781 | Ga0055536_1015946 | Ga0055536_10159463 | 307 |
| 69 | 3300003784 | Ga0055534_1008869 | Ga0055534_10088693 | 307 |
| 70 | 3300003784 | Ga0055534_1011960 | Ga0055534_10119601 | 307 |
| 71 | 3300003791 | Ga0055530_10000035 | Ga0055530_10000035121 | 307 |
| 72 | 3300003791 | Ga0055530_10000089 | Ga0055530_1000008931 | 307 |
| 73 | 3300003791 | Ga0055530_10000567 | Ga0055530_1000056726 | 307 |
| 74 | 3300003791 | Ga0055530_10001601 | Ga0055530_100016015 | 307 |
| 75 | 3300003792 | Ga0055540_1000306 | Ga0055540_100030618 | 307 |
| 76 | 3300003794 | Ga0055531_10000088 | Ga0055531_1000008824 | 307 |
| 77 | 3300003794 | Ga0055531_10000907 | Ga0055531_1000090723 | 307 |
| 78 | 3300003794 | Ga0055531_10008866 | Ga0055531_100088665 | 307 |
| 79 | 3300005262 | Ga0065165_1000213 | Ga0065165_100021333 | 307 |
| 80 | 3300005327 | Ga0070658_10004476 | Ga0070658_100044761 | 307 |
| 81 | 3300005327 | Ga0070658_10078785 | Ga0070658_100787852 | 307 |
| 82 | 3300005328 | Ga0070676_10000898 | Ga0070676_1000089812 | 307 |
| 83 | 3300005328 | Ga0070676_10114495 | Ga0070676_101144953 | 307 |
| 84 | 3300005331 | Ga0070670_100014223 | Ga0070670_1000142237 | 307 |
| 85 | 3300005331 | Ga0070670_100151525 | Ga0070670_1001515252 | 307 |
| 86 | 3300005335 | Ga0070666_10204349 | Ga0070666_102043491 | 307 |
| 87 | 3300005336 | Ga0070680_100036124 | Ga0070680_1000361241 | 307 |
| 88 | 3300005338 | Ga0068868_100000671 | Ga0068868_10000067116 | 307 |
| 89 | 3300005347 | Ga0070668_100045788 | Ga0070668_1000457883 | 307 |
| 90 | 3300005353 | Ga0070669_100000916 | Ga0070669_1000009161 | 307 |
| 91 | 3300005355 | Ga0070671_100010154 | Ga0070671_1000101543 | 307 |
| 92 | 3300005355 | Ga0070671_100045005 | Ga0070671_1000450052 | 307 |
| 93 | 3300005355 | Ga0070671_100049188 | Ga0070671_1000491884 | 307 |
| 94 | 3300005364 | Ga0070673_100000005 | Ga0070673_10000000580 | 307 |
| 95 | 3300005364 | Ga0070673_100000020 | Ga0070673_10000002032 | 307 |
| 96 | 3300005364 | Ga0070673_100051360 | Ga0070673_1000513604 | 307 |
| 97 | 3300005365 | Ga0070688_100240845 | Ga0070688_1002408451 | 307 |
| 98 | 3300005366 | Ga0070659_100017105 | Ga0070659_1000171051 | 307 |
| 99 | 3300005366 | Ga0070659_100054836 | Ga0070659_1000548364 | 307 |
| 100 | 3300005366 | Ga0070659_100220406 | Ga0070659_1002204063 | 307 |
| 101 | 3300005455 | Ga0070663_100068065 | Ga0070663_1000680653 | 307 |
| 102 | 3300005455 | Ga0070663_100350308 | Ga0070663_1003503081 | 307 |
| 103 | 3300005457 | Ga0070662_100099516 | Ga0070662_1000995161 | 307 |
| 104 | 3300005459 | Ga0068867_100000863 | Ga0068867_10000086314 | 307 |
| 105 | 3300005459 | Ga0068867_100037956 | Ga0068867_1000379566 | 307 |
| 106 | 3300005548 | Ga0070665_100001398 | Ga0070665_10000139816 | 307 |
| 107 | 3300005563 | Ga0068855_100000027 | Ga0068855_10000002776 | 307 |
| 108 | 3300005563 | Ga0068855_100003517 | Ga0068855_10000351719 | 307 |
| 109 | 3300005563 | Ga0068855_100313726 | Ga0068855_1003137262 | 307 |
| 110 | 3300005563 | Ga0068855_100380340 | Ga0068855_1003803402 | 307 |
| 111 | 3300005563 | Ga0068855_100459580 | Ga0068855_1004595801 | 307 |
| 112 | 3300005564 | Ga0070664_100275434 | Ga0070664_1002754342 | 307 |
| 113 | 3300005577 | Ga0068857_100020864 | Ga0068857_1000208645 | 307 |
| 114 | 3300005578 | Ga0068854_100000530 | Ga0068854_10000053012 | 307 |
| 115 | 3300005578 | Ga0068854_100030339 | Ga0068854_1000303394 | 307 |
| 116 | 3300005578 | Ga0068854_100039502 | Ga0068854_1000395025 | 307 |
| 117 | 3300005614 | Ga0068856_100390859 | Ga0068856_1003908591 | 307 |
| 118 | 3300005618 | Ga0068864_100014611 | Ga0068864_1000146111 | 307 |
| 119 | 3300005618 | Ga0068864_100391918 | Ga0068864_1003919182 | 307 |
| 120 | 3300005841 | Ga0068863_100046069 | Ga0068863_1000460693 | 307 |
| 121 | 3300005841 | Ga0068863_100109438 | Ga0068863_1001094381 | 307 |
| 122 | 3300006195 | Ga0075366_10148314 | Ga0075366_101483141 | 307 |
| 123 | 3300009092 | Ga0105250_10003474 | Ga0105250_1000347410 | 307 |
| 124 | 3300009093 | Ga0105240_10006143 | Ga0105240_1000614310 | 307 |
| 125 | 3300009093 | Ga0105240_10417451 | Ga0105240_104174513 | 307 |
| 126 | 3300009093 | Ga0105240_10453263 | Ga0105240_104532632 | 307 |
| 127 | 3300009098 | Ga0105245_10227884 | Ga0105245_102278843 | 307 |
| 128 | 3300009098 | Ga0105245_10391393 | Ga0105245_103913932 | 307 |
| 129 | 3300009148 | Ga0105243_10053854 | Ga0105243_100538543 | 307 |
| 130 | 3300009176 | Ga0105242_10000155 | Ga0105242_100001556 | 307 |
| 131 | 3300009176 | Ga0105242_10029774 | Ga0105242_100297743 | 307 |
| 132 | 3300009177 | Ga0105248_10059666 | Ga0105248_100596662 | 307 |
| 133 | 3300009545 | Ga0105237_10039608 | Ga0105237_100396086 | 307 |
| 134 | 3300009545 | Ga0105237_10079484 | Ga0105237_100794843 | 307 |
| 135 | 3300009545 | Ga0105237_10093149 | Ga0105237_100931493 | 307 |
| 136 | 3300009551 | Ga0105238_10040488 | Ga0105238_100404886 | 307 |
| 137 | 3300009551 | Ga0105238_10489280 | Ga0105238_104892802 | 307 |
| 138 | 3300010375 | Ga0105239_10014420 | Ga0105239_100144205 | 307 |
| 139 | 3300010375 | Ga0105239_10522718 | Ga0105239_105227181 | 307 |
| 140 | 3300011119 | Ga0105246_10015192 | Ga0105246_100151923 | 307 |
| 141 | 3300011119 | Ga0105246_10045934 | Ga0105246_100459343 | 307 |
| 142 | 3300013102 | Ga0157371_10029476 | Ga0157371_100294763 | 307 |
| 143 | 3300013104 | Ga0157370_10037013 | Ga0157370_100370133 | 307 |
| 144 | 3300013104 | Ga0157370_10293308 | Ga0157370_102933081 | 307 |
| 145 | 3300013104 | Ga0157370_10330817 | Ga0157370_103308172 | 307 |
| 146 | 3300013296 | Ga0157374_10001402 | Ga0157374_1000140213 | 307 |
| 147 | 3300013296 | Ga0157374_10080646 | Ga0157374_100806462 | 307 |
| 148 | 3300013297 | Ga0157378_10072084 | Ga0157378_100720843 | 307 |
| 149 | 3300013307 | Ga0157372_10001845 | Ga0157372_1000184520 | 307 |
| 150 | 3300013307 | Ga0157372_10243474 | Ga0157372_102434741 | 307 |
| 151 | 3300013307 | Ga0157372_10653047 | Ga0157372_106530471 | 307 |
| 152 | 3300013308 | Ga0157375_10001434 | Ga0157375_1000143416 | 307 |
| 153 | 3300013308 | Ga0157375_10039060 | Ga0157375_100390601 | 307 |
| 154 | 3300014969 | Ga0157376_10006033 | Ga0157376_100060336 | 307 |
| 155 | 3300014969 | Ga0157376_10170146 | Ga0157376_101701462 | 307 |
| 156 | 3300025231 | Ga0207427_101613 | Ga0207427_1016139 | 307 |
| 157 | 3300025250 | Ga0209026_1006099 | Ga0209026_10060992 | 307 |
| 158 | 3300025261 | Ga0209233_1000041 | Ga0209233_1000041432 | 307 |
| 159 | 3300025261 | Ga0209233_1000278 | Ga0209233_10002782 | 307 |
| 160 | 3300025263 | Ga0209565_1000245 | Ga0209565_100024528 | 307 |
| 161 | 3300025263 | Ga0209565_1000264 | Ga0209565_100026434 | 307 |
| 162 | 3300025273 | Ga0209673_1002400 | Ga0209673_100240013 | 307 |
| 163 | 3300025291 | Ga0209675_1000126 | Ga0209675_100012696 | 307 |
| 164 | 3300025291 | Ga0209675_1001955 | Ga0209675_10019552 | 307 |
| 165 | 3300025292 | Ga0209676_1000288 | Ga0209676_100028880 | 307 |
| 166 | 3300025292 | Ga0209676_1000566 | Ga0209676_100056623 | 307 |
| 167 | 3300025292 | Ga0209676_1000824 | Ga0209676_10008243 | 307 |
| 168 | 3300025292 | Ga0209676_1001055 | Ga0209676_100105512 | 307 |
| 169 | 3300025294 | Ga0209025_1007766 | Ga0209025_10077669 | 307 |
| 170 | 3300025295 | Ga0209564_1000378 | Ga0209564_100037852 | 307 |
| 171 | 3300025295 | Ga0209564_1001239 | Ga0209564_100123918 | 307 |
| 172 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011550 | 307 |
| 173 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042202 | 307 |
| 174 | 3300025298 | Ga0209050_1000042 | Ga0209050_100004241 | 307 |
| 175 | 3300025298 | Ga0209050_1001634 | Ga0209050_100163423 | 307 |
| 176 | 3300025298 | Ga0209050_1002864 | Ga0209050_10028641 | 307 |
| 177 | 3300025303 | Ga0209051_1000209 | Ga0209051_100020924 | 307 |
| 178 | 3300025304 | Ga0209257_1000111 | Ga0209257_1000111102 | 307 |
| 179 | 3300025304 | Ga0209257_1000826 | Ga0209257_10008264 | 307 |
| 180 | 3300025304 | Ga0209257_1001744 | Ga0209257_10017445 | 307 |
| 181 | 3300025304 | Ga0209257_1002880 | Ga0209257_10028804 | 307 |
| 182 | 3300025315 | Ga0207697_10004536 | Ga0207697_100045362 | 307 |
| 183 | 3300025321 | Ga0207656_10066260 | Ga0207656_100662601 | 307 |
| 184 | 3300025711 | Ga0207696_1002099 | Ga0207696_100209911 | 307 |
| 185 | 3300025903 | Ga0207680_10129031 | Ga0207680_101290313 | 307 |
| 186 | 3300025903 | Ga0207680_10219424 | Ga0207680_102194241 | 307 |
| 187 | 3300025904 | Ga0207647_10000393 | Ga0207647_100003932 | 307 |
| 188 | 3300025904 | Ga0207647_10042722 | Ga0207647_100427223 | 307 |
| 189 | 3300025904 | Ga0207647_10061867 | Ga0207647_100618674 | 307 |
| 190 | 3300025904 | Ga0207647_10135406 | Ga0207647_101354062 | 307 |
| 191 | 3300025904 | Ga0207647_10142014 | Ga0207647_101420142 | 307 |
| 192 | 3300025907 | Ga0207645_10006527 | Ga0207645_100065279 | 307 |
| 193 | 3300025907 | Ga0207645_10013297 | Ga0207645_100132973 | 307 |
| 194 | 3300025909 | Ga0207705_10018814 | Ga0207705_100188144 | 307 |
| 195 | 3300025909 | Ga0207705_10026824 | Ga0207705_100268241 | 307 |
| 196 | 3300025909 | Ga0207705_10081175 | Ga0207705_100811751 | 307 |
| 197 | 3300025909 | Ga0207705_10106538 | Ga0207705_101065382 | 307 |
| 198 | 3300025913 | Ga0207695_10004085 | Ga0207695_100040856 | 307 |
| 199 | 3300025913 | Ga0207695_10007311 | Ga0207695_1000731111 | 307 |
| 200 | 3300025913 | Ga0207695_10120020 | Ga0207695_101200202 | 307 |
| 201 | 3300025914 | Ga0207671_10037382 | Ga0207671_100373823 | 307 |
| 202 | 3300025914 | Ga0207671_10053796 | Ga0207671_100537963 | 307 |
| 203 | 3300025914 | Ga0207671_10073221 | Ga0207671_100732213 | 307 |
| 204 | 3300025914 | Ga0207671_10198498 | Ga0207671_101984982 | 307 |
| 205 | 3300025917 | Ga0207660_10331961 | Ga0207660_103319611 | 307 |
| 206 | 3300025919 | Ga0207657_10124921 | Ga0207657_101249212 | 307 |
| 207 | 3300025920 | Ga0207649_10250401 | Ga0207649_102504011 | 307 |
| 208 | 3300025923 | Ga0207681_10023900 | Ga0207681_100239003 | 307 |
| 209 | 3300025924 | Ga0207694_10040564 | Ga0207694_100405642 | 307 |
| 210 | 3300025925 | Ga0207650_10055524 | Ga0207650_100555244 | 307 |
| 211 | 3300025925 | Ga0207650_10315219 | Ga0207650_103152192 | 307 |
| 212 | 3300025927 | Ga0207687_10301653 | Ga0207687_103016532 | 307 |
| 213 | 3300025931 | Ga0207644_10010430 | Ga0207644_100104302 | 307 |
| 214 | 3300025932 | Ga0207690_10004259 | Ga0207690_100042597 | 307 |
| 215 | 3300025932 | Ga0207690_10030393 | Ga0207690_100303933 | 307 |
| 216 | 3300025932 | Ga0207690_10040580 | Ga0207690_100405801 | 307 |
| 217 | 3300025932 | Ga0207690_10163212 | Ga0207690_101632122 | 307 |
| 218 | 3300025932 | Ga0207690_10380032 | Ga0207690_103800321 | 307 |
| 219 | 3300025933 | Ga0207706_10017389 | Ga0207706_100173893 | 307 |
| 220 | 3300025933 | Ga0207706_10174143 | Ga0207706_101741431 | 307 |
| 221 | 3300025934 | Ga0207686_10000528 | Ga0207686_1000052815 | 307 |
| 222 | 3300025934 | Ga0207686_10002650 | Ga0207686_100026503 | 307 |
| 223 | 3300025935 | Ga0207709_10003603 | Ga0207709_100036036 | 307 |
| 224 | 3300025941 | Ga0207711_10051904 | Ga0207711_100519042 | 307 |
| 225 | 3300025949 | Ga0207667_10000013 | Ga0207667_10000013298 | 307 |
| 226 | 3300025949 | Ga0207667_10003476 | Ga0207667_1000347619 | 307 |
| 227 | 3300025949 | Ga0207667_10048014 | Ga0207667_100480141 | 307 |
| 228 | 3300025949 | Ga0207667_10071047 | Ga0207667_100710475 | 307 |
| 229 | 3300025949 | Ga0207667_10077749 | Ga0207667_100777495 | 307 |
| 230 | 3300025949 | Ga0207667_10277082 | Ga0207667_102770822 | 307 |
| 231 | 3300025960 | Ga0207651_10000001 | Ga0207651_1000000132 | 307 |
| 232 | 3300025960 | Ga0207651_10000010 | Ga0207651_1000001078 | 307 |
| 233 | 3300025960 | Ga0207651_10092766 | Ga0207651_100927661 | 307 |
| 234 | 3300025960 | Ga0207651_10277861 | Ga0207651_102778612 | 307 |
| 235 | 3300025972 | Ga0207668_10175464 | Ga0207668_101754642 | 307 |
| 236 | 3300025981 | Ga0207640_10000073 | Ga0207640_1000007361 | 307 |
| 237 | 3300025986 | Ga0207658_10007495 | Ga0207658_100074955 | 307 |
| 238 | 3300026023 | Ga0207677_10000021 | Ga0207677_1000002190 | 307 |
| 239 | 3300026041 | Ga0207639_10174001 | Ga0207639_101740012 | 307 |
| 240 | 3300026041 | Ga0207639_10193916 | Ga0207639_101939161 | 307 |
| 241 | 3300026067 | Ga0207678_10033658 | Ga0207678_100336585 | 307 |
| 242 | 3300026067 | Ga0207678_10051868 | Ga0207678_100518686 | 307 |
| 243 | 3300026067 | Ga0207678_10333972 | Ga0207678_103339721 | 307 |
| 244 | 3300026078 | Ga0207702_10005705 | Ga0207702_100057057 | 307 |
| 245 | 3300026088 | Ga0207641_10053237 | Ga0207641_100532372 | 307 |
| 246 | 3300026089 | Ga0207648_10002352 | Ga0207648_100023526 | 307 |
| 247 | 3300026089 | Ga0207648_10014061 | Ga0207648_100140616 | 307 |
| 248 | 3300026095 | Ga0207676_10006948 | Ga0207676_1000694810 | 307 |
| 249 | 3300026095 | Ga0207676_10136196 | Ga0207676_101361963 | 307 |
| 250 | 3300026116 | Ga0207674_10003309 | Ga0207674_100033092 | 307 |
| 251 | 3300026116 | Ga0207674_10057272 | Ga0207674_100572723 | 307 |
| 252 | 3300026116 | Ga0207674_10059699 | Ga0207674_100596993 | 307 |
| 253 | 3300026116 | Ga0207674_10291613 | Ga0207674_102916132 | 307 |
| 254 | 3300026142 | Ga0207698_10098243 | Ga0207698_100982433 | 307 |
| 255 | 3300027665 | Ga0209983_1023341 | Ga0209983_10233412 | 307 |
| 256 | 3300027876 | Ga0209974_10013935 | Ga0209974_100139353 | 307 |
| 257 | 3300028379 | Ga0268266_10008096 | Ga0268266_100080961 | 307 |
| 258 | 3300028379 | Ga0268266_10391823 | Ga0268266_103918231 | 307 |
| 259 | 3300031911 | Ga0307412_10001873 | Ga0307412_1000187310 | 307 |
| 260 | 3300031911 | Ga0307412_10003692 | Ga0307412_100036923 | 307 |
| 261 | 3300031911 | Ga0307412_10051185 | Ga0307412_100511855 | 307 |
| 262 | 3300032004 | Ga0307414_10000091 | Ga0307414_100000916 | 307 |
| 263 | 3300037312 | Ga0395899_0000165 | Ga0395899_0000165_99843_100766 | 307 |
| 264 | 3300037312 | Ga0395899_0018349 | Ga0395899_0018349_3585_4508 | 307 |
| 265 | 3300037418 | Ga0395900_0000471 | Ga0395900_0000471_32392_33315 | 307 |
| 266 | 3300037418 | Ga0395900_0021321 | Ga0395900_0021321_4734_5657 | 307 |
| 267 | 3300037418 | Ga0395900_0028415 | Ga0395900_0028415_4313_5236 | 307 |
| 268 | 3300037418 | Ga0395900_0054141 | Ga0395900_0054141_930_1853 | 307 |
| 269 | 3300037418 | Ga0395900_0057890 | Ga0395900_0057890_969_1892 | 307 |
| 270 | 3300037466 | Ga0395898_0021486 | Ga0395898_0021486_3711_4634 | 307 |
| 271 | 3300037466 | Ga0395898_0108548 | Ga0395898_0108548_1597_2520 | 307 |
| 272 | 3300037471 | Ga0395905_0007466 | Ga0395905_0007466_7693_8616 | 307 |
| 273 | 3300037471 | Ga0395905_0026436 | Ga0395905_0026436_2427_3350 | 307 |
| 274 | 3300037471 | Ga0395905_0070288 | Ga0395905_0070288_501_1424 | 307 |
| 275 | 3300037471 | Ga0395905_0127900 | Ga0395905_0127900_1339_2262 | 307 |
| 276 | 3300037471 | Ga0395905_0178149 | Ga0395905_0178149_799_1722 | 307 |
| 277 | 3300038443 | Ga0395901_0000064 | Ga0395901_0000064_89125_90048 | 307 |
| 278 | 3300038443 | Ga0395901_0003751 | Ga0395901_0003751_6474_7397 | 307 |
| 279 | 3300038443 | Ga0395901_0021308 | Ga0395901_0021308_4570_5493 | 307 |
| 280 | 3300038443 | Ga0395901_0088592 | Ga0395901_0088592_2231_3154 | 307 |
| 281 | 3300038443 | Ga0395901_0202219 | Ga0395901_0202219_476_1399 | 307 |
| 282 | 3300038443 | Ga0395901_0214274 | Ga0395901_0214274_602_1525 | 307 |
| 283 | 3300038443 | Ga0395901_0234293 | Ga0395901_0234293_132_1055 | 307 |
| 284 | 3300038705 | Ga0237819_00523 | Ga0237819_00523_9415_10344 | 307 |
| 285 | 3300042012 | Ga0439455_0014051 | Ga0439455_0014051_168_1172 | 307 |
| 286 | 3300045976 | Ga0466967_0104007 | Ga0466967_0104007_1498_2421 | 307 |
| 287 | 3300046530 | Ga0495654_0003117 | Ga0495654_0003117_4664_5587 | 307 |
| 288 | 3300046691 | Ga0495670_0000008 | Ga0495670_0000008_114486_115409 | 307 |
| 289 | 3300046691 | Ga0495670_0000042 | Ga0495670_0000042_57022_57945 | 307 |
| 290 | 3300048911 | Ga0496108_0064704 | Ga0496108_0064704_358_1281 | 307 |
| 291 | 3300048912 | Ga0496109_0188193 | Ga0496109_0188193_913_1842 | 307 |
| 292 | 3300048915 | Ga0496112_0004504 | Ga0496112_0004504_8365_9288 | 307 |
| 293 | 3300048915 | Ga0496112_0039275 | Ga0496112_0039275_286_1209 | 307 |
| 294 | 3300048916 | Ga0496113_0178451 | Ga0496113_0178451_740_1663 | 307 |
| 295 | 3300048918 | Ga0496115_0001733 | Ga0496115_0001733_9195_10118 | 307 |
| 296 | 3300048918 | Ga0496115_0002755 | Ga0496115_0002755_2782_3705 | 307 |
| 297 | 3300048919 | Ga0496116_0128271 | Ga0496116_0128271_183_1112 | 307 |
| 298 | 3300048924 | Ga0496121_0010848 | Ga0496121_0010848_8013_8978 | 307 |
| 299 | 3300048924 | Ga0496121_0110159 | Ga0496121_0110159_1022_1951 | 307 |
| 300 | 3300048925 | Ga0496122_0038478 | Ga0496122_0038478_886_1809 | 307 |
| 301 | 3300048925 | Ga0496122_0190925 | Ga0496122_0190925_240_1166 | 307 |
| 302 | 3300048926 | Ga0496123_0017409 | Ga0496123_0017409_3728_4651 | 307 |
| 303 | 3300048926 | Ga0496123_0062173 | Ga0496123_0062173_51_977 | 307 |
| 304 | 3300048926 | Ga0496123_0150750 | Ga0496123_0150750_115_1038 | 307 |
| 305 | 3300048927 | Ga0496124_0000501 | Ga0496124_0000501_10937_11860 | 307 |
| 306 | 3300048927 | Ga0496124_0002194 | Ga0496124_0002194_17010_17933 | 307 |
| 307 | 3300048927 | Ga0496124_0003757 | Ga0496124_0003757_15553_16476 | 307 |
| 308 | 3300048927 | Ga0496124_0008526 | Ga0496124_0008526_6807_7730 | 307 |
| 309 | 3300048927 | Ga0496124_0023610 | Ga0496124_0023610_2297_3220 | 307 |
| 310 | 3300048927 | Ga0496124_0064037 | Ga0496124_0064037_279_1202 | 307 |
| 311 | 3300048927 | Ga0496124_0095966 | Ga0496124_0095966_223_1146 | 307 |
| 312 | 3300048927 | Ga0496124_0104573 | Ga0496124_0104573_1322_2245 | 307 |
| 313 | 3300048928 | Ga0496125_0083773 | Ga0496125_0083773_431_1360 | 307 |
| 314 | 3300048928 | Ga0496125_0097176 | Ga0496125_0097176_705_1628 | 307 |
| 315 | 3300048928 | Ga0496125_0116031 | Ga0496125_0116031_864_1787 | 307 |
| 316 | 3300048929 | Ga0496126_0045987 | Ga0496126_0045987_1140_2063 | 307 |
| 317 | 3300049569 | Ga0501032_0100058 | Ga0501032_0100058_669_1595 | 307 |
| 318 | 3300049570 | Ga0501033_0000573 | Ga0501033_0000573_12300_13226 | 307 |
| 319 | 3300049571 | Ga0501034_0001427 | Ga0501034_0001427_29007_29933 | 307 |
| 320 | 3300049572 | Ga0501036_0240673 | Ga0501036_0240673_307_1233 | 307 |
| 321 | 3300049573 | Ga0501037_0047447 | Ga0501037_0047447_736_1662 | 307 |
| 322 | 3300049579 | Ga0501043_0021961 | Ga0501043_0021961_3978_4904 | 307 |
| 323 | 3300049581 | Ga0501047_0035515 | Ga0501047_0035515_2802_3728 | 307 |
| 324 | 3300049581 | Ga0501047_0041886 | Ga0501047_0041886_2420_3346 | 307 |
| 325 | 3300049653 | Ga0501206_006465 | Ga0501206_006465_14_943 | 307 |
| 326 | 3300049670 | Ga0501236_003981 | Ga0501236_003981_579_1508 | 307 |
| 327 | 3300049705 | Ga0501225_0015024 | Ga0501225_0015024_380_1309 | 307 |
| 328 | 3300049822 | Ga0501035_0011778 | Ga0501035_0011778_3770_4696 | 307 |
| 329 | 3300049823 | Ga0501044_0000949 | Ga0501044_0000949_21563_22489 | 307 |
| 330 | 3300049823 | Ga0501044_0020396 | Ga0501044_0020396_1491_2417 | 307 |
| 331 | 3300053087 | Ga0500643_015568 | Ga0500643_015568_1586_2512 | 307 |
| 332 | 3300053094 | Ga0500566_0000595 | Ga0500566_0000595_3019_3942 | 307 |
| 333 | 3300053140 | Ga0500573_0000021 | Ga0500573_0000021_71781_72704 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nqf-assembly1.cif.gz_A | crystal structure of hepn domain protein | 0.9806 | 156 | 296 |
| 4nqf-assembly1.cif.gz_A | crystal structure of hepn domain protein | 0.9475 | 156 | 296 |
| 2hsb-assembly1.cif.gz_A | crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution | 0.7603 | 168 | 295 |
| 3o10-assembly2.cif.gz_C | crystal structure of the hepn domain from human sacsin | 0.7262 | 156 | 295 |
| 1o3u-assembly1.cif.gz_A-2 | crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 a resolution | 0.7227 | 172 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4nqfA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.9755 | 156 | 296 | 1.20.120.330 |
| 4nqfA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.942 | 156 | 296 | 1.20.120.330 |
| af_Q58022_9_132_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.811 | 166 | 295 | 1.20.120.330 |
| af_Q58022_9_132_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.7949 | 166 | 295 | 1.20.120.330 |
| 2hsbA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.741 | 168 | 295 | 1.20.120.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3B7A4-F1-model_v4 | Nucleotidyltransferase | 1.001 | 200 | 306 |
GO:0016740
|
| AF-A0A4V6NHZ9-F1-model_v4 | HEPN domain-containing protein | 0.9981 | 164 | 303 |
|
| AF-A0A7Y9VNN5-F1-model_v4 | deleted | 0.992 | 193 | 306 |
|
| AF-A0A4Q3B9D5-F1-model_v4 | deleted | 0.9904 | 116 | 306 |
|
| AF-A0A807CJ87-F1-model_v4 | deleted | 0.9889 | 191 | 306 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar