F411460

General Info

Members Datasets Scaffolds Average Seq Length
333 159 320 307

Family's Representative Sequence

Representative Sequence 3300042012|Ga0439455_0014051|Ga0439455_0014051_168_1172
Length 334
Sequence MTRALSQSDRIGLAIRSAPAPHRSTIMRTDLDHLPAAKQRDLERVVQIIFEEFEDALSLATQGWKKRGRIEKIILYGSYARGNWVDEPHTAKGYRSDFDLLIIVNDKRLTDRAAYWSKLDERLIRELTITKTIHAPVNFILHTLQEVNDGLAHGRYFFMDIKRDGIAVYQADDNELHEPKPKTPQQALAMAKGYFQEWFPAAGGREKLAKYAVQEGLLKHAAFEYHQTAETLYHCVLLVCTFYTPHVHNLAFLRSQAELIDRRLTHVWPWGSRRERAMFEKLKEAYVKARYSSRYQISSEELAWLGERVEELGRVVLEICNERIAALEQSARAA

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
3 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
6 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
152 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0
Isolates 3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.32
Nodule 0
Rhizoplane 3
Rhizosphere 70.57
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1011284 3300001904 Bacteria 1455
2 JGI24739J22299_10046798 3300001989 Bacteria 1415
3 JGI24737J22298_10001550 3300001990 Bacteria 8169
4 JGI24737J22298_10003756 3300001990 Bacteria 5344
5 JGI24737J22298_10028866 3300001990 Bacteria 1742
6 JGI24737J22298_10038081 3300001990 Bacteria 1481
7 JGI24737J22298_10055694 3300001990 Bacteria 1195
8 JGI24735J21928_10008753 3300002067 Bacteria 3266
9 JGI24735J21928_10034713 3300002067 Bacteria 1486
10 JGI24735J21928_10043026 3300002067 Bacteria 1314
11 JGI24738J21930_10004453 3300002075 Bacteria 3430
12 JGI25165J46597_1000023 3300003214 Bacteria 338873
13 JGI25165J46597_1000179 3300003214 Bacteria 97445
14 JGI25165J46597_1000320 3300003214 Bacteria 57832
15 Ga0055526_1000379 3300003771 Bacteria 36047
16 Ga0055526_1016982 3300003771 Bacteria 2809
17 Ga0055537_1000574 3300003773 Bacteria 20500
18 Ga0055537_1000758 3300003773 Bacteria 16504
19 Ga0055536_1000515 3300003781 Bacteria 26648
20 Ga0055536_1000695 3300003781 Bacteria 22573
21 Ga0055536_1001217 3300003781 Bacteria 15966
22 Ga0055536_1003930 3300003781 Bacteria 7792
23 Ga0055536_1014264 3300003781 Bacteria 2806
24 Ga0055536_1015946 3300003781 Bacteria 2540
25 Ga0055534_1008869 3300003784 Bacteria 2236
26 Ga0055534_1011960 3300003784 Unclassified 1739
27 Ga0055530_10000035 3300003791 Bacteria 117598
28 Ga0055530_10000089 3300003791 Bacteria 78801
29 Ga0055530_10000567 3300003791 Bacteria 32025
30 Ga0055530_10001601 3300003791 Bacteria 16224
31 Ga0055540_1000306 3300003792 Bacteria 43525
32 Ga0055531_10000088 3300003794 Bacteria 100973
33 Ga0055531_10000907 3300003794 Bacteria 24086
34 Ga0055531_10008866 3300003794 Bacteria 5225
35 Ga0065165_1000213 3300005262 Bacteria 100746
36 Ga0070658_10004476 3300005327 Bacteria 11376
37 Ga0070658_10078785 3300005327 Bacteria 2705
38 Ga0070676_10000898 3300005328 Bacteria 14725
39 Ga0070676_10114495 3300005328 Bacteria 1684
40 Ga0070670_100014223 3300005331 Bacteria 6827
41 Ga0070670_100151525 3300005331 Bacteria 2007
42 Ga0070666_10204349 3300005335 Bacteria 1390
43 Ga0070680_100036124 3300005336 Bacteria 3992
44 Ga0068868_100000671 3300005338 Bacteria 22976
45 Ga0070668_100045788 3300005347 Bacteria 3357
46 Ga0070669_100000916 3300005353 Bacteria 21441
47 Ga0070671_100010154 3300005355 Bacteria 7561
48 Ga0070671_100045005 3300005355 Bacteria 3668
49 Ga0070671_100049188 3300005355 Bacteria 3508
50 Ga0070673_100000005 3300005364 Bacteria 193513
51 Ga0070673_100000020 3300005364 Bacteria 102632
52 Ga0070673_100051360 3300005364 Bacteria 3228
53 Ga0070688_100240845 3300005365 Bacteria 1284
54 Ga0070659_100017105 3300005366 Bacteria 5451
55 Ga0070659_100054836 3300005366 Bacteria 3141
56 Ga0070659_100220406 3300005366 Bacteria 1565
57 Ga0070663_100068065 3300005455 Bacteria 2584
58 Ga0070663_100350308 3300005455 Bacteria 1195
59 Ga0070662_100099516 3300005457 Bacteria 2198
60 Ga0068867_100000863 3300005459 Bacteria 20449
61 Ga0068867_100037956 3300005459 Bacteria 3504
62 Ga0070679_100000272 3300005530 Bacteria 43386
63 Ga0070665_100001398 3300005548 Bacteria 28355
64 Ga0068855_100000027 3300005563 Bacteria 173316
65 Ga0068855_100003517 3300005563 Bacteria 19169
66 Ga0068855_100313726 3300005563 Bacteria 1734
67 Ga0068855_100380340 3300005563 Bacteria 1550
68 Ga0068855_100459580 3300005563 Bacteria 1388
69 Ga0070664_100275434 3300005564 Bacteria 1516
70 Ga0068857_100020864 3300005577 Bacteria 5764
71 Ga0068854_100000188 3300005578 Bacteria 41566
72 Ga0068854_100000530 3300005578 Bacteria 23141
73 Ga0068854_100030339 3300005578 Bacteria 3750
74 Ga0068854_100039502 3300005578 Bacteria 3325
75 Ga0068854_100164830 3300005578 Bacteria 1720
76 Ga0068856_100009231 3300005614 Bacteria 9593
77 Ga0068856_100390859 3300005614 Bacteria 1411
78 Ga0068864_100014611 3300005618 Bacteria 6521
79 Ga0068864_100391918 3300005618 Bacteria 1318
80 Ga0068863_100046069 3300005841 Bacteria 4139
81 Ga0068863_100109438 3300005841 Bacteria 2630
82 Ga0075366_10148314 3300006195 Bacteria 1420
83 Ga0097621_100025094 3300006237 Bacteria 4661
84 Ga0105250_10003474 3300009092 Bacteria 7455
85 Ga0105240_10006143 3300009093 Bacteria 17714
86 Ga0105240_10417451 3300009093 Bacteria 1508
87 Ga0105240_10453263 3300009093 Bacteria 1435
88 Ga0105245_10227884 3300009098 Bacteria 1801
89 Ga0105245_10391393 3300009098 Bacteria 1387
90 Ga0105243_10053854 3300009148 Bacteria 3192
91 Ga0105242_10000155 3300009176 Bacteria 50755
92 Ga0105242_10029774 3300009176 Bacteria 4356
93 Ga0105248_10059666 3300009177 Bacteria 4285
94 Ga0105237_10039608 3300009545 Bacteria 4758
95 Ga0105237_10079484 3300009545 Bacteria 3269
96 Ga0105237_10093149 3300009545 Bacteria 3002
97 Ga0105238_10040488 3300009551 Bacteria 4721
98 Ga0105238_10489280 3300009551 Bacteria 1230
99 Ga0105239_10014420 3300010375 Bacteria 8771
100 Ga0105239_10522718 3300010375 Bacteria 1350
101 Ga0105246_10015192 3300011119 Bacteria 4856
102 Ga0105246_10045934 3300011119 Bacteria 2977
103 Ga0157371_10029476 3300013102 Bacteria 3968
104 Ga0157370_10037013 3300013104 Bacteria 4733
105 Ga0157370_10293308 3300013104 Bacteria 1502
106 Ga0157370_10330817 3300013104 Bacteria 1405
107 Ga0157369_10001136 3300013105 Bacteria 33292
108 Ga0157369_10001623 3300013105 Bacteria 27487
109 Ga0157369_10103698 3300013105 Bacteria 3030
110 Ga0157374_10001402 3300013296 Bacteria 20438
111 Ga0157374_10019478 3300013296 Bacteria 6006
112 Ga0157374_10080646 3300013296 Bacteria 3087
113 Ga0157378_10072084 3300013297 Bacteria 3103
114 Ga0157372_10000939 3300013307 Bacteria 31791
115 Ga0157372_10001845 3300013307 Bacteria 22966
116 Ga0157372_10243474 3300013307 Bacteria 2087
117 Ga0157372_10653047 3300013307 Bacteria 1225
118 Ga0157375_10001434 3300013308 Bacteria 20527
119 Ga0157375_10039060 3300013308 Bacteria 4564
120 Ga0157376_10006033 3300014969 Bacteria 8519
121 Ga0157376_10170146 3300014969 Bacteria 1983
122 Ga0207427_100211 3300025231 Bacteria 53121
123 Ga0207427_101342 3300025231 Bacteria 9112
124 Ga0207427_101613 3300025231 Bacteria 7672
125 Ga0209026_1006099 3300025250 Bacteria 3051
126 Ga0209233_1000003 3300025261 Bacteria 1607366
127 Ga0209233_1000041 3300025261 Bacteria 515463
128 Ga0209233_1000278 3300025261 Bacteria 71989
129 Ga0209565_1000245 3300025263 Bacteria 58278
130 Ga0209565_1000264 3300025263 Bacteria 54985
131 Ga0209673_1002400 3300025273 Bacteria 13106
132 Ga0209675_1000126 3300025291 Bacteria 104792
133 Ga0209675_1001955 3300025291 Bacteria 11123
134 Ga0209676_1000288 3300025292 Bacteria 103217
135 Ga0209676_1000566 3300025292 Bacteria 55814
136 Ga0209676_1000824 3300025292 Bacteria 40329
137 Ga0209676_1001055 3300025292 Bacteria 31590
138 Ga0209676_1005880 3300025292 Bacteria 6238
139 Ga0209025_1007766 3300025294 Bacteria 7899
140 Ga0209564_1000378 3300025295 Bacteria 81676
141 Ga0209564_1001239 3300025295 Bacteria 28706
142 Ga0209050_1000001 3300025298 Bacteria 3563507
143 Ga0209050_1000042 3300025298 Bacteria 402842
144 Ga0209050_1000688 3300025298 Bacteria 50791
145 Ga0209050_1001634 3300025298 Bacteria 22943
146 Ga0209050_1002864 3300025298 Bacteria 13664
147 Ga0209051_1000209 3300025303 Bacteria 102832
148 Ga0209257_1000111 3300025304 Bacteria 234809
149 Ga0209257_1000826 3300025304 Bacteria 44769
150 Ga0209257_1001744 3300025304 Bacteria 24138
151 Ga0209257_1002880 3300025304 Bacteria 15992
152 Ga0207697_10004536 3300025315 Bacteria 6618
153 Ga0207656_10066260 3300025321 Bacteria 1596
154 Ga0207696_1002099 3300025711 Bacteria 10032
155 Ga0207680_10129031 3300025903 Bacteria 1664
156 Ga0207680_10219424 3300025903 Bacteria 1303
157 Ga0207647_10000393 3300025904 Bacteria 35865
158 Ga0207647_10042722 3300025904 Bacteria 2841
159 Ga0207647_10061867 3300025904 Bacteria 2282
160 Ga0207647_10135406 3300025904 Bacteria 1446
161 Ga0207647_10142014 3300025904 Bacteria 1407
162 Ga0207645_10006527 3300025907 Bacteria 8355
163 Ga0207645_10013297 3300025907 Bacteria 5553
164 Ga0207705_10018814 3300025909 Bacteria 4941
165 Ga0207705_10026824 3300025909 Bacteria 4106
166 Ga0207705_10081175 3300025909 Bacteria 2364
167 Ga0207705_10106538 3300025909 Bacteria 2068
168 Ga0207705_10161621 3300025909 Bacteria 1683
169 Ga0207695_10004085 3300025913 Bacteria 20052
170 Ga0207695_10007311 3300025913 Bacteria 14101
171 Ga0207695_10120020 3300025913 Bacteria 2599
172 Ga0207671_10037382 3300025914 Bacteria 3600
173 Ga0207671_10053796 3300025914 Bacteria 2983
174 Ga0207671_10073221 3300025914 Bacteria 2558
175 Ga0207671_10198498 3300025914 Bacteria 1566
176 Ga0207660_10331961 3300025917 Bacteria 1216
177 Ga0207657_10124921 3300025919 Bacteria 2114
178 Ga0207649_10250401 3300025920 Bacteria 1276
179 Ga0207649_10458672 3300025920 Bacteria 963
180 Ga0207652_10000340 3300025921 Bacteria 48581
181 Ga0207681_10023900 3300025923 Bacteria 3915
182 Ga0207694_10040564 3300025924 Bacteria 3585
183 Ga0207650_10055524 3300025925 Bacteria 2940
184 Ga0207650_10315219 3300025925 Bacteria 1280
185 Ga0207687_10301653 3300025927 Bacteria 1290
186 Ga0207644_10010430 3300025931 Bacteria 6122
187 Ga0207644_10205680 3300025931 Bacteria 1554
188 Ga0207690_10004259 3300025932 Bacteria 8443
189 Ga0207690_10030393 3300025932 Bacteria 3445
190 Ga0207690_10040580 3300025932 Bacteria 3044
191 Ga0207690_10163212 3300025932 Bacteria 1663
192 Ga0207690_10380032 3300025932 Bacteria 1122
193 Ga0207706_10017389 3300025933 Bacteria 6477
194 Ga0207706_10174143 3300025933 Bacteria 1890
195 Ga0207706_10254569 3300025933 Bacteria 1533
196 Ga0207686_10000528 3300025934 Bacteria 24751
197 Ga0207686_10002650 3300025934 Bacteria 9701
198 Ga0207709_10003603 3300025935 Bacteria 9148
199 Ga0207711_10051904 3300025941 Bacteria 3513
200 Ga0207667_10000013 3300025949 Bacteria 435875
201 Ga0207667_10003476 3300025949 Bacteria 19447
202 Ga0207667_10048014 3300025949 Bacteria 4515
203 Ga0207667_10071047 3300025949 Bacteria 3621
204 Ga0207667_10077749 3300025949 Bacteria 3440
205 Ga0207667_10277082 3300025949 Bacteria 1714
206 Ga0207651_10000001 3300025960 Bacteria 516823
207 Ga0207651_10000010 3300025960 Bacteria 193754
208 Ga0207651_10092766 3300025960 Bacteria 2215
209 Ga0207651_10277861 3300025960 Bacteria 1382
210 Ga0207668_10175464 3300025972 Bacteria 1685
211 Ga0207640_10000073 3300025981 Bacteria 79417
212 Ga0207640_10000284 3300025981 Bacteria 34016
213 Ga0207640_10060938 3300025981 Bacteria 2497
214 Ga0207658_10007495 3300025986 Bacteria 7434
215 Ga0207677_10000021 3300026023 Bacteria 131828
216 Ga0207639_10174001 3300026041 Bacteria 1826
217 Ga0207639_10193916 3300026041 Bacteria 1737
218 Ga0207678_10033658 3300026067 Bacteria 4464
219 Ga0207678_10051868 3300026067 Bacteria 3540
220 Ga0207678_10333972 3300026067 Bacteria 1305
221 Ga0207702_10005705 3300026078 Bacteria 10856
222 Ga0207702_10025755 3300026078 Bacteria 4884
223 Ga0207641_10053237 3300026088 Bacteria 3430
224 Ga0207648_10002352 3300026089 Bacteria 20407
225 Ga0207648_10014061 3300026089 Bacteria 7408
226 Ga0207676_10006948 3300026095 Bacteria 8021
227 Ga0207676_10136196 3300026095 Bacteria 2095
228 Ga0207674_10003309 3300026116 Bacteria 19811
229 Ga0207674_10057272 3300026116 Bacteria 3951
230 Ga0207674_10059699 3300026116 Bacteria 3858
231 Ga0207674_10069180 3300026116 Bacteria 3551
232 Ga0207674_10291613 3300026116 Bacteria 1580
233 Ga0207698_10098243 3300026142 Bacteria 2419
234 Ga0209983_1023341 3300027665 Bacteria 1299
235 Ga0209974_10013935 3300027876 Bacteria 2678
236 Ga0268266_10008096 3300028379 Bacteria 9384
237 Ga0268266_10391823 3300028379 Bacteria 1312
238 Ga0307412_10001873 3300031911 Bacteria 11637
239 Ga0307412_10003692 3300031911 Bacteria 8501
240 Ga0307412_10051185 3300031911 Bacteria 2728
241 Ga0307412_10070886 3300031911 Bacteria 2377
242 Ga0307414_10000091 3300032004 Bacteria 72871
243 Ga0395899_0000165 3300037312 Bacteria 102140
244 Ga0395899_0018349 3300037312 Bacteria 5318
245 Ga0395900_0000471 3300037418 Bacteria 57583
246 Ga0395900_0021321 3300037418 Bacteria 6624
247 Ga0395900_0028415 3300037418 Bacteria 5727
248 Ga0395900_0054141 3300037418 Bacteria 4131
249 Ga0395900_0057890 3300037418 Bacteria 3990
250 Ga0395900_0064740 3300037418 Bacteria 3756
251 Ga0395898_0021486 3300037466 Bacteria 6545
252 Ga0395898_0108548 3300037466 Bacteria 2661
253 Ga0395905_0007466 3300037471 Bacteria 10872
254 Ga0395905_0026436 3300037471 Bacteria 5472
255 Ga0395905_0070288 3300037471 Bacteria 3280
256 Ga0395905_0127900 3300037471 Bacteria 2389
257 Ga0395905_0178149 3300037471 Bacteria 1995
258 Ga0395901_0000064 3300038443 Bacteria 147477
259 Ga0395901_0003751 3300038443 Bacteria 15310
260 Ga0395901_0021308 3300038443 Bacteria 6639
261 Ga0395901_0088592 3300038443 Bacteria 3237
262 Ga0395901_0202219 3300038443 Bacteria 2082
263 Ga0395901_0214274 3300038443 Bacteria 2014
264 Ga0395901_0234293 3300038443 Bacteria 1916
265 Ga0237819_00523 3300038705 Bacteria 12858
266 Ga0439455_0014051 3300042012 Bacteria 1823
267 Ga0466967_0104007 3300045976 Bacteria 2599
268 Ga0495596_0022983 3300046500 Plasmid 2533
269 Ga0495654_0003117 3300046530 Bacteria 10296
270 Ga0495609_0023669 3300046538 Bacteria 2822
271 Ga0495625_0006016 3300046660 Bacteria 10902
272 Ga0495670_0000008 3300046691 Bacteria 219555
273 Ga0495670_0000042 3300046691 Bacteria 69501
274 Ga0496108_0064704 3300048911 Bacteria 3081
275 Ga0496109_0188193 3300048912 Bacteria 1939
276 Ga0496112_0004504 3300048915 Bacteria 11824
277 Ga0496112_0039275 3300048915 Bacteria 4625
278 Ga0496113_0178451 3300048916 Bacteria 1683
279 Ga0496115_0001733 3300048918 Bacteria 15643
280 Ga0496115_0002755 3300048918 Bacteria 12634
281 Ga0496116_0128271 3300048919 Bacteria 1451
282 Ga0496121_0010848 3300048924 Bacteria 10189
283 Ga0496121_0110159 3300048924 Bacteria 2101
284 Ga0496122_0038478 3300048925 Bacteria 3832
285 Ga0496122_0190925 3300048925 Bacteria 1209
286 Ga0496123_0017409 3300048926 Bacteria 5784
287 Ga0496123_0062173 3300048926 Bacteria 2394
288 Ga0496123_0150750 3300048926 Bacteria 1255
289 Ga0496124_0000501 3300048927 Bacteria 67326
290 Ga0496124_0000731 3300048927 Bacteria 53888
291 Ga0496124_0002194 3300048927 Bacteria 26062
292 Ga0496124_0003757 3300048927 Bacteria 18267
293 Ga0496124_0008526 3300048927 Bacteria 10700
294 Ga0496124_0023610 3300048927 Bacteria 5610
295 Ga0496124_0064037 3300048927 Bacteria 3070
296 Ga0496124_0095966 3300048927 Bacteria 2409
297 Ga0496124_0104573 3300048927 Bacteria 2289
298 Ga0496125_0002167 3300048928 Bacteria 26252
299 Ga0496125_0083773 3300048928 Bacteria 2424
300 Ga0496125_0097176 3300048928 Bacteria 2183
301 Ga0496125_0116031 3300048928 Bacteria 1924
302 Ga0496126_0045987 3300048929 Bacteria 4008
303 Ga0501032_0100058 3300049569 Bacteria 1921
304 Ga0501033_0000573 3300049570 Bacteria 34229
305 Ga0501034_0001427 3300049571 Bacteria 31925
306 Ga0501036_0240673 3300049572 Bacteria 1518
307 Ga0501037_0047447 3300049573 Bacteria 3148
308 Ga0501043_0021961 3300049579 Bacteria 5006
309 Ga0501047_0035515 3300049581 Bacteria 4816
310 Ga0501047_0041886 3300049581 Bacteria 4425
311 Ga0501206_006465 3300049653 Bacteria 1525
312 Ga0501236_003981 3300049670 Bacteria 1741
313 Ga0501225_0015024 3300049705 Bacteria 2160
314 Ga0501035_0011778 3300049822 Bacteria 8097
315 Ga0501044_0000949 3300049823 Bacteria 34811
316 Ga0501044_0020396 3300049823 Bacteria 7077
317 Ga0500643_015568 3300053087 Bacteria 2603
318 Ga0500566_0000595 3300053094 Bacteria 20247
319 Ga0500608_007112 3300053122 Bacteria 4604
320 Ga0500573_0000021 3300053140 Bacteria 159093

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10458672 Ga0207649_104586721 269
2 3300026116 Ga0207674_10069180 Ga0207674_100691803 269
3 3300025909 Ga0207705_10161621 Ga0207705_101616213 272
4 3300005578 Ga0068854_100164830 Ga0068854_1001648303 273
5 3300025981 Ga0207640_10060938 Ga0207640_100609382 273
6 3300046538 Ga0495609_0023669 Ga0495609_0023669_216_1046 276
7 3300005530 Ga0070679_100000272 Ga0070679_10000027229 294
8 3300025921 Ga0207652_10000340 Ga0207652_1000034015 294
9 3300048928 Ga0496125_0002167 Ga0496125_0002167_21180_22094 294
10 3300013105 Ga0157369_10001623 Ga0157369_100016238 295
11 3300025931 Ga0207644_10205680 Ga0207644_102056801 296
12 3300005614 Ga0068856_100009231 Ga0068856_1000092316 297
13 3300026078 Ga0207702_10025755 Ga0207702_100257554 297
14 3300031911 Ga0307412_10070886 Ga0307412_100708863 299
15 3300013307 Ga0157372_10000939 Ga0157372_1000093915 302
16 iso_pu_bacteria 2599185359 2600224710 303
17 iso_pu_bacteria 2599185359 2600227266 303
18 iso_pu_bacteria 2599185359 2600228553 303
19 iso_pu_bacteria 2818991466 2819712875 303
20 iso_pu_bacteria 2852653556 2852653775 303
21 iso_pu_bacteria 2879163058 2879164231 303
22 iso_pu_bacteria 2928526807 2928529295 303
23 iso_pu_bacteria 2928526807 2928531300 303
24 iso_pu_bacteria 2928959182 2928962979 303
25 3300025298 Ga0209050_1000688 Ga0209050_100068816 304
26 3300025933 Ga0207706_10254569 Ga0207706_102545692 304
27 3300046500 Ga0495596_0022983 Ga0495596_0022983_477_1391 304
28 3300046660 Ga0495625_0006016 Ga0495625_0006016_5537_6451 304
29 3300048927 Ga0496124_0000731 Ga0496124_0000731_656_1570 304
30 3300053122 Ga0500608_007112 Ga0500608_007112_3604_4518 304
31 iso_pu_bacteria 2818991466 2819713830 304
32 3300003214 JGI25165J46597_1000023 JGI25165J46597_1000023351 305
33 3300005578 Ga0068854_100000188 Ga0068854_10000018831 305
34 3300006237 Ga0097621_100025094 Ga0097621_1000250941 305
35 3300013105 Ga0157369_10001136 Ga0157369_1000113615 305
36 3300013105 Ga0157369_10103698 Ga0157369_101036982 305
37 3300013296 Ga0157374_10019478 Ga0157374_100194784 305
38 3300025231 Ga0207427_100211 Ga0207427_10021145 305
39 3300025231 Ga0207427_101342 Ga0207427_1013426 305
40 3300025261 Ga0209233_1000003 Ga0209233_10000031186 305
41 3300025261 Ga0209233_1000003 Ga0209233_1000003226 305
42 3300025261 Ga0209233_1000003 Ga0209233_1000003618 305
43 3300025981 Ga0207640_10000284 Ga0207640_100002846 305
44 3300037418 Ga0395900_0064740 Ga0395900_0064740_1864_2847 305
45 3300025292 Ga0209676_1005880 Ga0209676_10058806 306
46 3300001904 JGI24736J21556_1011284 JGI24736J21556_10112841 307
47 3300001989 JGI24739J22299_10046798 JGI24739J22299_100467981 307
48 3300001990 JGI24737J22298_10001550 JGI24737J22298_100015502 307
49 3300001990 JGI24737J22298_10003756 JGI24737J22298_100037563 307
50 3300001990 JGI24737J22298_10028866 JGI24737J22298_100288662 307
51 3300001990 JGI24737J22298_10038081 JGI24737J22298_100380811 307
52 3300001990 JGI24737J22298_10055694 JGI24737J22298_100556941 307
53 3300002067 JGI24735J21928_10008753 JGI24735J21928_100087536 307
54 3300002067 JGI24735J21928_10034713 JGI24735J21928_100347131 307
55 3300002067 JGI24735J21928_10043026 JGI24735J21928_100430261 307
56 3300002075 JGI24738J21930_10004453 JGI24738J21930_100044532 307
57 3300003214 JGI25165J46597_1000179 JGI25165J46597_100017934 307
58 3300003214 JGI25165J46597_1000320 JGI25165J46597_100032052 307
59 3300003771 Ga0055526_1000379 Ga0055526_100037925 307
60 3300003771 Ga0055526_1016982 Ga0055526_10169823 307
61 3300003773 Ga0055537_1000574 Ga0055537_10005748 307
62 3300003773 Ga0055537_1000758 Ga0055537_100075814 307
63 3300003781 Ga0055536_1000515 Ga0055536_10005157 307
64 3300003781 Ga0055536_1000695 Ga0055536_100069516 307
65 3300003781 Ga0055536_1001217 Ga0055536_100121713 307
66 3300003781 Ga0055536_1003930 Ga0055536_100393011 307
67 3300003781 Ga0055536_1014264 Ga0055536_10142644 307
68 3300003781 Ga0055536_1015946 Ga0055536_10159463 307
69 3300003784 Ga0055534_1008869 Ga0055534_10088693 307
70 3300003784 Ga0055534_1011960 Ga0055534_10119601 307
71 3300003791 Ga0055530_10000035 Ga0055530_10000035121 307
72 3300003791 Ga0055530_10000089 Ga0055530_1000008931 307
73 3300003791 Ga0055530_10000567 Ga0055530_1000056726 307
74 3300003791 Ga0055530_10001601 Ga0055530_100016015 307
75 3300003792 Ga0055540_1000306 Ga0055540_100030618 307
76 3300003794 Ga0055531_10000088 Ga0055531_1000008824 307
77 3300003794 Ga0055531_10000907 Ga0055531_1000090723 307
78 3300003794 Ga0055531_10008866 Ga0055531_100088665 307
79 3300005262 Ga0065165_1000213 Ga0065165_100021333 307
80 3300005327 Ga0070658_10004476 Ga0070658_100044761 307
81 3300005327 Ga0070658_10078785 Ga0070658_100787852 307
82 3300005328 Ga0070676_10000898 Ga0070676_1000089812 307
83 3300005328 Ga0070676_10114495 Ga0070676_101144953 307
84 3300005331 Ga0070670_100014223 Ga0070670_1000142237 307
85 3300005331 Ga0070670_100151525 Ga0070670_1001515252 307
86 3300005335 Ga0070666_10204349 Ga0070666_102043491 307
87 3300005336 Ga0070680_100036124 Ga0070680_1000361241 307
88 3300005338 Ga0068868_100000671 Ga0068868_10000067116 307
89 3300005347 Ga0070668_100045788 Ga0070668_1000457883 307
90 3300005353 Ga0070669_100000916 Ga0070669_1000009161 307
91 3300005355 Ga0070671_100010154 Ga0070671_1000101543 307
92 3300005355 Ga0070671_100045005 Ga0070671_1000450052 307
93 3300005355 Ga0070671_100049188 Ga0070671_1000491884 307
94 3300005364 Ga0070673_100000005 Ga0070673_10000000580 307
95 3300005364 Ga0070673_100000020 Ga0070673_10000002032 307
96 3300005364 Ga0070673_100051360 Ga0070673_1000513604 307
97 3300005365 Ga0070688_100240845 Ga0070688_1002408451 307
98 3300005366 Ga0070659_100017105 Ga0070659_1000171051 307
99 3300005366 Ga0070659_100054836 Ga0070659_1000548364 307
100 3300005366 Ga0070659_100220406 Ga0070659_1002204063 307
101 3300005455 Ga0070663_100068065 Ga0070663_1000680653 307
102 3300005455 Ga0070663_100350308 Ga0070663_1003503081 307
103 3300005457 Ga0070662_100099516 Ga0070662_1000995161 307
104 3300005459 Ga0068867_100000863 Ga0068867_10000086314 307
105 3300005459 Ga0068867_100037956 Ga0068867_1000379566 307
106 3300005548 Ga0070665_100001398 Ga0070665_10000139816 307
107 3300005563 Ga0068855_100000027 Ga0068855_10000002776 307
108 3300005563 Ga0068855_100003517 Ga0068855_10000351719 307
109 3300005563 Ga0068855_100313726 Ga0068855_1003137262 307
110 3300005563 Ga0068855_100380340 Ga0068855_1003803402 307
111 3300005563 Ga0068855_100459580 Ga0068855_1004595801 307
112 3300005564 Ga0070664_100275434 Ga0070664_1002754342 307
113 3300005577 Ga0068857_100020864 Ga0068857_1000208645 307
114 3300005578 Ga0068854_100000530 Ga0068854_10000053012 307
115 3300005578 Ga0068854_100030339 Ga0068854_1000303394 307
116 3300005578 Ga0068854_100039502 Ga0068854_1000395025 307
117 3300005614 Ga0068856_100390859 Ga0068856_1003908591 307
118 3300005618 Ga0068864_100014611 Ga0068864_1000146111 307
119 3300005618 Ga0068864_100391918 Ga0068864_1003919182 307
120 3300005841 Ga0068863_100046069 Ga0068863_1000460693 307
121 3300005841 Ga0068863_100109438 Ga0068863_1001094381 307
122 3300006195 Ga0075366_10148314 Ga0075366_101483141 307
123 3300009092 Ga0105250_10003474 Ga0105250_1000347410 307
124 3300009093 Ga0105240_10006143 Ga0105240_1000614310 307
125 3300009093 Ga0105240_10417451 Ga0105240_104174513 307
126 3300009093 Ga0105240_10453263 Ga0105240_104532632 307
127 3300009098 Ga0105245_10227884 Ga0105245_102278843 307
128 3300009098 Ga0105245_10391393 Ga0105245_103913932 307
129 3300009148 Ga0105243_10053854 Ga0105243_100538543 307
130 3300009176 Ga0105242_10000155 Ga0105242_100001556 307
131 3300009176 Ga0105242_10029774 Ga0105242_100297743 307
132 3300009177 Ga0105248_10059666 Ga0105248_100596662 307
133 3300009545 Ga0105237_10039608 Ga0105237_100396086 307
134 3300009545 Ga0105237_10079484 Ga0105237_100794843 307
135 3300009545 Ga0105237_10093149 Ga0105237_100931493 307
136 3300009551 Ga0105238_10040488 Ga0105238_100404886 307
137 3300009551 Ga0105238_10489280 Ga0105238_104892802 307
138 3300010375 Ga0105239_10014420 Ga0105239_100144205 307
139 3300010375 Ga0105239_10522718 Ga0105239_105227181 307
140 3300011119 Ga0105246_10015192 Ga0105246_100151923 307
141 3300011119 Ga0105246_10045934 Ga0105246_100459343 307
142 3300013102 Ga0157371_10029476 Ga0157371_100294763 307
143 3300013104 Ga0157370_10037013 Ga0157370_100370133 307
144 3300013104 Ga0157370_10293308 Ga0157370_102933081 307
145 3300013104 Ga0157370_10330817 Ga0157370_103308172 307
146 3300013296 Ga0157374_10001402 Ga0157374_1000140213 307
147 3300013296 Ga0157374_10080646 Ga0157374_100806462 307
148 3300013297 Ga0157378_10072084 Ga0157378_100720843 307
149 3300013307 Ga0157372_10001845 Ga0157372_1000184520 307
150 3300013307 Ga0157372_10243474 Ga0157372_102434741 307
151 3300013307 Ga0157372_10653047 Ga0157372_106530471 307
152 3300013308 Ga0157375_10001434 Ga0157375_1000143416 307
153 3300013308 Ga0157375_10039060 Ga0157375_100390601 307
154 3300014969 Ga0157376_10006033 Ga0157376_100060336 307
155 3300014969 Ga0157376_10170146 Ga0157376_101701462 307
156 3300025231 Ga0207427_101613 Ga0207427_1016139 307
157 3300025250 Ga0209026_1006099 Ga0209026_10060992 307
158 3300025261 Ga0209233_1000041 Ga0209233_1000041432 307
159 3300025261 Ga0209233_1000278 Ga0209233_10002782 307
160 3300025263 Ga0209565_1000245 Ga0209565_100024528 307
161 3300025263 Ga0209565_1000264 Ga0209565_100026434 307
162 3300025273 Ga0209673_1002400 Ga0209673_100240013 307
163 3300025291 Ga0209675_1000126 Ga0209675_100012696 307
164 3300025291 Ga0209675_1001955 Ga0209675_10019552 307
165 3300025292 Ga0209676_1000288 Ga0209676_100028880 307
166 3300025292 Ga0209676_1000566 Ga0209676_100056623 307
167 3300025292 Ga0209676_1000824 Ga0209676_10008243 307
168 3300025292 Ga0209676_1001055 Ga0209676_100105512 307
169 3300025294 Ga0209025_1007766 Ga0209025_10077669 307
170 3300025295 Ga0209564_1000378 Ga0209564_100037852 307
171 3300025295 Ga0209564_1001239 Ga0209564_100123918 307
172 3300025298 Ga0209050_1000001 Ga0209050_10000011550 307
173 3300025298 Ga0209050_1000042 Ga0209050_1000042202 307
174 3300025298 Ga0209050_1000042 Ga0209050_100004241 307
175 3300025298 Ga0209050_1001634 Ga0209050_100163423 307
176 3300025298 Ga0209050_1002864 Ga0209050_10028641 307
177 3300025303 Ga0209051_1000209 Ga0209051_100020924 307
178 3300025304 Ga0209257_1000111 Ga0209257_1000111102 307
179 3300025304 Ga0209257_1000826 Ga0209257_10008264 307
180 3300025304 Ga0209257_1001744 Ga0209257_10017445 307
181 3300025304 Ga0209257_1002880 Ga0209257_10028804 307
182 3300025315 Ga0207697_10004536 Ga0207697_100045362 307
183 3300025321 Ga0207656_10066260 Ga0207656_100662601 307
184 3300025711 Ga0207696_1002099 Ga0207696_100209911 307
185 3300025903 Ga0207680_10129031 Ga0207680_101290313 307
186 3300025903 Ga0207680_10219424 Ga0207680_102194241 307
187 3300025904 Ga0207647_10000393 Ga0207647_100003932 307
188 3300025904 Ga0207647_10042722 Ga0207647_100427223 307
189 3300025904 Ga0207647_10061867 Ga0207647_100618674 307
190 3300025904 Ga0207647_10135406 Ga0207647_101354062 307
191 3300025904 Ga0207647_10142014 Ga0207647_101420142 307
192 3300025907 Ga0207645_10006527 Ga0207645_100065279 307
193 3300025907 Ga0207645_10013297 Ga0207645_100132973 307
194 3300025909 Ga0207705_10018814 Ga0207705_100188144 307
195 3300025909 Ga0207705_10026824 Ga0207705_100268241 307
196 3300025909 Ga0207705_10081175 Ga0207705_100811751 307
197 3300025909 Ga0207705_10106538 Ga0207705_101065382 307
198 3300025913 Ga0207695_10004085 Ga0207695_100040856 307
199 3300025913 Ga0207695_10007311 Ga0207695_1000731111 307
200 3300025913 Ga0207695_10120020 Ga0207695_101200202 307
201 3300025914 Ga0207671_10037382 Ga0207671_100373823 307
202 3300025914 Ga0207671_10053796 Ga0207671_100537963 307
203 3300025914 Ga0207671_10073221 Ga0207671_100732213 307
204 3300025914 Ga0207671_10198498 Ga0207671_101984982 307
205 3300025917 Ga0207660_10331961 Ga0207660_103319611 307
206 3300025919 Ga0207657_10124921 Ga0207657_101249212 307
207 3300025920 Ga0207649_10250401 Ga0207649_102504011 307
208 3300025923 Ga0207681_10023900 Ga0207681_100239003 307
209 3300025924 Ga0207694_10040564 Ga0207694_100405642 307
210 3300025925 Ga0207650_10055524 Ga0207650_100555244 307
211 3300025925 Ga0207650_10315219 Ga0207650_103152192 307
212 3300025927 Ga0207687_10301653 Ga0207687_103016532 307
213 3300025931 Ga0207644_10010430 Ga0207644_100104302 307
214 3300025932 Ga0207690_10004259 Ga0207690_100042597 307
215 3300025932 Ga0207690_10030393 Ga0207690_100303933 307
216 3300025932 Ga0207690_10040580 Ga0207690_100405801 307
217 3300025932 Ga0207690_10163212 Ga0207690_101632122 307
218 3300025932 Ga0207690_10380032 Ga0207690_103800321 307
219 3300025933 Ga0207706_10017389 Ga0207706_100173893 307
220 3300025933 Ga0207706_10174143 Ga0207706_101741431 307
221 3300025934 Ga0207686_10000528 Ga0207686_1000052815 307
222 3300025934 Ga0207686_10002650 Ga0207686_100026503 307
223 3300025935 Ga0207709_10003603 Ga0207709_100036036 307
224 3300025941 Ga0207711_10051904 Ga0207711_100519042 307
225 3300025949 Ga0207667_10000013 Ga0207667_10000013298 307
226 3300025949 Ga0207667_10003476 Ga0207667_1000347619 307
227 3300025949 Ga0207667_10048014 Ga0207667_100480141 307
228 3300025949 Ga0207667_10071047 Ga0207667_100710475 307
229 3300025949 Ga0207667_10077749 Ga0207667_100777495 307
230 3300025949 Ga0207667_10277082 Ga0207667_102770822 307
231 3300025960 Ga0207651_10000001 Ga0207651_1000000132 307
232 3300025960 Ga0207651_10000010 Ga0207651_1000001078 307
233 3300025960 Ga0207651_10092766 Ga0207651_100927661 307
234 3300025960 Ga0207651_10277861 Ga0207651_102778612 307
235 3300025972 Ga0207668_10175464 Ga0207668_101754642 307
236 3300025981 Ga0207640_10000073 Ga0207640_1000007361 307
237 3300025986 Ga0207658_10007495 Ga0207658_100074955 307
238 3300026023 Ga0207677_10000021 Ga0207677_1000002190 307
239 3300026041 Ga0207639_10174001 Ga0207639_101740012 307
240 3300026041 Ga0207639_10193916 Ga0207639_101939161 307
241 3300026067 Ga0207678_10033658 Ga0207678_100336585 307
242 3300026067 Ga0207678_10051868 Ga0207678_100518686 307
243 3300026067 Ga0207678_10333972 Ga0207678_103339721 307
244 3300026078 Ga0207702_10005705 Ga0207702_100057057 307
245 3300026088 Ga0207641_10053237 Ga0207641_100532372 307
246 3300026089 Ga0207648_10002352 Ga0207648_100023526 307
247 3300026089 Ga0207648_10014061 Ga0207648_100140616 307
248 3300026095 Ga0207676_10006948 Ga0207676_1000694810 307
249 3300026095 Ga0207676_10136196 Ga0207676_101361963 307
250 3300026116 Ga0207674_10003309 Ga0207674_100033092 307
251 3300026116 Ga0207674_10057272 Ga0207674_100572723 307
252 3300026116 Ga0207674_10059699 Ga0207674_100596993 307
253 3300026116 Ga0207674_10291613 Ga0207674_102916132 307
254 3300026142 Ga0207698_10098243 Ga0207698_100982433 307
255 3300027665 Ga0209983_1023341 Ga0209983_10233412 307
256 3300027876 Ga0209974_10013935 Ga0209974_100139353 307
257 3300028379 Ga0268266_10008096 Ga0268266_100080961 307
258 3300028379 Ga0268266_10391823 Ga0268266_103918231 307
259 3300031911 Ga0307412_10001873 Ga0307412_1000187310 307
260 3300031911 Ga0307412_10003692 Ga0307412_100036923 307
261 3300031911 Ga0307412_10051185 Ga0307412_100511855 307
262 3300032004 Ga0307414_10000091 Ga0307414_100000916 307
263 3300037312 Ga0395899_0000165 Ga0395899_0000165_99843_100766 307
264 3300037312 Ga0395899_0018349 Ga0395899_0018349_3585_4508 307
265 3300037418 Ga0395900_0000471 Ga0395900_0000471_32392_33315 307
266 3300037418 Ga0395900_0021321 Ga0395900_0021321_4734_5657 307
267 3300037418 Ga0395900_0028415 Ga0395900_0028415_4313_5236 307
268 3300037418 Ga0395900_0054141 Ga0395900_0054141_930_1853 307
269 3300037418 Ga0395900_0057890 Ga0395900_0057890_969_1892 307
270 3300037466 Ga0395898_0021486 Ga0395898_0021486_3711_4634 307
271 3300037466 Ga0395898_0108548 Ga0395898_0108548_1597_2520 307
272 3300037471 Ga0395905_0007466 Ga0395905_0007466_7693_8616 307
273 3300037471 Ga0395905_0026436 Ga0395905_0026436_2427_3350 307
274 3300037471 Ga0395905_0070288 Ga0395905_0070288_501_1424 307
275 3300037471 Ga0395905_0127900 Ga0395905_0127900_1339_2262 307
276 3300037471 Ga0395905_0178149 Ga0395905_0178149_799_1722 307
277 3300038443 Ga0395901_0000064 Ga0395901_0000064_89125_90048 307
278 3300038443 Ga0395901_0003751 Ga0395901_0003751_6474_7397 307
279 3300038443 Ga0395901_0021308 Ga0395901_0021308_4570_5493 307
280 3300038443 Ga0395901_0088592 Ga0395901_0088592_2231_3154 307
281 3300038443 Ga0395901_0202219 Ga0395901_0202219_476_1399 307
282 3300038443 Ga0395901_0214274 Ga0395901_0214274_602_1525 307
283 3300038443 Ga0395901_0234293 Ga0395901_0234293_132_1055 307
284 3300038705 Ga0237819_00523 Ga0237819_00523_9415_10344 307
285 3300042012 Ga0439455_0014051 Ga0439455_0014051_168_1172 307
286 3300045976 Ga0466967_0104007 Ga0466967_0104007_1498_2421 307
287 3300046530 Ga0495654_0003117 Ga0495654_0003117_4664_5587 307
288 3300046691 Ga0495670_0000008 Ga0495670_0000008_114486_115409 307
289 3300046691 Ga0495670_0000042 Ga0495670_0000042_57022_57945 307
290 3300048911 Ga0496108_0064704 Ga0496108_0064704_358_1281 307
291 3300048912 Ga0496109_0188193 Ga0496109_0188193_913_1842 307
292 3300048915 Ga0496112_0004504 Ga0496112_0004504_8365_9288 307
293 3300048915 Ga0496112_0039275 Ga0496112_0039275_286_1209 307
294 3300048916 Ga0496113_0178451 Ga0496113_0178451_740_1663 307
295 3300048918 Ga0496115_0001733 Ga0496115_0001733_9195_10118 307
296 3300048918 Ga0496115_0002755 Ga0496115_0002755_2782_3705 307
297 3300048919 Ga0496116_0128271 Ga0496116_0128271_183_1112 307
298 3300048924 Ga0496121_0010848 Ga0496121_0010848_8013_8978 307
299 3300048924 Ga0496121_0110159 Ga0496121_0110159_1022_1951 307
300 3300048925 Ga0496122_0038478 Ga0496122_0038478_886_1809 307
301 3300048925 Ga0496122_0190925 Ga0496122_0190925_240_1166 307
302 3300048926 Ga0496123_0017409 Ga0496123_0017409_3728_4651 307
303 3300048926 Ga0496123_0062173 Ga0496123_0062173_51_977 307
304 3300048926 Ga0496123_0150750 Ga0496123_0150750_115_1038 307
305 3300048927 Ga0496124_0000501 Ga0496124_0000501_10937_11860 307
306 3300048927 Ga0496124_0002194 Ga0496124_0002194_17010_17933 307
307 3300048927 Ga0496124_0003757 Ga0496124_0003757_15553_16476 307
308 3300048927 Ga0496124_0008526 Ga0496124_0008526_6807_7730 307
309 3300048927 Ga0496124_0023610 Ga0496124_0023610_2297_3220 307
310 3300048927 Ga0496124_0064037 Ga0496124_0064037_279_1202 307
311 3300048927 Ga0496124_0095966 Ga0496124_0095966_223_1146 307
312 3300048927 Ga0496124_0104573 Ga0496124_0104573_1322_2245 307
313 3300048928 Ga0496125_0083773 Ga0496125_0083773_431_1360 307
314 3300048928 Ga0496125_0097176 Ga0496125_0097176_705_1628 307
315 3300048928 Ga0496125_0116031 Ga0496125_0116031_864_1787 307
316 3300048929 Ga0496126_0045987 Ga0496126_0045987_1140_2063 307
317 3300049569 Ga0501032_0100058 Ga0501032_0100058_669_1595 307
318 3300049570 Ga0501033_0000573 Ga0501033_0000573_12300_13226 307
319 3300049571 Ga0501034_0001427 Ga0501034_0001427_29007_29933 307
320 3300049572 Ga0501036_0240673 Ga0501036_0240673_307_1233 307
321 3300049573 Ga0501037_0047447 Ga0501037_0047447_736_1662 307
322 3300049579 Ga0501043_0021961 Ga0501043_0021961_3978_4904 307
323 3300049581 Ga0501047_0035515 Ga0501047_0035515_2802_3728 307
324 3300049581 Ga0501047_0041886 Ga0501047_0041886_2420_3346 307
325 3300049653 Ga0501206_006465 Ga0501206_006465_14_943 307
326 3300049670 Ga0501236_003981 Ga0501236_003981_579_1508 307
327 3300049705 Ga0501225_0015024 Ga0501225_0015024_380_1309 307
328 3300049822 Ga0501035_0011778 Ga0501035_0011778_3770_4696 307
329 3300049823 Ga0501044_0000949 Ga0501044_0000949_21563_22489 307
330 3300049823 Ga0501044_0020396 Ga0501044_0020396_1491_2417 307
331 3300053087 Ga0500643_015568 Ga0500643_015568_1586_2512 307
332 3300053094 Ga0500566_0000595 Ga0500566_0000595_3019_3942 307
333 3300053140 Ga0500573_0000021 Ga0500573_0000021_71781_72704 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18765

Polbeta

Polymerase beta, Nucleotidyltransferase

61

148

0.9

PF05168

HEPN

HEPN domain

195

320

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.9806 156 296
4nqf-assembly1.cif.gz_A crystal structure of hepn domain protein 0.9475 156 296
2hsb-assembly1.cif.gz_A crystal structure of a hepn domain containing protein (af_0298) from archaeoglobus fulgidus at 1.95 a resolution 0.7603 168 295
3o10-assembly2.cif.gz_C crystal structure of the hepn domain from human sacsin 0.7262 156 295
1o3u-assembly1.cif.gz_A-2 crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 a resolution 0.7227 172 292
ID Description Score Start End Superfamily
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.9755 156 296 1.20.120.330
4nqfA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.942 156 296 1.20.120.330
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.811 166 295 1.20.120.330
af_Q58022_9_132_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7949 166 295 1.20.120.330
2hsbA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.741 168 295 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A2N3B7A4-F1-model_v4 Nucleotidyltransferase 1.001 200 306 GO:0016740
AF-A0A4V6NHZ9-F1-model_v4 HEPN domain-containing protein 0.9981 164 303
AF-A0A7Y9VNN5-F1-model_v4 deleted 0.992 193 306
AF-A0A4Q3B9D5-F1-model_v4 deleted 0.9904 116 306
AF-A0A807CJ87-F1-model_v4 deleted 0.9889 191 306

Feature Viewer

pLDDT pTM Quality
89.93 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map