F411412

General Info

Members Datasets Scaffolds Average Seq Length
333 168 666 379

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10028237|Ga0265325_100282373
Length 405
Sequence MVLAIGQKARRQDAGATKMTTEKNRLRVGVLFGGRSGEHEVSLVSAASVIQALDPEKYEAVPIGITKEGRWLAGPAANKMLPPPTNKTLGEVLLKGDRVMLSADPTVTTLVPVGAPRSDETMRLDVIFPVLHGTFGEDGTVQGLLDLAGVPYVGSGVVGSSVGMDKDMSKRLWLQAKLPVGDYLAILRAEWEKSRTKVQRAIQKKFRFPVFVKPATLGSSVGMTKAHDAKELAKAMDFAGEFAQKILVEKTIKGREIELSVLGNDNPKASIPGEIVPHREFYDYAAKYLEEGTRLLIPAKLTRAQIKKFQEYAVRAFRALECLGMARVDFFLEHRTNRIYLNEINTIPGFTSISMYPKLWEASGLPYRDLLSRLIELALEQHREKLRTKYTIELPAGTTPGSLEG

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10028237 3300031241 Bacteria 3026
2 rootH1_10072129 3300003323 Bacteria 6114
3 JGI25407J50210_10014435 3300003373 Bacteria 2035
4 Ga0070689_100065687 3300005340 Bacteria 2826
5 Ga0070674_100107348 3300005356 Bacteria 2044
6 Ga0070709_10009232 3300005434 Bacteria 5430
7 Ga0070709_10070681 3300005434 Bacteria 2250
8 Ga0070709_10077122 3300005434 Bacteria 2166
9 Ga0070714_100138569 3300005435 Bacteria 2181
10 Ga0070714_100298508 3300005435 Bacteria 1501
11 Ga0070713_100041764 3300005436 Bacteria 3739
12 Ga0070711_100199306 3300005439 Bacteria 1544
13 Ga0070705_100001850 3300005440 Bacteria 10909
14 Ga0070708_100006879 3300005445 Bacteria 9075
15 Ga0070708_100011760 3300005445 Bacteria 7121
16 Ga0070708_100158684 3300005445 Archaea 2107
17 Ga0070708_100213888 3300005445 Bacteria 1807
18 Ga0070662_100063262 3300005457 Bacteria 2706
19 Ga0070706_100002524 3300005467 Bacteria 18411
20 Ga0070706_100054258 3300005467 Bacteria 3699
21 Ga0070707_100000122 3300005468 Bacteria 72981
22 Ga0070707_100001215 3300005468 Bacteria 25370
23 Ga0070707_100019714 3300005468 Bacteria 6357
24 Ga0070707_100078184 3300005468 Bacteria 3192
25 Ga0070707_100322804 3300005468 Bacteria 1500
26 Ga0070698_100000471 3300005471 Bacteria 42715
27 Ga0070698_100004151 3300005471 Bacteria 15932
28 Ga0070698_100056481 3300005471 Bacteria 3978
29 Ga0070699_100013946 3300005518 Bacteria 6913
30 Ga0070699_100173422 3300005518 Bacteria 1912
31 Ga0070697_100001835 3300005536 Bacteria 16237
32 Ga0070697_100110082 3300005536 Unclassified 2294
33 Ga0070686_100109155 3300005544 Bacteria 1882
34 Ga0070695_100012596 3300005545 Bacteria 5078
35 Ga0070695_100104525 3300005545 Bacteria 1912
36 Ga0070693_100000780 3300005547 Bacteria 14052
37 Ga0070665_100000918 3300005548 Bacteria 37791
38 Ga0070704_100005482 3300005549 Bacteria 7396
39 Ga0070704_100021668 3300005549 Bacteria 4171
40 Ga0068855_100117117 3300005563 Bacteria 3053
41 Ga0068864_100304514 3300005618 Bacteria 1493
42 Ga0068863_100025882 3300005841 Bacteria 5598
43 Ga0068858_100178632 3300005842 Bacteria 2004
44 Ga0068860_100020728 3300005843 Bacteria 6368
45 Ga0068860_100140588 3300005843 Unclassified 2320
46 Ga0081538_10015975 3300005981 Bacteria 5782
47 Ga0081538_10110727 3300005981 Bacteria 1349
48 Ga0070717_10185251 3300006028 Bacteria 1816
49 Ga0070715_10015831 3300006163 Bacteria 2820
50 Ga0070716_100000504 3300006173 Bacteria 16259
51 Ga0070716_100003702 3300006173 Bacteria 7237
52 Ga0070716_100015672 3300006173 Bacteria 3900
53 Ga0070716_100055220 3300006173 Bacteria 2272
54 Ga0070716_100088318 3300006173 Bacteria 1870
55 Ga0070716_100093059 3300006173 Bacteria 1829
56 Ga0070712_100078493 3300006175 Bacteria 2384
57 Ga0097621_100033494 3300006237 Bacteria 4092
58 Ga0075433_10185813 3300006852 Bacteria 1849
59 Ga0075434_100001285 3300006871 Bacteria 20928
60 Ga0075434_100018800 3300006871 Bacteria 6678
61 Ga0075434_100189832 3300006871 Bacteria 2075
62 Ga0068865_100286296 3300006881 Bacteria 1314
63 Ga0075436_100000983 3300006914 Archaea 19120
64 Ga0075435_100023833 3300007076 Bacteria 4740
65 Ga0099794_10001545 3300007265 Bacteria 8108
66 Ga0099794_10006956 3300007265 Bacteria 4612
67 Ga0099794_10018733 3300007265 Bacteria 3107
68 Ga0099795_10041067 3300007788 Bacteria 1646
69 Ga0105240_10063373 3300009093 Bacteria 4599
70 Ga0105245_10115102 3300009098 Bacteria 2505
71 Ga0114129_10171679 3300009147 Bacteria 2956
72 Ga0105243_10163397 3300009148 Bacteria 1922
73 Ga0105242_10032571 3300009176 Bacteria 4168
74 Ga0105242_10047621 3300009176 Bacteria 3482
75 Ga0105242_10169166 3300009176 Bacteria 1919
76 Ga0105248_10107107 3300009177 Bacteria 3152
77 Ga0105237_10046358 3300009545 Bacteria 4372
78 Ga0105237_10134301 3300009545 Bacteria 2469
79 Ga0099796_10000577 3300010159 Bacteria 6331
80 Ga0157370_10112778 3300013104 Bacteria 2541
81 Ga0157378_10000323 3300013297 Bacteria 47134
82 Ga0157378_10002951 3300013297 Bacteria 15127
83 Ga0157378_10066010 3300013297 Bacteria 3240
84 Ga0163163_10181826 3300014325 Bacteria 2150
85 Ga0157379_10076291 3300014968 Bacteria 3001
86 Ga0157379_10215653 3300014968 Bacteria 1738
87 Ga0157376_10000041 3300014969 Bacteria 120988
88 Ga0157376_10020066 3300014969 Bacteria 5163
89 Ga0207699_10001934 3300025906 Bacteria 9756
90 Ga0207699_10013623 3300025906 Bacteria 4168
91 Ga0207699_10022370 3300025906 Bacteria 3424
92 Ga0207684_10005895 3300025910 Bacteria 11223
93 Ga0207671_10093561 3300025914 Bacteria 2267
94 Ga0207693_10137419 3300025915 Bacteria 1922
95 Ga0207663_10027934 3300025916 Bacteria 3295
96 Ga0207663_10147230 3300025916 Bacteria 1648
97 Ga0207646_10000178 3300025922 Bacteria 86727
98 Ga0207646_10000246 3300025922 Bacteria 74117
99 Ga0207646_10007292 3300025922 Bacteria 11265
100 Ga0207646_10058781 3300025922 Bacteria 3434
101 Ga0207700_10033758 3300025928 Bacteria 3665
102 Ga0207700_10048695 3300025928 Bacteria 3148
103 Ga0207706_10177896 3300025933 Bacteria 1869
104 Ga0207686_10228971 3300025934 Bacteria 1346
105 Ga0207704_10104417 3300025938 Bacteria 1898
106 Ga0207665_10000310 3300025939 Bacteria 33756
107 Ga0207665_10022802 3300025939 Bacteria 4120
108 Ga0207665_10024081 3300025939 Bacteria 4012
109 Ga0207665_10025118 3300025939 Bacteria 3930
110 Ga0207665_10074000 3300025939 Bacteria 2331
111 Ga0207665_10124781 3300025939 Bacteria 1822
112 Ga0207641_10008737 3300026088 Bacteria 8369
113 Ga0209588_1004001 3300027671 Bacteria 4124
114 Ga0265354_1000800 3300028016 Bacteria 5115
115 Ga0268266_10000144 3300028379 Bacteria 135508
116 Ga0268264_10034406 3300028381 Bacteria 4168
117 Ga0265337_1001369 3300028556 Bacteria 12004
118 Ga0265319_1000067 3300028563 Bacteria 82947
119 Ga0265319_1000114 3300028563 Bacteria 61495
120 Ga0265319_1000229 3300028563 Bacteria 42103
121 Ga0265319_1012348 3300028563 Bacteria 3458
122 Ga0265318_10000111 3300028577 Bacteria 75372
123 Ga0265318_10002156 3300028577 Bacteria 10680
124 Ga0265323_10000269 3300028653 Bacteria 30543
125 Ga0265322_10000274 3300028654 Bacteria 21951
126 Ga0265322_10000573 3300028654 Bacteria 14005
127 Ga0265322_10004210 3300028654 Bacteria 4308
128 Ga0265336_10000067 3300028666 Bacteria 93268
129 Ga0265338_10000126 3300028800 Bacteria 140495
130 Ga0265338_10004297 3300028800 Bacteria 19344
131 Ga0265338_10004392 3300028800 Bacteria 19073
132 Ga0265338_10008463 3300028800 Bacteria 12487
133 Ga0265338_10260447 3300028800 Bacteria 1275
134 Ga0265324_10000469 3300029957 Bacteria 28377
135 Ga0265324_10005093 3300029957 Bacteria 5752
136 Ga0265324_10045530 3300029957 Bacteria 1511
137 Ga0265770_1000158 3300030878 Bacteria 8597
138 Ga0265765_1000431 3300030879 Bacteria 3239
139 Ga0265760_10000031 3300031090 Bacteria 52116
140 Ga0265760_10018408 3300031090 Bacteria 2012
141 Ga0265760_10019640 3300031090 Bacteria 1947
142 Ga0265760_10040321 3300031090 Bacteria 1391
143 Ga0265330_10000150 3300031235 Bacteria 56333
144 Ga0265330_10001638 3300031235 Bacteria 12749
145 Ga0265330_10027926 3300031235 Bacteria 2547
146 Ga0265332_10000306 3300031238 Bacteria 37911
147 Ga0265332_10004075 3300031238 Bacteria 6934
148 Ga0265328_10002963 3300031239 Bacteria 7580
149 Ga0265320_10000087 3300031240 Bacteria 77435
150 Ga0265320_10000275 3300031240 Bacteria 42230
151 Ga0265320_10010778 3300031240 Bacteria 5418
152 Ga0265325_10002204 3300031241 Bacteria 13222
153 Ga0265325_10012319 3300031241 Bacteria 4892
154 Ga0265325_10027396 3300031241 Bacteria 3080
155 Ga0265325_10078637 3300031241 Bacteria 1643
156 Ga0265329_10000111 3300031242 Bacteria 38630
157 Ga0265329_10000181 3300031242 Bacteria 32113
158 Ga0265340_10019080 3300031247 Bacteria 3531
159 Ga0265340_10084866 3300031247 Bacteria 1486
160 Ga0265339_10000097 3300031249 Bacteria 73931
161 Ga0265339_10002441 3300031249 Bacteria 13320
162 Ga0265339_10013157 3300031249 Bacteria 5023
163 Ga0265331_10000169 3300031250 Bacteria 80399
164 Ga0265331_10000322 3300031250 Bacteria 51785
165 Ga0265331_10001601 3300031250 Bacteria 16532
166 Ga0265316_10000220 3300031344 Bacteria 66743
167 Ga0265316_10001497 3300031344 Bacteria 25056
168 Ga0265316_10010799 3300031344 Bacteria 8297
169 Ga0265316_10040344 3300031344 Bacteria 3742
170 Ga0265316_10063668 3300031344 Bacteria 2859
171 Ga0265316_10129573 3300031344 Bacteria 1901
172 Ga0307408_100216589 3300031548 Bacteria 1560
173 Ga0265313_10006919 3300031595 Bacteria 7878
174 Ga0265314_10000337 3300031711 Bacteria 65738
175 Ga0265314_10015394 3300031711 Bacteria 6072
176 Ga0265342_10000435 3300031712 Bacteria 45794
177 Ga0265342_10000999 3300031712 Bacteria 27871
178 Ga0265342_10001401 3300031712 Bacteria 22534
179 Ga0265342_10083439 3300031712 Bacteria 1842
180 Ga0307405_10149283 3300031731 Bacteria 1641
181 Ga0307413_10263569 3300031824 Bacteria 1286
182 Ga0307406_10181547 3300031901 Bacteria 1532
183 Ga0307416_100042830 3300032002 Bacteria 3538
184 Ga0307415_100023485 3300032126 Bacteria 3828
185 Ga0307415_100076603 3300032126 Bacteria 2372
186 Ga0373926_0001671 3300035083 Bacteria 6858
187 Ga0373934_0000856 3300035086 Bacteria 11032
188 Ga0373923_0014762 3300035111 Bacteria 2940
189 Ga0373954_0003370 3300035118 Bacteria 6762
190 Ga0373956_0001904 3300035119 Bacteria 8611
191 Ga0373956_0003575 3300035119 Bacteria 6269
192 Ga0373957_0026017 3300035120 Bacteria 2113
193 Ga0373955_0002782 3300035172 Bacteria 7678
194 Ga0373931_0037559 3300035691 Bacteria 2529
195 Ga0373935_0010802 3300035692 Bacteria 5485
196 Ga0373927_0013165 3300035695 Bacteria 5501
197 Ga0373933_0000442 3300035724 Bacteria 25948
198 Ga0373933_0005548 3300035724 Bacteria 6874
199 Ga0373937_0000008 3300036401 Bacteria 170075
200 Ga0373937_0000741 3300036401 Bacteria 28141
201 Ga0373937_0016459 3300036401 Bacteria 6569
202 Ga0373937_0082812 3300036401 Bacteria 2968
203 Ga0373925_0181296 3300037068 Bacteria 1667
204 Ga0395898_0261868 3300037466 Bacteria 1649
205 Ga0395901_0111983 3300038443 Bacteria 2866
206 Ga0451853_3508435 3300041512 Bacteria 2112
207 Ga0451577_0000439 3300042876 Bacteria 73641
208 Ga0451577_0000575 3300042876 Bacteria 59390
209 Ga0451577_0025182 3300042876 Bacteria 5400
210 Ga0451577_0158889 3300042876 Bacteria 2035
211 Ga0466969_0027836 3300044656 Bacteria 2892
212 Ga0466972_0022305 3300044658 Bacteria 3153
213 Ga0453683_0001419 3300044673 Bacteria 20834
214 Ga0453683_0003430 3300044673 Bacteria 11686
215 Ga0453683_0004520 3300044673 Bacteria 9849
216 Ga0453683_0004822 3300044673 Bacteria 9497
217 Ga0453683_0009288 3300044673 Bacteria 6572
218 Ga0453683_0091488 3300044673 Bacteria 1907
219 Ga0466965_0002465 3300044683 Bacteria 7871
220 Ga0453684_0000039 3300044712 Bacteria 697730
221 Ga0453684_0004217 3300044712 Bacteria 30872
222 Ga0453684_0020701 3300044712 Bacteria 9899
223 Ga0453684_0030282 3300044712 Bacteria 7650
224 Ga0453684_0068647 3300044712 Bacteria 4500
225 Ga0453684_0355957 3300044712 Bacteria 1649
226 Ga0466968_0000254 3300044735 Bacteria 16913
227 Ga0466960_0000423 3300044901 Bacteria 14551
228 Ga0466959_0020387 3300045049 Bacteria 4884
229 Ga0451576_0023690 3300045051 Bacteria 6643
230 Ga0451576_0030394 3300045051 Bacteria 5773
231 Ga0451576_0048912 3300045051 Bacteria 4439
232 Ga0451576_0086026 3300045051 Bacteria 3270
233 Ga0495592_0027169 3300046454 Bacteria 4339
234 Ga0495651_0001179 3300046462 Bacteria 20176
235 Ga0495651_0004183 3300046462 Bacteria 11055
236 Ga0495651_0005645 3300046462 Bacteria 9534
237 Ga0495651_0012503 3300046462 Bacteria 6547
238 Ga0495653_0022903 3300046463 Bacteria 5052
239 Ga0495653_0052206 3300046463 Bacteria 3134
240 Ga0495580_0000914 3300046472 Bacteria 25743
241 Ga0495580_0149393 3300046472 Bacteria 1619
242 Ga0495582_0000192 3300046473 Bacteria 33815
243 Ga0495662_0011372 3300046476 Unclassified 4350
244 Ga0495664_0129266 3300046477 Bacteria 1529
245 Ga0495608_0001324 3300046511 Bacteria 17643
246 Ga0495608_0023276 3300046511 Bacteria 4247
247 Ga0495608_0031357 3300046511 Bacteria 3594
248 Ga0495608_0060104 3300046511 Bacteria 2501
249 Ga0495618_0019666 3300046514 Bacteria 4156
250 Ga0495618_0046940 3300046514 Bacteria 2726
251 Ga0495618_0065354 3300046514 Bacteria 2312
252 Ga0495628_0001969 3300046516 Bacteria 18613
253 Ga0495628_0017824 3300046516 Bacteria 5895
254 Ga0495628_0024363 3300046516 Bacteria 4954
255 Ga0495652_0002539 3300046529 Bacteria 18711
256 Ga0495652_0021445 3300046529 Bacteria 5743
257 Ga0495665_0001446 3300046531 Bacteria 12722
258 Ga0495640_0038061 3300046533 Bacteria 3386
259 Ga0495587_0000066 3300046536 Bacteria 87398
260 Ga0495587_0004845 3300046536 Bacteria 8832
261 Ga0495587_0008428 3300046536 Bacteria 6627
262 Ga0495587_0028448 3300046536 Bacteria 3399
263 Ga0495587_0058781 3300046536 Bacteria 2258
264 Ga0495645_0015665 3300046543 Bacteria 5394
265 Ga0495645_0078707 3300046543 Bacteria 2369
266 Ga0495667_0000891 3300046559 Bacteria 19311
267 Ga0495667_0005475 3300046559 Bacteria 8578
268 Ga0495667_0015995 3300046559 Bacteria 5070
269 Ga0495667_0042139 3300046559 Bacteria 3027
270 Ga0495667_0116832 3300046559 Bacteria 1723
271 Ga0495634_0066952 3300046642 Bacteria 2377
272 Ga0495635_0011185 3300046663 Bacteria 6291
273 Ga0495635_0022504 3300046663 Bacteria 4390
274 Ga0495635_0123828 3300046663 Bacteria 1763
275 Ga0495657_0007460 3300046675 Bacteria 8452
276 Ga0495657_0009396 3300046675 Bacteria 7414
277 Ga0495599_0132191 3300046678 Bacteria 1550
278 Ga0495599_0155633 3300046678 Bacteria 1414
279 Ga0495623_0000969 3300046679 Bacteria 19361
280 Ga0495623_0025625 3300046679 Bacteria 3799
281 Ga0495623_0049639 3300046679 Bacteria 2659
282 Ga0495623_0073679 3300046679 Bacteria 2122
283 Ga0495646_0003096 3300046680 Bacteria 10320
284 Ga0495646_0006050 3300046680 Bacteria 7672
285 Ga0495658_0024119 3300046683 Bacteria 3236
286 Ga0495613_0024122 3300046689 Bacteria 4533
287 Ga0495613_0034258 3300046689 Bacteria 3772
288 Ga0495600_0001305 3300046809 Bacteria 13756
289 Ga0495600_0076046 3300046809 Bacteria 2192
290 Ga0495600_0186882 3300046809 Bacteria 1334
291 Ga0495581_0228949 3300047315 Bacteria 1087
292 Ga0495604_0000840 3300047317 Bacteria 25663
293 Ga0495604_0010695 3300047317 Bacteria 7283
294 Ga0495604_0051958 3300047317 Bacteria 3175
295 Ga0495604_0068783 3300047317 Bacteria 2686
296 Ga0495604_0078601 3300047317 Bacteria 2475
297 Ga0495674_0012135 3300047319 Bacteria 8120
298 Ga0495674_0014998 3300047319 Bacteria 7252
299 Ga0495674_0020056 3300047319 Bacteria 6196
300 Ga0495674_0033052 3300047319 Bacteria 4689
301 Ga0495680_0000563 3300047322 Bacteria 41798
302 Ga0495680_0006117 3300047322 Bacteria 11240
303 Ga0495680_0035262 3300047322 Bacteria 4031
304 Ga0495675_0000371 3300047444 Bacteria 31063
305 Ga0495675_0002272 3300047444 Bacteria 11474
306 Ga0495675_0031112 3300047444 Bacteria 3407
307 Ga0495675_0102791 3300047444 Bacteria 1787
308 Ga0495675_0180439 3300047444 Bacteria 1293
309 Ga0495684_0003086 3300047471 Bacteria 13084
310 Ga0495684_0011434 3300047471 Bacteria 6854
311 Ga0495684_0021945 3300047471 Bacteria 4915
312 Ga0495684_0071955 3300047471 Bacteria 2627
313 Ga0495593_0007961 3300047673 Bacteria 6172
314 Ga0495602_0010037 3300048088 Bacteria 9829
315 Ga0495602_0013841 3300048088 Bacteria 8224
316 Ga0495602_0024590 3300048088 Bacteria 5843
317 Ga0495602_0028627 3300048088 Bacteria 5327
318 Ga0495602_0045610 3300048088 Bacteria 3965
319 Ga0495614_0009850 3300048089 Bacteria 4218
320 Ga0496102_0028685 3300048905 Bacteria 4973
321 Ga0496108_0000023 3300048911 Bacteria 186204
322 Ga0496114_0169772 3300048917 Bacteria 1901
323 Ga0496117_0000041 3300048920 Bacteria 317207
324 nmdc:mga0n895_117559_c1 3300050512 Bacteria 2678
325 nmdc:mga0n895_22776_c1 3300050512 Bacteria 5876
326 nmdc:mga0n895_68821_c1 3300050512 Bacteria 3507
327 nmdc:mga0rr50_56315_c1 3300050513 Bacteria 2937
328 nmdc:mga08x19_10414_c1 3300050514 Bacteria 5581
329 nmdc:mga08x19_226_c1 3300050514 Bacteria 43178
330 nmdc:mga0a205_176153_c1 3300050515 Bacteria 2034
331 nmdc:mga0a205_22948_c1 3300050515 Bacteria 2100
332 Ga0495612_0002804 3300053078 Bacteria 7207
333 Ga0495619_0093043 3300053085 Bacteria 2043
334 Ga0265325_10028237
335 rootH1_10072129
336 JGI25407J50210_10014435
337 Ga0070689_100065687
338 Ga0070674_100107348
339 Ga0070709_10009232
340 Ga0070709_10070681
341 Ga0070709_10077122
342 Ga0070714_100138569
343 Ga0070714_100298508
344 Ga0070713_100041764
345 Ga0070711_100199306
346 Ga0070705_100001850
347 Ga0070708_100006879
348 Ga0070708_100011760
349 Ga0070708_100158684
350 Ga0070708_100213888
351 Ga0070662_100063262
352 Ga0070706_100002524
353 Ga0070706_100054258
354 Ga0070707_100000122
355 Ga0070707_100001215
356 Ga0070707_100019714
357 Ga0070707_100078184
358 Ga0070707_100322804
359 Ga0070698_100000471
360 Ga0070698_100004151
361 Ga0070698_100056481
362 Ga0070699_100013946
363 Ga0070699_100173422
364 Ga0070697_100001835
365 Ga0070697_100110082
366 Ga0070686_100109155
367 Ga0070695_100012596
368 Ga0070695_100104525
369 Ga0070693_100000780
370 Ga0070665_100000918
371 Ga0070704_100005482
372 Ga0070704_100021668
373 Ga0068855_100117117
374 Ga0068864_100304514
375 Ga0068863_100025882
376 Ga0068858_100178632
377 Ga0068860_100020728
378 Ga0068860_100140588
379 Ga0081538_10015975
380 Ga0081538_10110727
381 Ga0070717_10185251
382 Ga0070715_10015831
383 Ga0070716_100000504
384 Ga0070716_100003702
385 Ga0070716_100015672
386 Ga0070716_100055220
387 Ga0070716_100088318
388 Ga0070716_100093059
389 Ga0070712_100078493
390 Ga0097621_100033494
391 Ga0075433_10185813
392 Ga0075434_100001285
393 Ga0075434_100018800
394 Ga0075434_100189832
395 Ga0068865_100286296
396 Ga0075436_100000983
397 Ga0075435_100023833
398 Ga0099794_10001545
399 Ga0099794_10006956
400 Ga0099794_10018733
401 Ga0099795_10041067
402 Ga0105240_10063373
403 Ga0105245_10115102
404 Ga0114129_10171679
405 Ga0105243_10163397
406 Ga0105242_10032571
407 Ga0105242_10047621
408 Ga0105242_10169166
409 Ga0105248_10107107
410 Ga0105237_10046358
411 Ga0105237_10134301
412 Ga0099796_10000577
413 Ga0157370_10112778
414 Ga0157378_10000323
415 Ga0157378_10002951
416 Ga0157378_10066010
417 Ga0163163_10181826
418 Ga0157379_10076291
419 Ga0157379_10215653
420 Ga0157376_10000041
421 Ga0157376_10020066
422 Ga0207699_10001934
423 Ga0207699_10013623
424 Ga0207699_10022370
425 Ga0207684_10005895
426 Ga0207671_10093561
427 Ga0207693_10137419
428 Ga0207663_10027934
429 Ga0207663_10147230
430 Ga0207646_10000178
431 Ga0207646_10000246
432 Ga0207646_10007292
433 Ga0207646_10058781
434 Ga0207700_10033758
435 Ga0207700_10048695
436 Ga0207706_10177896
437 Ga0207686_10228971
438 Ga0207704_10104417
439 Ga0207665_10000310
440 Ga0207665_10022802
441 Ga0207665_10024081
442 Ga0207665_10025118
443 Ga0207665_10074000
444 Ga0207665_10124781
445 Ga0207641_10008737
446 Ga0209588_1004001
447 Ga0265354_1000800
448 Ga0268266_10000144
449 Ga0268264_10034406
450 Ga0265337_1001369
451 Ga0265319_1000067
452 Ga0265319_1000114
453 Ga0265319_1000229
454 Ga0265319_1012348
455 Ga0265318_10000111
456 Ga0265318_10002156
457 Ga0265323_10000269
458 Ga0265322_10000274
459 Ga0265322_10000573
460 Ga0265322_10004210
461 Ga0265336_10000067
462 Ga0265338_10000126
463 Ga0265338_10004297
464 Ga0265338_10004392
465 Ga0265338_10008463
466 Ga0265338_10260447
467 Ga0265324_10000469
468 Ga0265324_10005093
469 Ga0265324_10045530
470 Ga0265770_1000158
471 Ga0265765_1000431
472 Ga0265760_10000031
473 Ga0265760_10018408
474 Ga0265760_10019640
475 Ga0265760_10040321
476 Ga0265330_10000150
477 Ga0265330_10001638
478 Ga0265330_10027926
479 Ga0265332_10000306
480 Ga0265332_10004075
481 Ga0265328_10002963
482 Ga0265320_10000087
483 Ga0265320_10000275
484 Ga0265320_10010778
485 Ga0265325_10002204
486 Ga0265325_10012319
487 Ga0265325_10027396
488 Ga0265325_10078637
489 Ga0265329_10000111
490 Ga0265329_10000181
491 Ga0265340_10019080
492 Ga0265340_10084866
493 Ga0265339_10000097
494 Ga0265339_10002441
495 Ga0265339_10013157
496 Ga0265331_10000169
497 Ga0265331_10000322
498 Ga0265331_10001601
499 Ga0265316_10000220
500 Ga0265316_10001497
501 Ga0265316_10010799
502 Ga0265316_10040344
503 Ga0265316_10063668
504 Ga0265316_10129573
505 Ga0307408_100216589
506 Ga0265313_10006919
507 Ga0265314_10000337
508 Ga0265314_10015394
509 Ga0265342_10000435
510 Ga0265342_10000999
511 Ga0265342_10001401
512 Ga0265342_10083439
513 Ga0307405_10149283
514 Ga0307413_10263569
515 Ga0307406_10181547
516 Ga0307416_100042830
517 Ga0307415_100023485
518 Ga0307415_100076603
519 Ga0373926_0001671
520 Ga0373934_0000856
521 Ga0373923_0014762
522 Ga0373954_0003370
523 Ga0373956_0001904
524 Ga0373956_0003575
525 Ga0373957_0026017
526 Ga0373955_0002782
527 Ga0373931_0037559
528 Ga0373935_0010802
529 Ga0373927_0013165
530 Ga0373933_0000442
531 Ga0373933_0005548
532 Ga0373937_0000008
533 Ga0373937_0000741
534 Ga0373937_0016459
535 Ga0373937_0082812
536 Ga0373925_0181296
537 Ga0395898_0261868
538 Ga0395901_0111983
539 Ga0451853_3508435
540 Ga0451577_0000439
541 Ga0451577_0000575
542 Ga0451577_0025182
543 Ga0451577_0158889
544 Ga0466969_0027836
545 Ga0466972_0022305
546 Ga0453683_0001419
547 Ga0453683_0003430
548 Ga0453683_0004520
549 Ga0453683_0004822
550 Ga0453683_0009288
551 Ga0453683_0091488
552 Ga0466965_0002465
553 Ga0453684_0000039
554 Ga0453684_0004217
555 Ga0453684_0020701
556 Ga0453684_0030282
557 Ga0453684_0068647
558 Ga0453684_0355957
559 Ga0466968_0000254
560 Ga0466960_0000423
561 Ga0466959_0020387
562 Ga0451576_0023690
563 Ga0451576_0030394
564 Ga0451576_0048912
565 Ga0451576_0086026
566 Ga0495592_0027169
567 Ga0495651_0001179
568 Ga0495651_0004183
569 Ga0495651_0005645
570 Ga0495651_0012503
571 Ga0495653_0022903
572 Ga0495653_0052206
573 Ga0495580_0000914
574 Ga0495580_0149393
575 Ga0495582_0000192
576 Ga0495662_0011372
577 Ga0495664_0129266
578 Ga0495608_0001324
579 Ga0495608_0023276
580 Ga0495608_0031357
581 Ga0495608_0060104
582 Ga0495618_0019666
583 Ga0495618_0046940
584 Ga0495618_0065354
585 Ga0495628_0001969
586 Ga0495628_0017824
587 Ga0495628_0024363
588 Ga0495652_0002539
589 Ga0495652_0021445
590 Ga0495665_0001446
591 Ga0495640_0038061
592 Ga0495587_0000066
593 Ga0495587_0004845
594 Ga0495587_0008428
595 Ga0495587_0028448
596 Ga0495587_0058781
597 Ga0495645_0015665
598 Ga0495645_0078707
599 Ga0495667_0000891
600 Ga0495667_0005475
601 Ga0495667_0015995
602 Ga0495667_0042139
603 Ga0495667_0116832
604 Ga0495634_0066952
605 Ga0495635_0011185
606 Ga0495635_0022504
607 Ga0495635_0123828
608 Ga0495657_0007460
609 Ga0495657_0009396
610 Ga0495599_0132191
611 Ga0495599_0155633
612 Ga0495623_0000969
613 Ga0495623_0025625
614 Ga0495623_0049639
615 Ga0495623_0073679
616 Ga0495646_0003096
617 Ga0495646_0006050
618 Ga0495658_0024119
619 Ga0495613_0024122
620 Ga0495613_0034258
621 Ga0495600_0001305
622 Ga0495600_0076046
623 Ga0495600_0186882
624 Ga0495581_0228949
625 Ga0495604_0000840
626 Ga0495604_0010695
627 Ga0495604_0051958
628 Ga0495604_0068783
629 Ga0495604_0078601
630 Ga0495674_0012135
631 Ga0495674_0014998
632 Ga0495674_0020056
633 Ga0495674_0033052
634 Ga0495680_0000563
635 Ga0495680_0006117
636 Ga0495680_0035262
637 Ga0495675_0000371
638 Ga0495675_0002272
639 Ga0495675_0031112
640 Ga0495675_0102791
641 Ga0495675_0180439
642 Ga0495684_0003086
643 Ga0495684_0011434
644 Ga0495684_0021945
645 Ga0495684_0071955
646 Ga0495593_0007961
647 Ga0495602_0010037
648 Ga0495602_0013841
649 Ga0495602_0024590
650 Ga0495602_0028627
651 Ga0495602_0045610
652 Ga0495614_0009850
653 Ga0496102_0028685
654 Ga0496108_0000023
655 Ga0496114_0169772
656 Ga0496117_0000041
657 nmdc:mga0n895_117559_c1
658 nmdc:mga0n895_22776_c1
659 nmdc:mga0n895_68821_c1
660 nmdc:mga0rr50_56315_c1
661 nmdc:mga08x19_10414_c1
662 nmdc:mga08x19_226_c1
663 nmdc:mga0a205_176153_c1
664 nmdc:mga0a205_22948_c1
665 Ga0495612_0002804
666 Ga0495619_0093043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

172

376

0.99

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

27

155

0.92

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

165

347

0.82

PF02222

ATP-grasp

ATP-grasp domain

174

348

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q1k-assembly2.cif.gz_C the crystal structure of the d-alanyl-alanine synthetase a from salmonella enterica typhimurium complexed with adp 0.9011 3 367
3q1k-assembly1.cif.gz_B the crystal structure of the d-alanyl-alanine synthetase a from salmonella enterica typhimurium complexed with adp 0.8968 3 367
7u56-assembly1.cif.gz_B crystal structure of d-alanine--d-alanine ligase from klebsiella pneumoniae subsp. pneumoniae in complex with amp 0.8915 4 361
3q1k-assembly2.cif.gz_C the crystal structure of the d-alanyl-alanine synthetase a from salmonella enterica typhimurium complexed with adp 0.891 3 367
3i12-assembly2.cif.gz_C the crystal structure of the d-alanyl-alanine synthetase a from salmonella enterica subsp. enterica serovar typhimurium str. lt2 0.8904 3 367
ID Description Score Start End Superfamily
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9466 131 364 3.30.470.20
3k3pB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9409 131 361 3.30.470.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9381 131 367 3.30.470.20
2yzgC02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9378 132 354 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9294 131 353 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A7X2ST90-F1-model_v4 D-alanine--D-alanine ligase 0.9417 218 362 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-I7C917-F1-model_v4 D-alanine--D-alanine ligase A (EC 6.3.2.4) (D-Ala-D-Ala ligase A) (D-alanylalanine synthetase A) 0.9404 241 361 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A378DKL8-F1-model_v4 deleted 0.9364 205 367
AF-A0A536SW86-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) 0.9352 205 358 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A496UGF4-F1-model_v4 D-alanine--D-alanine ligase A 0.933 218 356 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872

Map