F411408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 197 | 319 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300028794|Ga0307515_10142136|Ga0307515_101421362 |
| Length | 339 |
| Sequence | MSAAPGRPKQARTEAGGEGTPMSNARSPEGARTAAHQGEGSSADSRLFILELAAGRVFSVKPDGSDKRIIASDCRMPDGVVVNVKAGHVYWTSMGVLSRNDGSIERVDLDGRNHKTIIPQGATFTPKQLQLDRRNGKLYWCDREGMRVMRANLDGSVIETLVQTGSTEADRRDQTRWCVGIALDLARQQIYWTQKGPDNAGRGRILRAGIDIPRGESAESRSDIETLYDGLPEPIDLEIDHVKRILYWTDRGDPPLGNTVNRAPLDTVASGRPAPEIVFKNLMEGIGIALDRQGDRMFMTDLAGTVYSARLDGSTPSVVLFAQGNLTGIAYANLSLKDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 3 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 4 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 5 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 6 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 7 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 8 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 9 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 10 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 11 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 12 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 13 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 55 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 65 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 100 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 111 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 112 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 115 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 116 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 117 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 118 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 119 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 120 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 121 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 122 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 175 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 189 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 190 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 191 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 192 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 193 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 194 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 196 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 197 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.8 |
| Metatranscriptomes | 0 |
| Isolates | 4.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.91 |
| Nodule | 3.6 |
| Rhizoplane | 5.11 |
| Rhizosphere | 72.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000266 | 3300002987 | Bacteria | 24375 |
| 2 | JGI25406J46586_10012511 | 3300003203 | Bacteria | 3680 |
| 3 | rootH1_10076708 | 3300003323 | Bacteria | 3288 |
| 4 | JGI25160J50197_1000271 | 3300003354 | Bacteria | 38299 |
| 5 | JGI25161J50226_1000208 | 3300003374 | Bacteria | 38299 |
| 6 | JGI25404J52841_10000024 | 3300003659 | Bacteria | 12135 |
| 7 | JGI25404J52841_10002078 | 3300003659 | Bacteria | 3714 |
| 8 | JGI25404J52841_10022880 | 3300003659 | Bacteria | 1349 |
| 9 | Ga0055543_1000274 | 3300004625 | Bacteria | 38337 |
| 10 | Ga0065165_1001956 | 3300005262 | Bacteria | 19511 |
| 11 | Ga0065707_10090610 | 3300005295 | Bacteria | 4106 |
| 12 | Ga0065707_10090782 | 3300005295 | Bacteria | 4069 |
| 13 | Ga0070666_10017437 | 3300005335 | Bacteria | 4603 |
| 14 | Ga0070666_10028026 | 3300005335 | Bacteria | 3694 |
| 15 | Ga0070709_10004455 | 3300005434 | Bacteria | 7556 |
| 16 | Ga0070714_100290684 | 3300005435 | Bacteria | 1521 |
| 17 | Ga0070713_100329705 | 3300005436 | Bacteria | 1411 |
| 18 | Ga0070713_100473424 | 3300005436 | Bacteria | 1179 |
| 19 | Ga0070710_10018874 | 3300005437 | Bacteria | 3554 |
| 20 | Ga0070711_100385215 | 3300005439 | Bacteria | 1135 |
| 21 | Ga0070708_100188630 | 3300005445 | Bacteria | 1928 |
| 22 | Ga0070678_100019806 | 3300005456 | Bacteria | 4398 |
| 23 | Ga0070662_100012628 | 3300005457 | Bacteria | 5605 |
| 24 | Ga0070706_100004568 | 3300005467 | Bacteria | 13292 |
| 25 | Ga0070706_100050288 | 3300005467 | Bacteria | 3846 |
| 26 | Ga0070707_100091972 | 3300005468 | Bacteria | 2937 |
| 27 | Ga0070707_100110070 | 3300005468 | Bacteria | 2671 |
| 28 | Ga0070707_100158601 | 3300005468 | Bacteria | 2204 |
| 29 | Ga0070698_100005195 | 3300005471 | Bacteria | 14238 |
| 30 | Ga0070698_100056981 | 3300005471 | Bacteria | 3955 |
| 31 | Ga0070698_100063525 | 3300005471 | Bacteria | 3723 |
| 32 | Ga0070698_100181505 | 3300005471 | Bacteria | 2043 |
| 33 | Ga0070699_100005384 | 3300005518 | Bacteria | 11228 |
| 34 | Ga0070699_100054063 | 3300005518 | Bacteria | 3475 |
| 35 | Ga0070699_100121602 | 3300005518 | Bacteria | 2296 |
| 36 | Ga0070699_100138357 | 3300005518 | Bacteria | 2149 |
| 37 | Ga0070699_100233840 | 3300005518 | Bacteria | 1639 |
| 38 | Ga0070697_100007003 | 3300005536 | Bacteria | 8766 |
| 39 | Ga0070697_100063524 | 3300005536 | Bacteria | 3015 |
| 40 | Ga0070697_100261392 | 3300005536 | Bacteria | 1482 |
| 41 | Ga0070665_100002740 | 3300005548 | Bacteria | 19089 |
| 42 | Ga0070704_100362420 | 3300005549 | Bacteria | 1227 |
| 43 | Ga0068858_100440667 | 3300005842 | Bacteria | 1254 |
| 44 | Ga0068860_100000173 | 3300005843 | Bacteria | 106145 |
| 45 | Ga0068860_100080571 | 3300005843 | Bacteria | 3096 |
| 46 | Ga0068862_100100668 | 3300005844 | Bacteria | 2527 |
| 47 | Ga0081540_1000288 | 3300005983 | Bacteria | 52745 |
| 48 | Ga0081540_1000791 | 3300005983 | Bacteria | 29049 |
| 49 | Ga0081540_1002850 | 3300005983 | Bacteria | 14002 |
| 50 | Ga0081540_1005479 | 3300005983 | Bacteria | 9470 |
| 51 | Ga0081540_1008879 | 3300005983 | Bacteria | 6976 |
| 52 | Ga0081540_1010135 | 3300005983 | Bacteria | 6414 |
| 53 | Ga0081539_10000992 | 3300005985 | Bacteria | 52704 |
| 54 | Ga0070717_10002869 | 3300006028 | Bacteria | 12227 |
| 55 | Ga0070717_10040474 | 3300006028 | Bacteria | 3796 |
| 56 | Ga0075365_10176160 | 3300006038 | Bacteria | 1494 |
| 57 | Ga0070716_100013055 | 3300006173 | Bacteria | 4224 |
| 58 | Ga0070712_100102722 | 3300006175 | Bacteria | 2118 |
| 59 | Ga0070712_100120720 | 3300006175 | Bacteria | 1971 |
| 60 | Ga0075362_10088560 | 3300006177 | Bacteria | 1434 |
| 61 | Ga0075369_10018163 | 3300006186 | Bacteria | 2861 |
| 62 | Ga0097621_100006834 | 3300006237 | Bacteria | 8107 |
| 63 | Ga0075428_100120939 | 3300006844 | Bacteria | 2851 |
| 64 | Ga0075428_100193883 | 3300006844 | Bacteria | 2197 |
| 65 | Ga0075428_100475277 | 3300006844 | Bacteria | 1338 |
| 66 | Ga0075433_10123440 | 3300006852 | Bacteria | 2301 |
| 67 | Ga0075433_10244304 | 3300006852 | Bacteria | 1594 |
| 68 | Ga0075434_100102981 | 3300006871 | Bacteria | 2863 |
| 69 | Ga0075434_100211464 | 3300006871 | Bacteria | 1959 |
| 70 | Ga0075434_100278725 | 3300006871 | Bacteria | 1691 |
| 71 | Ga0099825_1033226 | 3300006941 | Bacteria | 2021 |
| 72 | Ga0099823_1000406 | 3300006944 | Bacteria | 27786 |
| 73 | Ga0075435_100077341 | 3300007076 | Bacteria | 2728 |
| 74 | Ga0075435_100280055 | 3300007076 | Bacteria | 1423 |
| 75 | Ga0099795_10001266 | 3300007788 | Bacteria | 5372 |
| 76 | Ga0099795_10003125 | 3300007788 | Bacteria | 4056 |
| 77 | Ga0105240_10000060 | 3300009093 | Bacteria | 219839 |
| 78 | Ga0111539_10050688 | 3300009094 | Bacteria | 4945 |
| 79 | Ga0111539_10389239 | 3300009094 | Bacteria | 1623 |
| 80 | Ga0111539_10584955 | 3300009094 | Bacteria | 1300 |
| 81 | Ga0105245_10535717 | 3300009098 | Bacteria | 1191 |
| 82 | Ga0105247_10023171 | 3300009101 | Bacteria | 3740 |
| 83 | Ga0105247_10179599 | 3300009101 | Bacteria | 1412 |
| 84 | Ga0114129_10010093 | 3300009147 | Bacteria | 13463 |
| 85 | Ga0114129_10139142 | 3300009147 | Bacteria | 3329 |
| 86 | Ga0114129_10243225 | 3300009147 | Bacteria | 2418 |
| 87 | Ga0114129_10450782 | 3300009147 | Bacteria | 1687 |
| 88 | Ga0105248_10021151 | 3300009177 | Bacteria | 7208 |
| 89 | Ga0105248_10062710 | 3300009177 | Bacteria | 4173 |
| 90 | Ga0105248_10438616 | 3300009177 | Bacteria | 1471 |
| 91 | Ga0123342_1000436 | 3300009766 | Bacteria | 65465 |
| 92 | Ga0099796_10022857 | 3300010159 | Bacteria | 1945 |
| 93 | Ga0099796_10038234 | 3300010159 | Bacteria | 1609 |
| 94 | Ga0099796_10042644 | 3300010159 | Bacteria | 1542 |
| 95 | Ga0105239_10121548 | 3300010375 | Bacteria | 2900 |
| 96 | Ga0105239_10398643 | 3300010375 | Bacteria | 1557 |
| 97 | Ga0105246_10055508 | 3300011119 | Bacteria | 2734 |
| 98 | Ga0157378_10009493 | 3300013297 | Bacteria | 8473 |
| 99 | Ga0163162_10008515 | 3300013306 | Bacteria | 10001 |
| 100 | Ga0163162_10264209 | 3300013306 | Bacteria | 1852 |
| 101 | Ga0157372_10548159 | 3300013307 | Unclassified | 1348 |
| 102 | Ga0157379_10372378 | 3300014968 | Bacteria | 1310 |
| 103 | Ga0157376_10006250 | 3300014969 | Bacteria | 8397 |
| 104 | Ga0213874_10019855 | 3300021377 | Unclassified | 1835 |
| 105 | Ga0213874_10027346 | 3300021377 | Bacteria | 1622 |
| 106 | Ga0213876_10059681 | 3300021384 | Bacteria | 2013 |
| 107 | Ga0213875_10103576 | 3300021388 | Bacteria | 1328 |
| 108 | Ga0209436_111670 | 3300025208 | Bacteria | 1531 |
| 109 | Ga0209130_1000292 | 3300025284 | Bacteria | 60927 |
| 110 | Ga0207426_1000269 | 3300025302 | Bacteria | 109050 |
| 111 | Ga0207710_10029285 | 3300025900 | Bacteria | 2395 |
| 112 | Ga0207710_10116126 | 3300025900 | Bacteria | 1274 |
| 113 | Ga0207680_10005697 | 3300025903 | Bacteria | 5966 |
| 114 | Ga0207699_10004584 | 3300025906 | Bacteria | 6604 |
| 115 | Ga0207684_10001499 | 3300025910 | Bacteria | 25075 |
| 116 | Ga0207684_10005585 | 3300025910 | Bacteria | 11580 |
| 117 | Ga0207684_10319335 | 3300025910 | Bacteria | 1339 |
| 118 | Ga0207695_10000025 | 3300025913 | Bacteria | 627211 |
| 119 | Ga0207693_10141793 | 3300025915 | Bacteria | 1889 |
| 120 | Ga0207693_10280376 | 3300025915 | Bacteria | 1306 |
| 121 | Ga0207663_10017641 | 3300025916 | Bacteria | 3983 |
| 122 | Ga0207663_10114777 | 3300025916 | Bacteria | 1834 |
| 123 | Ga0207646_10015999 | 3300025922 | Bacteria | 7052 |
| 124 | Ga0207646_10017825 | 3300025922 | Bacteria | 6633 |
| 125 | Ga0207646_10129876 | 3300025922 | Bacteria | 2267 |
| 126 | Ga0207659_10171465 | 3300025926 | Unclassified | 1712 |
| 127 | Ga0207664_10102461 | 3300025929 | Bacteria | 2367 |
| 128 | Ga0207706_10034575 | 3300025933 | Bacteria | 4496 |
| 129 | Ga0207711_10012906 | 3300025941 | Bacteria | 6939 |
| 130 | Ga0207658_10010409 | 3300025986 | Bacteria | 6318 |
| 131 | Ga0207677_10145390 | 3300026023 | Bacteria | 1821 |
| 132 | Ga0207708_10387198 | 3300026075 | Bacteria | 1154 |
| 133 | Ga0207641_10344330 | 3300026088 | Bacteria | 1419 |
| 134 | Ga0207676_10352296 | 3300026095 | Bacteria | 1362 |
| 135 | Ga0207674_10295137 | 3300026116 | Bacteria | 1570 |
| 136 | Ga0207683_10031360 | 3300026121 | Bacteria | 4612 |
| 137 | Ga0209389_1000111 | 3300027296 | Bacteria | 72517 |
| 138 | Ga0209489_100220 | 3300027361 | Bacteria | 95167 |
| 139 | Ga0209700_100041 | 3300027363 | Bacteria | 168380 |
| 140 | Ga0209179_1002865 | 3300027512 | Bacteria | 2402 |
| 141 | Ga0265356_1004591 | 3300028017 | Bacteria | 1678 |
| 142 | Ga0268266_10043237 | 3300028379 | Bacteria | 3849 |
| 143 | Ga0268265_10079601 | 3300028380 | Bacteria | 2581 |
| 144 | Ga0268264_10000045 | 3300028381 | Bacteria | 364764 |
| 145 | Ga0268264_10079677 | 3300028381 | Bacteria | 2795 |
| 146 | Ga0268264_10382230 | 3300028381 | Bacteria | 1349 |
| 147 | Ga0307517_10003177 | 3300028786 | Bacteria | 25825 |
| 148 | Ga0307515_10000272 | 3300028794 | Bacteria | 126613 |
| 149 | Ga0307515_10002868 | 3300028794 | Bacteria | 36682 |
| 150 | Ga0307515_10114512 | 3300028794 | Bacteria | 3116 |
| 151 | Ga0307515_10123349 | 3300028794 | Bacteria | 2915 |
| 152 | Ga0307515_10142136 | 3300028794 | Bacteria | 2567 |
| 153 | Ga0307511_10028771 | 3300030521 | Bacteria | 5034 |
| 154 | Ga0307513_10009858 | 3300031456 | Bacteria | 12059 |
| 155 | Ga0307513_10139182 | 3300031456 | Bacteria | 2357 |
| 156 | Ga0307513_10269534 | 3300031456 | Bacteria | 1487 |
| 157 | Ga0307509_10301597 | 3300031507 | Bacteria | 1350 |
| 158 | Ga0307510_10003963 | 3300033180 | Bacteria | 17350 |
| 159 | Ga0307510_10070691 | 3300033180 | Bacteria | 3483 |
| 160 | Ga0373928_0042186 | 3300035084 | Bacteria | 1052 |
| 161 | Ga0373951_0042046 | 3300035091 | Bacteria | 1105 |
| 162 | Ga0373939_0011113 | 3300035114 | Bacteria | 2265 |
| 163 | Ga0373960_0099894 | 3300035121 | Bacteria | 939 |
| 164 | Ga0436364_0333317 | 3300037853 | Bacteria | 1797 |
| 165 | Ga0436364_0802450 | 3300037853 | Bacteria | 2796 |
| 166 | Ga0436364_1258249 | 3300037853 | Bacteria | 2976 |
| 167 | Ga0436364_1425419 | 3300037853 | Bacteria | 1109 |
| 168 | Ga0436365_0551111 | 3300039437 | Bacteria | 2511 |
| 169 | Ga0436365_0618599 | 3300039437 | Bacteria | 2606 |
| 170 | Ga0436365_0718974 | 3300039437 | Bacteria | 2226 |
| 171 | Ga0436365_1299344 | 3300039437 | Bacteria | 3252 |
| 172 | Ga0436365_1796875 | 3300039437 | Bacteria | 3695 |
| 173 | Ga0436360_0382744 | 3300039438 | Bacteria | 2716 |
| 174 | Ga0436360_0428023 | 3300039438 | Bacteria | 1541 |
| 175 | Ga0436360_1368254 | 3300039438 | Bacteria | 1595 |
| 176 | Ga0436361_0239619 | 3300039447 | Bacteria | 3161 |
| 177 | Ga0436361_0353370 | 3300039447 | Bacteria | 1544 |
| 178 | Ga0436361_0400093 | 3300039447 | Bacteria | 1607 |
| 179 | Ga0436363_0211584 | 3300039450 | Unclassified | 2350 |
| 180 | Ga0436363_0769582 | 3300039450 | Bacteria | 1456 |
| 181 | Ga0436363_1241403 | 3300039450 | Bacteria | 1711 |
| 182 | Ga0436362_0864037 | 3300039453 | Bacteria | 1349 |
| 183 | Ga0436362_1251981 | 3300039453 | Bacteria | 1185 |
| 184 | Ga0495617_000445 | 3300046452 | Bacteria | 22316 |
| 185 | Ga0495590_0022509 | 3300046457 | Bacteria | 2229 |
| 186 | Ga0495638_0000946 | 3300046460 | Bacteria | 29439 |
| 187 | Ga0495638_0008289 | 3300046460 | Bacteria | 7379 |
| 188 | Ga0495638_0011763 | 3300046460 | Bacteria | 6024 |
| 189 | Ga0495638_0116193 | 3300046460 | Bacteria | 1585 |
| 190 | Ga0495605_0003220 | 3300046474 | Bacteria | 9792 |
| 191 | Ga0495605_0010191 | 3300046474 | Bacteria | 5263 |
| 192 | Ga0495605_0041387 | 3300046474 | Bacteria | 2295 |
| 193 | Ga0495639_0021888 | 3300046475 | Bacteria | 2801 |
| 194 | Ga0495584_0000153 | 3300046491 | Bacteria | 47948 |
| 195 | Ga0495584_0000585 | 3300046491 | Bacteria | 24586 |
| 196 | Ga0495584_0112264 | 3300046491 | Bacteria | 1379 |
| 197 | Ga0495584_0157710 | 3300046491 | Bacteria | 1153 |
| 198 | Ga0495585_0017642 | 3300046492 | Bacteria | 4122 |
| 199 | Ga0495594_0249521 | 3300046499 | Bacteria | 1011 |
| 200 | Ga0495607_0029878 | 3300046501 | Bacteria | 3352 |
| 201 | Ga0495607_0135658 | 3300046501 | Bacteria | 1275 |
| 202 | Ga0495583_0000057 | 3300046506 | Bacteria | 200688 |
| 203 | Ga0495583_0001800 | 3300046506 | Bacteria | 20280 |
| 204 | Ga0495583_0024069 | 3300046506 | Bacteria | 3067 |
| 205 | Ga0495606_0008833 | 3300046507 | Bacteria | 8639 |
| 206 | Ga0495606_0114430 | 3300046507 | Bacteria | 1623 |
| 207 | Ga0495610_0006963 | 3300046512 | Bacteria | 7654 |
| 208 | Ga0495610_0076888 | 3300046512 | Bacteria | 1543 |
| 209 | Ga0495610_0096760 | 3300046512 | Bacteria | 1329 |
| 210 | Ga0495616_0109333 | 3300046513 | Bacteria | 1285 |
| 211 | Ga0495620_0003141 | 3300046515 | Bacteria | 9480 |
| 212 | Ga0495620_0083952 | 3300046515 | Bacteria | 1285 |
| 213 | Ga0495631_0003533 | 3300046518 | Bacteria | 8543 |
| 214 | Ga0495632_0028176 | 3300046519 | Bacteria | 2933 |
| 215 | Ga0495632_0144967 | 3300046519 | Bacteria | 1100 |
| 216 | Ga0495643_0001012 | 3300046522 | Bacteria | 28728 |
| 217 | Ga0495643_0066140 | 3300046522 | Bacteria | 1907 |
| 218 | Ga0495644_0000266 | 3300046523 | Bacteria | 23929 |
| 219 | Ga0495644_0001300 | 3300046523 | Bacteria | 10244 |
| 220 | Ga0495648_0000104 | 3300046524 | Bacteria | 105792 |
| 221 | Ga0495648_0076784 | 3300046524 | Bacteria | 1917 |
| 222 | Ga0495609_0003027 | 3300046538 | Bacteria | 9906 |
| 223 | Ga0495609_0067667 | 3300046538 | Bacteria | 1572 |
| 224 | Ga0495597_0001460 | 3300046542 | Bacteria | 16933 |
| 225 | Ga0495633_0035532 | 3300046558 | Bacteria | 2392 |
| 226 | Ga0495656_0029445 | 3300046615 | Bacteria | 2211 |
| 227 | Ga0495668_0006305 | 3300046616 | Bacteria | 7809 |
| 228 | Ga0495611_0002793 | 3300046648 | Bacteria | 7811 |
| 229 | Ga0495611_0009807 | 3300046648 | Bacteria | 4049 |
| 230 | Ga0495611_0050612 | 3300046648 | Bacteria | 1871 |
| 231 | Ga0495625_0007154 | 3300046660 | Bacteria | 9796 |
| 232 | Ga0495625_0042199 | 3300046660 | Bacteria | 3316 |
| 233 | Ga0495625_0110185 | 3300046660 | Bacteria | 1882 |
| 234 | Ga0495647_0055252 | 3300046681 | Bacteria | 1554 |
| 235 | Ga0495669_0000405 | 3300046684 | Bacteria | 21042 |
| 236 | Ga0495669_0047491 | 3300046684 | Bacteria | 1918 |
| 237 | Ga0495670_0000961 | 3300046691 | Bacteria | 13949 |
| 238 | Ga0495670_0018109 | 3300046691 | Bacteria | 3469 |
| 239 | Ga0495649_0029582 | 3300046694 | Bacteria | 3029 |
| 240 | Ga0495649_0112850 | 3300046694 | Bacteria | 1441 |
| 241 | Ga0495649_0229394 | 3300046694 | Bacteria | 959 |
| 242 | Ga0495589_0011384 | 3300046794 | Bacteria | 4620 |
| 243 | Ga0495589_0022345 | 3300046794 | Bacteria | 3228 |
| 244 | Ga0495660_0001928 | 3300046810 | Bacteria | 13530 |
| 245 | Ga0495660_0024666 | 3300046810 | Bacteria | 3425 |
| 246 | Ga0495660_0068674 | 3300046810 | Bacteria | 1885 |
| 247 | Ga0495636_0004218 | 3300047318 | Bacteria | 5645 |
| 248 | Ga0495636_0067354 | 3300047318 | Bacteria | 1523 |
| 249 | Ga0495672_0017070 | 3300047320 | Bacteria | 4863 |
| 250 | Ga0495672_0151374 | 3300047320 | Bacteria | 1203 |
| 251 | Ga0495672_0175125 | 3300047320 | Bacteria | 1091 |
| 252 | Ga0495683_0002609 | 3300047323 | Bacteria | 10815 |
| 253 | Ga0495683_0016505 | 3300047323 | Bacteria | 3834 |
| 254 | Ga0495687_000362 | 3300047443 | Bacteria | 56701 |
| 255 | Ga0495687_001507 | 3300047443 | Bacteria | 21224 |
| 256 | Ga0495687_003845 | 3300047443 | Bacteria | 10569 |
| 257 | Ga0495687_015898 | 3300047443 | Bacteria | 3805 |
| 258 | Ga0495687_015899 | 3300047443 | Bacteria | 3805 |
| 259 | Ga0495677_0053047 | 3300047445 | Bacteria | 1494 |
| 260 | Ga0495685_000006 | 3300047447 | Bacteria | 110665 |
| 261 | Ga0495673_0012994 | 3300047469 | Bacteria | 4388 |
| 262 | Ga0495686_0094157 | 3300047472 | Bacteria | 1816 |
| 263 | Ga0495626_0005243 | 3300048091 | Bacteria | 7669 |
| 264 | Ga0495626_0041869 | 3300048091 | Bacteria | 2154 |
| 265 | Ga0496103_0046187 | 3300048906 | Bacteria | 2688 |
| 266 | Ga0496104_0020653 | 3300048907 | Bacteria | 6039 |
| 267 | Ga0496104_0144221 | 3300048907 | Bacteria | 2287 |
| 268 | Ga0496104_0174158 | 3300048907 | Bacteria | 2062 |
| 269 | Ga0496105_0032861 | 3300048908 | Bacteria | 4258 |
| 270 | Ga0496107_0109733 | 3300048910 | Bacteria | 2027 |
| 271 | Ga0496108_0415983 | 3300048911 | Bacteria | 1174 |
| 272 | Ga0496109_0109504 | 3300048912 | Bacteria | 2568 |
| 273 | Ga0496110_0118438 | 3300048913 | Bacteria | 2385 |
| 274 | Ga0496112_0038912 | 3300048915 | Bacteria | 4646 |
| 275 | Ga0496112_0181520 | 3300048915 | Bacteria | 2068 |
| 276 | Ga0496113_0329491 | 3300048916 | Bacteria | 1224 |
| 277 | Ga0496114_0199379 | 3300048917 | Bacteria | 1753 |
| 278 | Ga0496115_0001576 | 3300048918 | Bacteria | 16387 |
| 279 | Ga0496115_0008843 | 3300048918 | Bacteria | 7464 |
| 280 | Ga0496115_0107348 | 3300048918 | Bacteria | 2292 |
| 281 | Ga0496115_0443316 | 3300048918 | Unclassified | 1050 |
| 282 | Ga0496117_0057362 | 3300048920 | Bacteria | 2705 |
| 283 | Ga0496121_0000578 | 3300048924 | Bacteria | 68826 |
| 284 | Ga0496123_0135653 | 3300048926 | Bacteria | 1355 |
| 285 | Ga0496124_0000023 | 3300048927 | Bacteria | 415226 |
| 286 | Ga0496126_0000602 | 3300048929 | Bacteria | 67975 |
| 287 | Ga0495678_002358 | 3300049459 | Bacteria | 12968 |
| 288 | Ga0495678_029578 | 3300049459 | Bacteria | 2299 |
| 289 | Ga0495682_0000053 | 3300049460 | Bacteria | 107313 |
| 290 | Ga0495682_0000401 | 3300049460 | Bacteria | 31088 |
| 291 | Ga0495682_0039428 | 3300049460 | Bacteria | 1734 |
| 292 | nmdc:mga03683_94177_c1 | 3300050489 | Bacteria | 1309 |
| 293 | nmdc:mga05p37_296087_c1 | 3300050507 | Bacteria | 1924 |
| 294 | nmdc:mga05p37_39565_c1 | 3300050507 | Bacteria | 5790 |
| 295 | nmdc:mga05p37_445421_c1 | 3300050507 | Bacteria | 1500 |
| 296 | nmdc:mga05p37_53881_c1 | 3300050507 | Bacteria | 4948 |
| 297 | nmdc:mga05p37_6930_c1 | 3300050507 | Bacteria | 13355 |
| 298 | nmdc:mga06r32_500240_c1 | 3300050510 | Bacteria | 1192 |
| 299 | nmdc:mga08y16_53069_c1 | 3300050511 | Bacteria | 4240 |
| 300 | nmdc:mga0n895_30627_c1 | 3300050512 | Bacteria | 5144 |
| 301 | nmdc:mga0n895_59967_c1 | 3300050512 | Bacteria | 3754 |
| 302 | nmdc:mga0n895_635635_c1 | 3300050512 | Bacteria | 1067 |
| 303 | nmdc:mga0n895_75578_c1 | 3300050512 | Bacteria | 3349 |
| 304 | nmdc:mga0rr50_15341_c1 | 3300050513 | Bacteria | 5054 |
| 305 | nmdc:mga0rr50_3602_c1 | 3300050513 | Bacteria | 8955 |
| 306 | nmdc:mga0rr50_68704_c1 | 3300050513 | Bacteria | 2695 |
| 307 | nmdc:mga0a205_184518_c1 | 3300050515 | Bacteria | 1980 |
| 308 | nmdc:mga0a205_71484_c1 | 3300050515 | Bacteria | 3351 |
| 309 | Ga0500610_0098028 | 3300053079 | Bacteria | 1519 |
| 310 | Ga0500610_0139316 | 3300053079 | Bacteria | 1226 |
| 311 | Ga0500578_0016027 | 3300053086 | Bacteria | 4813 |
| 312 | Ga0500557_041972 | 3300053105 | Bacteria | 1438 |
| 313 | Ga0500594_0003331 | 3300053118 | Bacteria | 3519 |
| 314 | Ga0500642_0251713 | 3300053130 | Bacteria | 811 |
| 315 | Ga0500658_0004938 | 3300053134 | Bacteria | 4974 |
| 316 | Ga0500568_0083487 | 3300053139 | Bacteria | 1211 |
| 317 | Ga0500588_0056592 | 3300053146 | Bacteria | 1241 |
| 318 | Ga0500616_0022465 | 3300053153 | Bacteria | 3521 |
| 319 | Ga0500627_0050615 | 3300053158 | Bacteria | 1810 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035091 | Ga0373951_0042046 | Ga0373951_0042046_330_1064 | 206 |
| 2 | 3300053130 | Ga0500642_0251713 | Ga0500642_0251713_25_750 | 206 |
| 3 | 3300053139 | Ga0500568_0083487 | Ga0500568_0083487_419_1192 | 221 |
| 4 | 3300035121 | Ga0373960_0099894 | Ga0373960_0099894_56_892 | 222 |
| 5 | 3300035114 | Ga0373939_0011113 | Ga0373939_0011113_704_1534 | 223 |
| 6 | 3300048911 | Ga0496108_0415983 | Ga0496108_0415983_93_929 | 224 |
| 7 | 3300037853 | Ga0436364_0802450 | Ga0436364_0802450_1973_2764 | 228 |
| 8 | 3300050507 | nmdc:mga05p37_53881_c1 | nmdc:mga05p37_53881_c1_1832_2716 | 228 |
| 9 | 3300039438 | Ga0436360_0428023 | Ga0436360_0428023_715_1530 | 236 |
| 10 | 3300013306 | Ga0163162_10264209 | Ga0163162_102642092 | 237 |
| 11 | 3300014968 | Ga0157379_10372378 | Ga0157379_103723781 | 237 |
| 12 | 3300039453 | Ga0436362_1251981 | Ga0436362_1251981_28_846 | 237 |
| 13 | 3300048907 | Ga0496104_0174158 | Ga0496104_0174158_825_1646 | 237 |
| 14 | 3300005842 | Ga0068858_100440667 | Ga0068858_1004406671 | 238 |
| 15 | 3300009101 | Ga0105247_10023171 | Ga0105247_100231713 | 238 |
| 16 | 3300025900 | Ga0207710_10029285 | Ga0207710_100292852 | 238 |
| 17 | 3300026088 | Ga0207641_10344330 | Ga0207641_103443301 | 238 |
| 18 | 3300048910 | Ga0496107_0109733 | Ga0496107_0109733_269_1186 | 238 |
| 19 | 3300048924 | Ga0496121_0000578 | Ga0496121_0000578_57073_57990 | 238 |
| 20 | 3300048929 | Ga0496126_0000602 | Ga0496126_0000602_58212_59129 | 238 |
| 21 | 3300028017 | Ga0265356_1004591 | Ga0265356_10045912 | 239 |
| 22 | 3300039438 | Ga0436360_0382744 | Ga0436360_0382744_1624_2538 | 239 |
| 23 | 3300039450 | Ga0436363_0769582 | Ga0436363_0769582_275_1189 | 239 |
| 24 | 3300005518 | Ga0070699_100005384 | Ga0070699_1000053843 | 240 |
| 25 | 3300037853 | Ga0436364_0333317 | Ga0436364_0333317_236_1150 | 240 |
| 26 | 3300039447 | Ga0436361_0353370 | Ga0436361_0353370_50_964 | 240 |
| 27 | 3300046491 | Ga0495584_0157710 | Ga0495584_0157710_246_1082 | 240 |
| 28 | 3300005468 | Ga0070707_100091972 | Ga0070707_1000919722 | 241 |
| 29 | 3300005471 | Ga0070698_100063525 | Ga0070698_1000635254 | 241 |
| 30 | 3300005536 | Ga0070697_100063524 | Ga0070697_1000635242 | 241 |
| 31 | 3300025922 | Ga0207646_10015999 | Ga0207646_100159992 | 241 |
| 32 | 3300039437 | Ga0436365_1796875 | Ga0436365_1796875_2509_3423 | 241 |
| 33 | 3300046519 | Ga0495632_0144967 | Ga0495632_0144967_92_1009 | 241 |
| 34 | 3300050512 | nmdc:mga0n895_635635_c1 | nmdc:mga0n895_635635_c1_18_914 | 241 |
| 35 | 3300025906 | Ga0207699_10004584 | Ga0207699_100045844 | 242 |
| 36 | 3300046474 | Ga0495605_0041387 | Ga0495605_0041387_241_1158 | 242 |
| 37 | 3300046499 | Ga0495594_0249521 | Ga0495594_0249521_18_935 | 242 |
| 38 | 3300046507 | Ga0495606_0114430 | Ga0495606_0114430_772_1608 | 242 |
| 39 | 3300046684 | Ga0495669_0047491 | Ga0495669_0047491_780_1697 | 242 |
| 40 | 3300046694 | Ga0495649_0112850 | Ga0495649_0112850_376_1293 | 242 |
| 41 | 3300046794 | Ga0495589_0022345 | Ga0495589_0022345_458_1375 | 242 |
| 42 | 3300047320 | Ga0495672_0175125 | Ga0495672_0175125_102_1019 | 242 |
| 43 | 3300050510 | nmdc:mga06r32_500240_c1 | nmdc:mga06r32_500240_c1_55_891 | 242 |
| 44 | 3300025916 | Ga0207663_10017641 | Ga0207663_100176414 | 243 |
| 45 | 3300046694 | Ga0495649_0229394 | Ga0495649_0229394_87_929 | 243 |
| 46 | 3300047320 | Ga0495672_0151374 | Ga0495672_0151374_55_897 | 243 |
| 47 | 3300005439 | Ga0070711_100385215 | Ga0070711_1003852152 | 244 |
| 48 | 3300025916 | Ga0207663_10114777 | Ga0207663_101147772 | 244 |
| 49 | 3300030521 | Ga0307511_10028771 | Ga0307511_100287711 | 245 |
| 50 | 3300005518 | Ga0070699_100121602 | Ga0070699_1001216022 | 249 |
| 51 | 3300009147 | Ga0114129_10010093 | Ga0114129_100100932 | 249 |
| 52 | 3300039453 | Ga0436362_0864037 | Ga0436362_0864037_261_1115 | 249 |
| 53 | 3300046475 | Ga0495639_0021888 | Ga0495639_0021888_294_1148 | 249 |
| 54 | 3300046681 | Ga0495647_0055252 | Ga0495647_0055252_167_1021 | 249 |
| 55 | 3300050507 | nmdc:mga05p37_6930_c1 | nmdc:mga05p37_6930_c1_11629_12483 | 249 |
| 56 | 3300050512 | nmdc:mga0n895_59967_c1 | nmdc:mga0n895_59967_c1_858_1712 | 249 |
| 57 | 3300050513 | nmdc:mga0rr50_3602_c1 | nmdc:mga0rr50_3602_c1_7259_8113 | 249 |
| 58 | 3300050515 | nmdc:mga0a205_184518_c1 | nmdc:mga0a205_184518_c1_858_1712 | 249 |
| 59 | 3300006844 | Ga0075428_100475277 | Ga0075428_1004752771 | 250 |
| 60 | 3300021388 | Ga0213875_10103576 | Ga0213875_101035762 | 250 |
| 61 | 3300037853 | Ga0436364_1258249 | Ga0436364_1258249_1738_2691 | 250 |
| 62 | 3300039437 | Ga0436365_0551111 | Ga0436365_0551111_687_1625 | 250 |
| 63 | 3300035084 | Ga0373928_0042186 | Ga0373928_0042186_48_962 | 251 |
| 64 | 3300007788 | Ga0099795_10001266 | Ga0099795_100012662 | 252 |
| 65 | 3300027512 | Ga0209179_1002865 | Ga0209179_10028652 | 252 |
| 66 | 3300005435 | Ga0070714_100290684 | Ga0070714_1002906842 | 253 |
| 67 | 3300006175 | Ga0070712_100102722 | Ga0070712_1001027222 | 253 |
| 68 | 3300025915 | Ga0207693_10280376 | Ga0207693_102803762 | 253 |
| 69 | 3300026023 | Ga0207677_10145390 | Ga0207677_101453902 | 253 |
| 70 | 3300006028 | Ga0070717_10040474 | Ga0070717_100404743 | 254 |
| 71 | 3300009098 | Ga0105245_10535717 | Ga0105245_105357172 | 255 |
| 72 | 3300009101 | Ga0105247_10179599 | Ga0105247_101795991 | 255 |
| 73 | 3300011119 | Ga0105246_10055508 | Ga0105246_100555082 | 255 |
| 74 | 3300025900 | Ga0207710_10116126 | Ga0207710_101161261 | 255 |
| 75 | 3300039447 | Ga0436361_0239619 | Ga0436361_0239619_1891_2805 | 255 |
| 76 | 3300048906 | Ga0496103_0046187 | Ga0496103_0046187_1632_2567 | 255 |
| 77 | 3300009094 | Ga0111539_10050688 | Ga0111539_100506883 | 256 |
| 78 | 3300010159 | Ga0099796_10022857 | Ga0099796_100228572 | 256 |
| 79 | 3300039438 | Ga0436360_1368254 | Ga0436360_1368254_409_1380 | 256 |
| 80 | 3300046522 | Ga0495643_0001012 | Ga0495643_0001012_13021_13908 | 256 |
| 81 | 3300046542 | Ga0495597_0001460 | Ga0495597_0001460_862_1749 | 256 |
| 82 | 3300046810 | Ga0495660_0001928 | Ga0495660_0001928_7026_7913 | 256 |
| 83 | 3300048918 | Ga0496115_0443316 | Ga0496115_0443316_156_1037 | 256 |
| 84 | 3300050511 | nmdc:mga08y16_53069_c1 | nmdc:mga08y16_53069_c1_1465_2346 | 256 |
| 85 | 3300005295 | Ga0065707_10090782 | Ga0065707_100907822 | 257 |
| 86 | 3300009177 | Ga0105248_10062710 | Ga0105248_100627102 | 257 |
| 87 | 3300048913 | Ga0496110_0118438 | Ga0496110_0118438_526_1461 | 257 |
| 88 | 3300048915 | Ga0496112_0181520 | Ga0496112_0181520_571_1506 | 257 |
| 89 | 3300048918 | Ga0496115_0107348 | Ga0496115_0107348_192_1127 | 257 |
| 90 | 3300005467 | Ga0070706_100050288 | Ga0070706_1000502884 | 258 |
| 91 | 3300005468 | Ga0070707_100110070 | Ga0070707_1001100702 | 258 |
| 92 | 3300005471 | Ga0070698_100056981 | Ga0070698_1000569812 | 258 |
| 93 | 3300005518 | Ga0070699_100054063 | Ga0070699_1000540633 | 258 |
| 94 | 3300005536 | Ga0070697_100261392 | Ga0070697_1002613922 | 258 |
| 95 | 3300025910 | Ga0207684_10001499 | Ga0207684_100014995 | 258 |
| 96 | 3300025922 | Ga0207646_10017825 | Ga0207646_100178255 | 258 |
| 97 | 3300050513 | nmdc:mga0rr50_15341_c1 | nmdc:mga0rr50_15341_c1_118_1035 | 258 |
| 98 | 3300010159 | Ga0099796_10038234 | Ga0099796_100382341 | 259 |
| 99 | 3300039450 | Ga0436363_1241403 | Ga0436363_1241403_492_1421 | 259 |
| 100 | iso_pu_bacteria | 2932809354 | 2932816203 | 259 |
| 101 | 3300005434 | Ga0070709_10004455 | Ga0070709_100044554 | 260 |
| 102 | 3300005437 | Ga0070710_10018874 | Ga0070710_100188743 | 260 |
| 103 | 3300005983 | Ga0081540_1000288 | Ga0081540_100028825 | 260 |
| 104 | 3300006173 | Ga0070716_100013055 | Ga0070716_1000130552 | 260 |
| 105 | 3300009177 | Ga0105248_10438616 | Ga0105248_104386161 | 260 |
| 106 | 3300025929 | Ga0207664_10102461 | Ga0207664_101024613 | 260 |
| 107 | 3300028794 | Ga0307515_10000272 | Ga0307515_1000027236 | 260 |
| 108 | 3300031456 | Ga0307513_10009858 | Ga0307513_100098582 | 260 |
| 109 | 3300031507 | Ga0307509_10301597 | Ga0307509_103015972 | 260 |
| 110 | 3300046506 | Ga0495583_0024069 | Ga0495583_0024069_1057_1950 | 260 |
| 111 | 3300046512 | Ga0495610_0096760 | Ga0495610_0096760_303_1196 | 260 |
| 112 | 3300046515 | Ga0495620_0083952 | Ga0495620_0083952_242_1135 | 260 |
| 113 | 3300046660 | Ga0495625_0110185 | Ga0495625_0110185_809_1702 | 260 |
| 114 | 3300046810 | Ga0495660_0068674 | Ga0495660_0068674_482_1375 | 260 |
| 115 | 3300047443 | Ga0495687_015898 | Ga0495687_015898_2421_3320 | 260 |
| 116 | 3300047443 | Ga0495687_015899 | Ga0495687_015899_486_1385 | 260 |
| 117 | 3300048091 | Ga0495626_0041869 | Ga0495626_0041869_923_1816 | 260 |
| 118 | 3300053134 | Ga0500658_0004938 | Ga0500658_0004938_963_1862 | 260 |
| 119 | 3300005467 | Ga0070706_100004568 | Ga0070706_10000456810 | 261 |
| 120 | 3300005471 | Ga0070698_100005195 | Ga0070698_1000051956 | 261 |
| 121 | 3300005471 | Ga0070698_100181505 | Ga0070698_1001815051 | 261 |
| 122 | 3300005518 | Ga0070699_100233840 | Ga0070699_1002338403 | 261 |
| 123 | 3300005536 | Ga0070697_100007003 | Ga0070697_1000070038 | 261 |
| 124 | 3300006028 | Ga0070717_10002869 | Ga0070717_1000286911 | 261 |
| 125 | 3300025910 | Ga0207684_10005585 | Ga0207684_100055859 | 261 |
| 126 | 3300050507 | nmdc:mga05p37_296087_c1 | nmdc:mga05p37_296087_c1_755_1687 | 261 |
| 127 | 3300053153 | Ga0500616_0022465 | Ga0500616_0022465_515_1408 | 261 |
| 128 | 3300006871 | Ga0075434_100102981 | Ga0075434_1001029811 | 262 |
| 129 | 3300028794 | Ga0307515_10123349 | Ga0307515_101233491 | 262 |
| 130 | 3300046460 | Ga0495638_0116193 | Ga0495638_0116193_349_1251 | 262 |
| 131 | 3300047320 | Ga0495672_0017070 | Ga0495672_0017070_1769_2671 | 262 |
| 132 | 3300050512 | nmdc:mga0n895_30627_c1 | nmdc:mga0n895_30627_c1_236_1165 | 262 |
| 133 | 3300053079 | Ga0500610_0098028 | Ga0500610_0098028_394_1293 | 262 |
| 134 | 3300053146 | Ga0500588_0056592 | Ga0500588_0056592_298_1197 | 262 |
| 135 | 3300005843 | Ga0068860_100000173 | Ga0068860_10000017363 | 263 |
| 136 | 3300005844 | Ga0068862_100100668 | Ga0068862_1001006682 | 263 |
| 137 | 3300006852 | Ga0075433_10244304 | Ga0075433_102443042 | 263 |
| 138 | 3300006871 | Ga0075434_100211464 | Ga0075434_1002114642 | 263 |
| 139 | 3300007076 | Ga0075435_100280055 | Ga0075435_1002800551 | 263 |
| 140 | 3300009147 | Ga0114129_10139142 | Ga0114129_101391422 | 263 |
| 141 | 3300009147 | Ga0114129_10243225 | Ga0114129_102432252 | 263 |
| 142 | 3300028380 | Ga0268265_10079601 | Ga0268265_100796012 | 263 |
| 143 | 3300028381 | Ga0268264_10000045 | Ga0268264_1000004552 | 263 |
| 144 | 3300046460 | Ga0495638_0000946 | Ga0495638_0000946_3739_4683 | 263 |
| 145 | 3300049460 | Ga0495682_0039428 | Ga0495682_0039428_282_1223 | 263 |
| 146 | 3300050507 | nmdc:mga05p37_39565_c1 | nmdc:mga05p37_39565_c1_814_1749 | 263 |
| 147 | 3300050512 | nmdc:mga0n895_75578_c1 | nmdc:mga0n895_75578_c1_360_1295 | 263 |
| 148 | 3300050515 | nmdc:mga0a205_71484_c1 | nmdc:mga0a205_71484_c1_2003_2938 | 263 |
| 149 | 3300005549 | Ga0070704_100362420 | Ga0070704_1003624201 | 264 |
| 150 | 3300046684 | Ga0495669_0000405 | Ga0495669_0000405_19993_20901 | 264 |
| 151 | 3300047443 | Ga0495687_003845 | Ga0495687_003845_3316_4224 | 264 |
| 152 | 3300005983 | Ga0081540_1008879 | Ga0081540_10088796 | 265 |
| 153 | 3300046513 | Ga0495616_0109333 | Ga0495616_0109333_39_980 | 265 |
| 154 | 3300046616 | Ga0495668_0006305 | Ga0495668_0006305_3845_4786 | 265 |
| 155 | 3300053079 | Ga0500610_0139316 | Ga0500610_0139316_198_1139 | 265 |
| 156 | iso_pu_bacteria | 2883087390 | 2883089079 | 265 |
| 157 | iso_pu_bacteria | 2885409591 | 2885416156 | 265 |
| 158 | iso_pu_bacteria | 2904690495 | 2904695367 | 265 |
| 159 | iso_pu_bacteria | 2937822353 | 2937825251 | 265 |
| 160 | 3300003323 | rootH1_10076708 | rootH1_100767083 | 266 |
| 161 | 3300005983 | Ga0081540_1010135 | Ga0081540_10101355 | 266 |
| 162 | 3300006177 | Ga0075362_10088560 | Ga0075362_100885602 | 266 |
| 163 | 3300006186 | Ga0075369_10018163 | Ga0075369_100181631 | 266 |
| 164 | 3300009766 | Ga0123342_1000436 | Ga0123342_100043645 | 266 |
| 165 | 3300046474 | Ga0495605_0003220 | Ga0495605_0003220_5647_6588 | 266 |
| 166 | 3300046492 | Ga0495585_0017642 | Ga0495585_0017642_2213_3154 | 266 |
| 167 | 3300046501 | Ga0495607_0135658 | Ga0495607_0135658_52_993 | 266 |
| 168 | 3300046506 | Ga0495583_0001800 | Ga0495583_0001800_6222_7163 | 266 |
| 169 | 3300046512 | Ga0495610_0076888 | Ga0495610_0076888_125_1066 | 266 |
| 170 | 3300046515 | Ga0495620_0003141 | Ga0495620_0003141_4987_5928 | 266 |
| 171 | 3300046518 | Ga0495631_0003533 | Ga0495631_0003533_4540_5481 | 266 |
| 172 | 3300046519 | Ga0495632_0028176 | Ga0495632_0028176_373_1314 | 266 |
| 173 | 3300046648 | Ga0495611_0009807 | Ga0495611_0009807_2644_3585 | 266 |
| 174 | 3300046660 | Ga0495625_0007154 | Ga0495625_0007154_2729_3670 | 266 |
| 175 | 3300046691 | Ga0495670_0018109 | Ga0495670_0018109_1261_2202 | 266 |
| 176 | 3300046694 | Ga0495649_0029582 | Ga0495649_0029582_1242_2183 | 266 |
| 177 | 3300046810 | Ga0495660_0024666 | Ga0495660_0024666_1777_2718 | 266 |
| 178 | 3300047323 | Ga0495683_0016505 | Ga0495683_0016505_574_1515 | 266 |
| 179 | 3300047443 | Ga0495687_001507 | Ga0495687_001507_19247_20188 | 266 |
| 180 | 3300047472 | Ga0495686_0094157 | Ga0495686_0094157_761_1702 | 266 |
| 181 | 3300048091 | Ga0495626_0005243 | Ga0495626_0005243_5807_6748 | 266 |
| 182 | 3300048907 | Ga0496104_0020653 | Ga0496104_0020653_2357_3274 | 266 |
| 183 | 3300048908 | Ga0496105_0032861 | Ga0496105_0032861_1164_2081 | 266 |
| 184 | 3300048917 | Ga0496114_0199379 | Ga0496114_0199379_252_1169 | 266 |
| 185 | 3300048918 | Ga0496115_0008843 | Ga0496115_0008843_4030_4947 | 266 |
| 186 | 3300049459 | Ga0495678_029578 | Ga0495678_029578_456_1397 | 266 |
| 187 | 3300050489 | nmdc:mga03683_94177_c1 | nmdc:mga03683_94177_c1_37_978 | 266 |
| 188 | 3300053086 | Ga0500578_0016027 | Ga0500578_0016027_544_1485 | 266 |
| 189 | 3300053105 | Ga0500557_041972 | Ga0500557_041972_324_1265 | 266 |
| 190 | 3300053118 | Ga0500594_0003331 | Ga0500594_0003331_1065_2006 | 266 |
| 191 | 3300028794 | Ga0307515_10114512 | Ga0307515_101145122 | 267 |
| 192 | 3300031456 | Ga0307513_10139182 | Ga0307513_101391822 | 267 |
| 193 | 3300046460 | Ga0495638_0008289 | Ga0495638_0008289_5906_6865 | 267 |
| 194 | 3300046491 | Ga0495584_0000153 | Ga0495584_0000153_33063_33977 | 267 |
| 195 | 3300046524 | Ga0495648_0076784 | Ga0495648_0076784_331_1251 | 267 |
| 196 | 3300005436 | Ga0070713_100473424 | Ga0070713_1004734241 | 268 |
| 197 | 3300005983 | Ga0081540_1002850 | Ga0081540_10028502 | 268 |
| 198 | 3300006941 | Ga0099825_1033226 | Ga0099825_10332262 | 268 |
| 199 | 3300006944 | Ga0099823_1000406 | Ga0099823_100040615 | 268 |
| 200 | 3300014969 | Ga0157376_10006250 | Ga0157376_100062505 | 268 |
| 201 | 3300027296 | Ga0209389_1000111 | Ga0209389_10001119 | 268 |
| 202 | 3300027361 | Ga0209489_100220 | Ga0209489_10022087 | 268 |
| 203 | 3300027363 | Ga0209700_100041 | Ga0209700_100041165 | 268 |
| 204 | 3300046452 | Ga0495617_000445 | Ga0495617_000445_175_1101 | 268 |
| 205 | 3300046457 | Ga0495590_0022509 | Ga0495590_0022509_120_1115 | 268 |
| 206 | 3300046460 | Ga0495638_0011763 | Ga0495638_0011763_763_1689 | 268 |
| 207 | 3300046474 | Ga0495605_0010191 | Ga0495605_0010191_3687_4613 | 268 |
| 208 | 3300046491 | Ga0495584_0000585 | Ga0495584_0000585_6277_7203 | 268 |
| 209 | 3300046491 | Ga0495584_0112264 | Ga0495584_0112264_82_1008 | 268 |
| 210 | 3300046501 | Ga0495607_0029878 | Ga0495607_0029878_108_1034 | 268 |
| 211 | 3300046506 | Ga0495583_0000057 | Ga0495583_0000057_67241_68167 | 268 |
| 212 | 3300046507 | Ga0495606_0008833 | Ga0495606_0008833_2956_3882 | 268 |
| 213 | 3300046512 | Ga0495610_0006963 | Ga0495610_0006963_2510_3505 | 268 |
| 214 | 3300046523 | Ga0495644_0000266 | Ga0495644_0000266_8563_9489 | 268 |
| 215 | 3300046523 | Ga0495644_0001300 | Ga0495644_0001300_165_1091 | 268 |
| 216 | 3300046524 | Ga0495648_0000104 | Ga0495648_0000104_35874_36800 | 268 |
| 217 | 3300046538 | Ga0495609_0003027 | Ga0495609_0003027_8581_9507 | 268 |
| 218 | 3300046538 | Ga0495609_0067667 | Ga0495609_0067667_400_1326 | 268 |
| 219 | 3300046558 | Ga0495633_0035532 | Ga0495633_0035532_220_1146 | 268 |
| 220 | 3300046615 | Ga0495656_0029445 | Ga0495656_0029445_1122_2048 | 268 |
| 221 | 3300046648 | Ga0495611_0002793 | Ga0495611_0002793_76_1002 | 268 |
| 222 | 3300046648 | Ga0495611_0050612 | Ga0495611_0050612_400_1326 | 268 |
| 223 | 3300046660 | Ga0495625_0042199 | Ga0495625_0042199_1098_2024 | 268 |
| 224 | 3300046691 | Ga0495670_0000961 | Ga0495670_0000961_9003_9929 | 268 |
| 225 | 3300046794 | Ga0495589_0011384 | Ga0495589_0011384_821_1747 | 268 |
| 226 | 3300047318 | Ga0495636_0067354 | Ga0495636_0067354_387_1313 | 268 |
| 227 | 3300047323 | Ga0495683_0002609 | Ga0495683_0002609_550_1476 | 268 |
| 228 | 3300047443 | Ga0495687_000362 | Ga0495687_000362_30377_31303 | 268 |
| 229 | 3300047445 | Ga0495677_0053047 | Ga0495677_0053047_363_1289 | 268 |
| 230 | 3300047447 | Ga0495685_000006 | Ga0495685_000006_108726_109652 | 268 |
| 231 | 3300047469 | Ga0495673_0012994 | Ga0495673_0012994_1603_2529 | 268 |
| 232 | 3300048918 | Ga0496115_0001576 | Ga0496115_0001576_7826_8830 | 268 |
| 233 | 3300049459 | Ga0495678_002358 | Ga0495678_002358_3143_4069 | 268 |
| 234 | 3300049460 | Ga0495682_0000053 | Ga0495682_0000053_21676_22602 | 268 |
| 235 | 3300049460 | Ga0495682_0000401 | Ga0495682_0000401_387_1313 | 268 |
| 236 | 3300003659 | JGI25404J52841_10002078 | JGI25404J52841_100020783 | 269 |
| 237 | 3300005983 | Ga0081540_1005479 | Ga0081540_10054795 | 269 |
| 238 | 3300006871 | Ga0075434_100278725 | Ga0075434_1002787252 | 269 |
| 239 | 3300021384 | Ga0213876_10059681 | Ga0213876_100596812 | 269 |
| 240 | 3300039437 | Ga0436365_0618599 | Ga0436365_0618599_475_1395 | 269 |
| 241 | 3300005335 | Ga0070666_10028026 | Ga0070666_100280264 | 270 |
| 242 | 3300005436 | Ga0070713_100329705 | Ga0070713_1003297052 | 270 |
| 243 | 3300048920 | Ga0496117_0057362 | Ga0496117_0057362_246_1169 | 270 |
| 244 | 3300048926 | Ga0496123_0135653 | Ga0496123_0135653_256_1179 | 270 |
| 245 | 3300048927 | Ga0496124_0000023 | Ga0496124_0000023_11957_12880 | 270 |
| 246 | iso_pu_bacteria | 2582581315 | 2585324491 | 270 |
| 247 | iso_pu_bacteria | 2885383462 | 2885384846 | 270 |
| 248 | 3300007788 | Ga0099795_10003125 | Ga0099795_100031254 | 271 |
| 249 | 3300010159 | Ga0099796_10042644 | Ga0099796_100426441 | 271 |
| 250 | 3300021377 | Ga0213874_10027346 | Ga0213874_100273462 | 271 |
| 251 | 3300037853 | Ga0436364_1425419 | Ga0436364_1425419_59_985 | 271 |
| 252 | 3300039437 | Ga0436365_0718974 | Ga0436365_0718974_289_1215 | 271 |
| 253 | 3300048907 | Ga0496104_0144221 | Ga0496104_0144221_405_1328 | 271 |
| 254 | 3300048912 | Ga0496109_0109504 | Ga0496109_0109504_1502_2425 | 271 |
| 255 | 3300048915 | Ga0496112_0038912 | Ga0496112_0038912_3486_4409 | 271 |
| 256 | 3300003659 | JGI25404J52841_10022880 | JGI25404J52841_100228801 | 272 |
| 257 | 3300005983 | Ga0081540_1000791 | Ga0081540_10007916 | 272 |
| 258 | 3300006844 | Ga0075428_100193883 | Ga0075428_1001938832 | 272 |
| 259 | 3300009094 | Ga0111539_10584955 | Ga0111539_105849551 | 272 |
| 260 | 3300021377 | Ga0213874_10019855 | Ga0213874_100198552 | 272 |
| 261 | 3300026075 | Ga0207708_10387198 | Ga0207708_103871981 | 272 |
| 262 | 3300026116 | Ga0207674_10295137 | Ga0207674_102951371 | 272 |
| 263 | 3300028381 | Ga0268264_10382230 | Ga0268264_103822301 | 272 |
| 264 | 3300031456 | Ga0307513_10269534 | Ga0307513_102695342 | 272 |
| 265 | 3300039450 | Ga0436363_0211584 | Ga0436363_0211584_1305_2252 | 272 |
| 266 | iso_pu_bacteria | 2510917028 | 2511183287 | 272 |
| 267 | iso_pu_bacteria | 2513237088 | 2513594871 | 272 |
| 268 | iso_pu_bacteria | 2582581867 | 2585404145 | 272 |
| 269 | iso_pu_bacteria | 2585427590 | 2585820690 | 272 |
| 270 | 3300009094 | Ga0111539_10389239 | Ga0111539_103892391 | 273 |
| 271 | 3300010375 | Ga0105239_10121548 | Ga0105239_101215484 | 273 |
| 272 | 3300048916 | Ga0496113_0329491 | Ga0496113_0329491_245_1180 | 273 |
| 273 | iso_pu_bacteria | 2874168670 | 2874174284 | 273 |
| 274 | iso_pu_bacteria | 2894652903 | 2894653588 | 273 |
| 275 | iso_pu_bacteria | 2937822353 | 2937824123 | 273 |
| 276 | 3300003659 | JGI25404J52841_10000024 | JGI25404J52841_100000247 | 274 |
| 277 | 3300006844 | Ga0075428_100120939 | Ga0075428_1001209393 | 274 |
| 278 | 3300009147 | Ga0114129_10450782 | Ga0114129_104507822 | 275 |
| 279 | 3300050507 | nmdc:mga05p37_445421_c1 | nmdc:mga05p37_445421_c1_26_976 | 275 |
| 280 | 3300053158 | Ga0500627_0050615 | Ga0500627_0050615_533_1471 | 275 |
| 281 | 3300005335 | Ga0070666_10017437 | Ga0070666_100174371 | 276 |
| 282 | 3300005445 | Ga0070708_100188630 | Ga0070708_1001886302 | 276 |
| 283 | 3300005456 | Ga0070678_100019806 | Ga0070678_1000198063 | 276 |
| 284 | 3300005457 | Ga0070662_100012628 | Ga0070662_1000126282 | 276 |
| 285 | 3300005468 | Ga0070707_100158601 | Ga0070707_1001586012 | 276 |
| 286 | 3300005518 | Ga0070699_100138357 | Ga0070699_1001383572 | 276 |
| 287 | 3300005548 | Ga0070665_100002740 | Ga0070665_10000274015 | 276 |
| 288 | 3300005843 | Ga0068860_100080571 | Ga0068860_1000805712 | 276 |
| 289 | 3300006175 | Ga0070712_100120720 | Ga0070712_1001207202 | 276 |
| 290 | 3300006237 | Ga0097621_100006834 | Ga0097621_1000068343 | 276 |
| 291 | 3300007076 | Ga0075435_100077341 | Ga0075435_1000773412 | 276 |
| 292 | 3300009177 | Ga0105248_10021151 | Ga0105248_100211515 | 276 |
| 293 | 3300013297 | Ga0157378_10009493 | Ga0157378_100094935 | 276 |
| 294 | 3300013306 | Ga0163162_10008515 | Ga0163162_100085155 | 276 |
| 295 | 3300013307 | Ga0157372_10548159 | Ga0157372_105481592 | 276 |
| 296 | 3300025903 | Ga0207680_10005697 | Ga0207680_100056974 | 276 |
| 297 | 3300025910 | Ga0207684_10319335 | Ga0207684_103193352 | 276 |
| 298 | 3300025915 | Ga0207693_10141793 | Ga0207693_101417932 | 276 |
| 299 | 3300025922 | Ga0207646_10129876 | Ga0207646_101298763 | 276 |
| 300 | 3300025926 | Ga0207659_10171465 | Ga0207659_101714652 | 276 |
| 301 | 3300025933 | Ga0207706_10034575 | Ga0207706_100345752 | 276 |
| 302 | 3300025941 | Ga0207711_10012906 | Ga0207711_100129062 | 276 |
| 303 | 3300025986 | Ga0207658_10010409 | Ga0207658_100104094 | 276 |
| 304 | 3300026095 | Ga0207676_10352296 | Ga0207676_103522962 | 276 |
| 305 | 3300026121 | Ga0207683_10031360 | Ga0207683_100313603 | 276 |
| 306 | 3300028379 | Ga0268266_10043237 | Ga0268266_100432373 | 276 |
| 307 | 3300028381 | Ga0268264_10079677 | Ga0268264_100796776 | 276 |
| 308 | 3300028794 | Ga0307515_10142136 | Ga0307515_101421362 | 276 |
| 309 | 3300039437 | Ga0436365_1299344 | Ga0436365_1299344_52_993 | 276 |
| 310 | 3300039447 | Ga0436361_0400093 | Ga0436361_0400093_481_1428 | 276 |
| 311 | 3300050513 | nmdc:mga0rr50_68704_c1 | nmdc:mga0rr50_68704_c1_232_1209 | 276 |
| 312 | 3300002987 | JGI25159J45721_1000266 | JGI25159J45721_100026615 | 277 |
| 313 | 3300003203 | JGI25406J46586_10012511 | JGI25406J46586_100125113 | 277 |
| 314 | 3300003354 | JGI25160J50197_1000271 | JGI25160J50197_100027120 | 277 |
| 315 | 3300003374 | JGI25161J50226_1000208 | JGI25161J50226_100020814 | 277 |
| 316 | 3300004625 | Ga0055543_1000274 | Ga0055543_100027420 | 277 |
| 317 | 3300005262 | Ga0065165_1001956 | Ga0065165_100195615 | 277 |
| 318 | 3300005295 | Ga0065707_10090610 | Ga0065707_100906102 | 277 |
| 319 | 3300005985 | Ga0081539_10000992 | Ga0081539_100009924 | 277 |
| 320 | 3300006038 | Ga0075365_10176160 | Ga0075365_101761602 | 277 |
| 321 | 3300006852 | Ga0075433_10123440 | Ga0075433_101234402 | 277 |
| 322 | 3300009093 | Ga0105240_10000060 | Ga0105240_10000060150 | 277 |
| 323 | 3300010375 | Ga0105239_10398643 | Ga0105239_103986432 | 277 |
| 324 | 3300025208 | Ga0209436_111670 | Ga0209436_1116702 | 277 |
| 325 | 3300025284 | Ga0209130_1000292 | Ga0209130_100029214 | 277 |
| 326 | 3300025302 | Ga0207426_1000269 | Ga0207426_100026956 | 277 |
| 327 | 3300025913 | Ga0207695_10000025 | Ga0207695_1000002551 | 277 |
| 328 | 3300028786 | Ga0307517_10003177 | Ga0307517_1000317715 | 277 |
| 329 | 3300028794 | Ga0307515_10002868 | Ga0307515_100028685 | 277 |
| 330 | 3300033180 | Ga0307510_10003963 | Ga0307510_100039632 | 277 |
| 331 | 3300033180 | Ga0307510_10070691 | Ga0307510_100706913 | 277 |
| 332 | 3300046522 | Ga0495643_0066140 | Ga0495643_0066140_446_1390 | 277 |
| 333 | 3300047318 | Ga0495636_0004218 | Ga0495636_0004218_1759_2703 | 277 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s2k-assembly1.cif.gz_B | structural basis of wnt signaling inhibition by dickkopf binding to lrp5/6. | 0.7717 | 20 | 270 |
| 8em7-assembly1.cif.gz_B | cryo-em structure of lrp2 at ph 5.2 | 0.7697 | 20 | 270 |
| 8s9p-assembly1.cif.gz_B | 1:1:1 agrin/lrp4/musk complex | 0.7669 | 19 | 269 |
| 6h15-assembly1.cif.gz_A | structure of lrp6 p3e3p4e4 in complex with vhh l-p2-b10 | 0.7643 | 19 | 269 |
| 8dvl-assembly1.cif.gz_A | crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.18 | 0.7628 | 19 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HXD7_5_384_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8425 | 21 | 268 | 2.130.10.10 |
| af_R4GEA5_306_467_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.7893 | 121 | 261 | 2.110.10.10 |
| af_A0A1D6H6T3_20_145_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7878 | 177 | 268 | 2.130.10.10 |
| af_Q9NZR2_1261_1572_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.7786 | 22 | 267 | 2.120.10.30 |
| af_Q7ZUV2_4_123_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.777 | 184 | 263 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841P3J1-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.959 | 20 | 270 |
GO:0005886
GO:0017147 GO:0042813 GO:0060070 |
| AF-A0A511XWV2-F1-model_v4 | deleted | 0.9554 | 113 | 171 |
|
| AF-Q2UUZ4-F1-model_v4 | Low density lipoprotein receptor | 0.955 | 46 | 266 |
GO:0005886
GO:0030154 |
| AF-A0A6P1BXP9-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9536 | 220 | 272 |
|
| AF-A0A534WEQ0-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9519 | 113 | 277 |
GO:0005886
GO:0017147 GO:0042813 GO:0060070 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar