F411408

General Info

Members Datasets Scaffolds Average Seq Length
333 197 319 291

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10142136|Ga0307515_101421362
Length 339
Sequence MSAAPGRPKQARTEAGGEGTPMSNARSPEGARTAAHQGEGSSADSRLFILELAAGRVFSVKPDGSDKRIIASDCRMPDGVVVNVKAGHVYWTSMGVLSRNDGSIERVDLDGRNHKTIIPQGATFTPKQLQLDRRNGKLYWCDREGMRVMRANLDGSVIETLVQTGSTEADRRDQTRWCVGIALDLARQQIYWTQKGPDNAGRGRILRAGIDIPRGESAESRSDIETLYDGLPEPIDLEIDHVKRILYWTDRGDPPLGNTVNRAPLDTVASGRPAPEIVFKNLMEGIGIALDRQGDRMFMTDLAGTVYSARLDGSTPSVVLFAQGNLTGIAYANLSLKDA

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
3 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
4 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
5 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
6 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
7 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
8 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
9 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
10 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
11 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
12 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
13 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
55 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
99 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
101 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 3.6
Rhizoplane 5.11
Rhizosphere 72.97
Stem 0
Stem Tuber 0
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000266 3300002987 Bacteria 24375
2 JGI25406J46586_10012511 3300003203 Bacteria 3680
3 rootH1_10076708 3300003323 Bacteria 3288
4 JGI25160J50197_1000271 3300003354 Bacteria 38299
5 JGI25161J50226_1000208 3300003374 Bacteria 38299
6 JGI25404J52841_10000024 3300003659 Bacteria 12135
7 JGI25404J52841_10002078 3300003659 Bacteria 3714
8 JGI25404J52841_10022880 3300003659 Bacteria 1349
9 Ga0055543_1000274 3300004625 Bacteria 38337
10 Ga0065165_1001956 3300005262 Bacteria 19511
11 Ga0065707_10090610 3300005295 Bacteria 4106
12 Ga0065707_10090782 3300005295 Bacteria 4069
13 Ga0070666_10017437 3300005335 Bacteria 4603
14 Ga0070666_10028026 3300005335 Bacteria 3694
15 Ga0070709_10004455 3300005434 Bacteria 7556
16 Ga0070714_100290684 3300005435 Bacteria 1521
17 Ga0070713_100329705 3300005436 Bacteria 1411
18 Ga0070713_100473424 3300005436 Bacteria 1179
19 Ga0070710_10018874 3300005437 Bacteria 3554
20 Ga0070711_100385215 3300005439 Bacteria 1135
21 Ga0070708_100188630 3300005445 Bacteria 1928
22 Ga0070678_100019806 3300005456 Bacteria 4398
23 Ga0070662_100012628 3300005457 Bacteria 5605
24 Ga0070706_100004568 3300005467 Bacteria 13292
25 Ga0070706_100050288 3300005467 Bacteria 3846
26 Ga0070707_100091972 3300005468 Bacteria 2937
27 Ga0070707_100110070 3300005468 Bacteria 2671
28 Ga0070707_100158601 3300005468 Bacteria 2204
29 Ga0070698_100005195 3300005471 Bacteria 14238
30 Ga0070698_100056981 3300005471 Bacteria 3955
31 Ga0070698_100063525 3300005471 Bacteria 3723
32 Ga0070698_100181505 3300005471 Bacteria 2043
33 Ga0070699_100005384 3300005518 Bacteria 11228
34 Ga0070699_100054063 3300005518 Bacteria 3475
35 Ga0070699_100121602 3300005518 Bacteria 2296
36 Ga0070699_100138357 3300005518 Bacteria 2149
37 Ga0070699_100233840 3300005518 Bacteria 1639
38 Ga0070697_100007003 3300005536 Bacteria 8766
39 Ga0070697_100063524 3300005536 Bacteria 3015
40 Ga0070697_100261392 3300005536 Bacteria 1482
41 Ga0070665_100002740 3300005548 Bacteria 19089
42 Ga0070704_100362420 3300005549 Bacteria 1227
43 Ga0068858_100440667 3300005842 Bacteria 1254
44 Ga0068860_100000173 3300005843 Bacteria 106145
45 Ga0068860_100080571 3300005843 Bacteria 3096
46 Ga0068862_100100668 3300005844 Bacteria 2527
47 Ga0081540_1000288 3300005983 Bacteria 52745
48 Ga0081540_1000791 3300005983 Bacteria 29049
49 Ga0081540_1002850 3300005983 Bacteria 14002
50 Ga0081540_1005479 3300005983 Bacteria 9470
51 Ga0081540_1008879 3300005983 Bacteria 6976
52 Ga0081540_1010135 3300005983 Bacteria 6414
53 Ga0081539_10000992 3300005985 Bacteria 52704
54 Ga0070717_10002869 3300006028 Bacteria 12227
55 Ga0070717_10040474 3300006028 Bacteria 3796
56 Ga0075365_10176160 3300006038 Bacteria 1494
57 Ga0070716_100013055 3300006173 Bacteria 4224
58 Ga0070712_100102722 3300006175 Bacteria 2118
59 Ga0070712_100120720 3300006175 Bacteria 1971
60 Ga0075362_10088560 3300006177 Bacteria 1434
61 Ga0075369_10018163 3300006186 Bacteria 2861
62 Ga0097621_100006834 3300006237 Bacteria 8107
63 Ga0075428_100120939 3300006844 Bacteria 2851
64 Ga0075428_100193883 3300006844 Bacteria 2197
65 Ga0075428_100475277 3300006844 Bacteria 1338
66 Ga0075433_10123440 3300006852 Bacteria 2301
67 Ga0075433_10244304 3300006852 Bacteria 1594
68 Ga0075434_100102981 3300006871 Bacteria 2863
69 Ga0075434_100211464 3300006871 Bacteria 1959
70 Ga0075434_100278725 3300006871 Bacteria 1691
71 Ga0099825_1033226 3300006941 Bacteria 2021
72 Ga0099823_1000406 3300006944 Bacteria 27786
73 Ga0075435_100077341 3300007076 Bacteria 2728
74 Ga0075435_100280055 3300007076 Bacteria 1423
75 Ga0099795_10001266 3300007788 Bacteria 5372
76 Ga0099795_10003125 3300007788 Bacteria 4056
77 Ga0105240_10000060 3300009093 Bacteria 219839
78 Ga0111539_10050688 3300009094 Bacteria 4945
79 Ga0111539_10389239 3300009094 Bacteria 1623
80 Ga0111539_10584955 3300009094 Bacteria 1300
81 Ga0105245_10535717 3300009098 Bacteria 1191
82 Ga0105247_10023171 3300009101 Bacteria 3740
83 Ga0105247_10179599 3300009101 Bacteria 1412
84 Ga0114129_10010093 3300009147 Bacteria 13463
85 Ga0114129_10139142 3300009147 Bacteria 3329
86 Ga0114129_10243225 3300009147 Bacteria 2418
87 Ga0114129_10450782 3300009147 Bacteria 1687
88 Ga0105248_10021151 3300009177 Bacteria 7208
89 Ga0105248_10062710 3300009177 Bacteria 4173
90 Ga0105248_10438616 3300009177 Bacteria 1471
91 Ga0123342_1000436 3300009766 Bacteria 65465
92 Ga0099796_10022857 3300010159 Bacteria 1945
93 Ga0099796_10038234 3300010159 Bacteria 1609
94 Ga0099796_10042644 3300010159 Bacteria 1542
95 Ga0105239_10121548 3300010375 Bacteria 2900
96 Ga0105239_10398643 3300010375 Bacteria 1557
97 Ga0105246_10055508 3300011119 Bacteria 2734
98 Ga0157378_10009493 3300013297 Bacteria 8473
99 Ga0163162_10008515 3300013306 Bacteria 10001
100 Ga0163162_10264209 3300013306 Bacteria 1852
101 Ga0157372_10548159 3300013307 Unclassified 1348
102 Ga0157379_10372378 3300014968 Bacteria 1310
103 Ga0157376_10006250 3300014969 Bacteria 8397
104 Ga0213874_10019855 3300021377 Unclassified 1835
105 Ga0213874_10027346 3300021377 Bacteria 1622
106 Ga0213876_10059681 3300021384 Bacteria 2013
107 Ga0213875_10103576 3300021388 Bacteria 1328
108 Ga0209436_111670 3300025208 Bacteria 1531
109 Ga0209130_1000292 3300025284 Bacteria 60927
110 Ga0207426_1000269 3300025302 Bacteria 109050
111 Ga0207710_10029285 3300025900 Bacteria 2395
112 Ga0207710_10116126 3300025900 Bacteria 1274
113 Ga0207680_10005697 3300025903 Bacteria 5966
114 Ga0207699_10004584 3300025906 Bacteria 6604
115 Ga0207684_10001499 3300025910 Bacteria 25075
116 Ga0207684_10005585 3300025910 Bacteria 11580
117 Ga0207684_10319335 3300025910 Bacteria 1339
118 Ga0207695_10000025 3300025913 Bacteria 627211
119 Ga0207693_10141793 3300025915 Bacteria 1889
120 Ga0207693_10280376 3300025915 Bacteria 1306
121 Ga0207663_10017641 3300025916 Bacteria 3983
122 Ga0207663_10114777 3300025916 Bacteria 1834
123 Ga0207646_10015999 3300025922 Bacteria 7052
124 Ga0207646_10017825 3300025922 Bacteria 6633
125 Ga0207646_10129876 3300025922 Bacteria 2267
126 Ga0207659_10171465 3300025926 Unclassified 1712
127 Ga0207664_10102461 3300025929 Bacteria 2367
128 Ga0207706_10034575 3300025933 Bacteria 4496
129 Ga0207711_10012906 3300025941 Bacteria 6939
130 Ga0207658_10010409 3300025986 Bacteria 6318
131 Ga0207677_10145390 3300026023 Bacteria 1821
132 Ga0207708_10387198 3300026075 Bacteria 1154
133 Ga0207641_10344330 3300026088 Bacteria 1419
134 Ga0207676_10352296 3300026095 Bacteria 1362
135 Ga0207674_10295137 3300026116 Bacteria 1570
136 Ga0207683_10031360 3300026121 Bacteria 4612
137 Ga0209389_1000111 3300027296 Bacteria 72517
138 Ga0209489_100220 3300027361 Bacteria 95167
139 Ga0209700_100041 3300027363 Bacteria 168380
140 Ga0209179_1002865 3300027512 Bacteria 2402
141 Ga0265356_1004591 3300028017 Bacteria 1678
142 Ga0268266_10043237 3300028379 Bacteria 3849
143 Ga0268265_10079601 3300028380 Bacteria 2581
144 Ga0268264_10000045 3300028381 Bacteria 364764
145 Ga0268264_10079677 3300028381 Bacteria 2795
146 Ga0268264_10382230 3300028381 Bacteria 1349
147 Ga0307517_10003177 3300028786 Bacteria 25825
148 Ga0307515_10000272 3300028794 Bacteria 126613
149 Ga0307515_10002868 3300028794 Bacteria 36682
150 Ga0307515_10114512 3300028794 Bacteria 3116
151 Ga0307515_10123349 3300028794 Bacteria 2915
152 Ga0307515_10142136 3300028794 Bacteria 2567
153 Ga0307511_10028771 3300030521 Bacteria 5034
154 Ga0307513_10009858 3300031456 Bacteria 12059
155 Ga0307513_10139182 3300031456 Bacteria 2357
156 Ga0307513_10269534 3300031456 Bacteria 1487
157 Ga0307509_10301597 3300031507 Bacteria 1350
158 Ga0307510_10003963 3300033180 Bacteria 17350
159 Ga0307510_10070691 3300033180 Bacteria 3483
160 Ga0373928_0042186 3300035084 Bacteria 1052
161 Ga0373951_0042046 3300035091 Bacteria 1105
162 Ga0373939_0011113 3300035114 Bacteria 2265
163 Ga0373960_0099894 3300035121 Bacteria 939
164 Ga0436364_0333317 3300037853 Bacteria 1797
165 Ga0436364_0802450 3300037853 Bacteria 2796
166 Ga0436364_1258249 3300037853 Bacteria 2976
167 Ga0436364_1425419 3300037853 Bacteria 1109
168 Ga0436365_0551111 3300039437 Bacteria 2511
169 Ga0436365_0618599 3300039437 Bacteria 2606
170 Ga0436365_0718974 3300039437 Bacteria 2226
171 Ga0436365_1299344 3300039437 Bacteria 3252
172 Ga0436365_1796875 3300039437 Bacteria 3695
173 Ga0436360_0382744 3300039438 Bacteria 2716
174 Ga0436360_0428023 3300039438 Bacteria 1541
175 Ga0436360_1368254 3300039438 Bacteria 1595
176 Ga0436361_0239619 3300039447 Bacteria 3161
177 Ga0436361_0353370 3300039447 Bacteria 1544
178 Ga0436361_0400093 3300039447 Bacteria 1607
179 Ga0436363_0211584 3300039450 Unclassified 2350
180 Ga0436363_0769582 3300039450 Bacteria 1456
181 Ga0436363_1241403 3300039450 Bacteria 1711
182 Ga0436362_0864037 3300039453 Bacteria 1349
183 Ga0436362_1251981 3300039453 Bacteria 1185
184 Ga0495617_000445 3300046452 Bacteria 22316
185 Ga0495590_0022509 3300046457 Bacteria 2229
186 Ga0495638_0000946 3300046460 Bacteria 29439
187 Ga0495638_0008289 3300046460 Bacteria 7379
188 Ga0495638_0011763 3300046460 Bacteria 6024
189 Ga0495638_0116193 3300046460 Bacteria 1585
190 Ga0495605_0003220 3300046474 Bacteria 9792
191 Ga0495605_0010191 3300046474 Bacteria 5263
192 Ga0495605_0041387 3300046474 Bacteria 2295
193 Ga0495639_0021888 3300046475 Bacteria 2801
194 Ga0495584_0000153 3300046491 Bacteria 47948
195 Ga0495584_0000585 3300046491 Bacteria 24586
196 Ga0495584_0112264 3300046491 Bacteria 1379
197 Ga0495584_0157710 3300046491 Bacteria 1153
198 Ga0495585_0017642 3300046492 Bacteria 4122
199 Ga0495594_0249521 3300046499 Bacteria 1011
200 Ga0495607_0029878 3300046501 Bacteria 3352
201 Ga0495607_0135658 3300046501 Bacteria 1275
202 Ga0495583_0000057 3300046506 Bacteria 200688
203 Ga0495583_0001800 3300046506 Bacteria 20280
204 Ga0495583_0024069 3300046506 Bacteria 3067
205 Ga0495606_0008833 3300046507 Bacteria 8639
206 Ga0495606_0114430 3300046507 Bacteria 1623
207 Ga0495610_0006963 3300046512 Bacteria 7654
208 Ga0495610_0076888 3300046512 Bacteria 1543
209 Ga0495610_0096760 3300046512 Bacteria 1329
210 Ga0495616_0109333 3300046513 Bacteria 1285
211 Ga0495620_0003141 3300046515 Bacteria 9480
212 Ga0495620_0083952 3300046515 Bacteria 1285
213 Ga0495631_0003533 3300046518 Bacteria 8543
214 Ga0495632_0028176 3300046519 Bacteria 2933
215 Ga0495632_0144967 3300046519 Bacteria 1100
216 Ga0495643_0001012 3300046522 Bacteria 28728
217 Ga0495643_0066140 3300046522 Bacteria 1907
218 Ga0495644_0000266 3300046523 Bacteria 23929
219 Ga0495644_0001300 3300046523 Bacteria 10244
220 Ga0495648_0000104 3300046524 Bacteria 105792
221 Ga0495648_0076784 3300046524 Bacteria 1917
222 Ga0495609_0003027 3300046538 Bacteria 9906
223 Ga0495609_0067667 3300046538 Bacteria 1572
224 Ga0495597_0001460 3300046542 Bacteria 16933
225 Ga0495633_0035532 3300046558 Bacteria 2392
226 Ga0495656_0029445 3300046615 Bacteria 2211
227 Ga0495668_0006305 3300046616 Bacteria 7809
228 Ga0495611_0002793 3300046648 Bacteria 7811
229 Ga0495611_0009807 3300046648 Bacteria 4049
230 Ga0495611_0050612 3300046648 Bacteria 1871
231 Ga0495625_0007154 3300046660 Bacteria 9796
232 Ga0495625_0042199 3300046660 Bacteria 3316
233 Ga0495625_0110185 3300046660 Bacteria 1882
234 Ga0495647_0055252 3300046681 Bacteria 1554
235 Ga0495669_0000405 3300046684 Bacteria 21042
236 Ga0495669_0047491 3300046684 Bacteria 1918
237 Ga0495670_0000961 3300046691 Bacteria 13949
238 Ga0495670_0018109 3300046691 Bacteria 3469
239 Ga0495649_0029582 3300046694 Bacteria 3029
240 Ga0495649_0112850 3300046694 Bacteria 1441
241 Ga0495649_0229394 3300046694 Bacteria 959
242 Ga0495589_0011384 3300046794 Bacteria 4620
243 Ga0495589_0022345 3300046794 Bacteria 3228
244 Ga0495660_0001928 3300046810 Bacteria 13530
245 Ga0495660_0024666 3300046810 Bacteria 3425
246 Ga0495660_0068674 3300046810 Bacteria 1885
247 Ga0495636_0004218 3300047318 Bacteria 5645
248 Ga0495636_0067354 3300047318 Bacteria 1523
249 Ga0495672_0017070 3300047320 Bacteria 4863
250 Ga0495672_0151374 3300047320 Bacteria 1203
251 Ga0495672_0175125 3300047320 Bacteria 1091
252 Ga0495683_0002609 3300047323 Bacteria 10815
253 Ga0495683_0016505 3300047323 Bacteria 3834
254 Ga0495687_000362 3300047443 Bacteria 56701
255 Ga0495687_001507 3300047443 Bacteria 21224
256 Ga0495687_003845 3300047443 Bacteria 10569
257 Ga0495687_015898 3300047443 Bacteria 3805
258 Ga0495687_015899 3300047443 Bacteria 3805
259 Ga0495677_0053047 3300047445 Bacteria 1494
260 Ga0495685_000006 3300047447 Bacteria 110665
261 Ga0495673_0012994 3300047469 Bacteria 4388
262 Ga0495686_0094157 3300047472 Bacteria 1816
263 Ga0495626_0005243 3300048091 Bacteria 7669
264 Ga0495626_0041869 3300048091 Bacteria 2154
265 Ga0496103_0046187 3300048906 Bacteria 2688
266 Ga0496104_0020653 3300048907 Bacteria 6039
267 Ga0496104_0144221 3300048907 Bacteria 2287
268 Ga0496104_0174158 3300048907 Bacteria 2062
269 Ga0496105_0032861 3300048908 Bacteria 4258
270 Ga0496107_0109733 3300048910 Bacteria 2027
271 Ga0496108_0415983 3300048911 Bacteria 1174
272 Ga0496109_0109504 3300048912 Bacteria 2568
273 Ga0496110_0118438 3300048913 Bacteria 2385
274 Ga0496112_0038912 3300048915 Bacteria 4646
275 Ga0496112_0181520 3300048915 Bacteria 2068
276 Ga0496113_0329491 3300048916 Bacteria 1224
277 Ga0496114_0199379 3300048917 Bacteria 1753
278 Ga0496115_0001576 3300048918 Bacteria 16387
279 Ga0496115_0008843 3300048918 Bacteria 7464
280 Ga0496115_0107348 3300048918 Bacteria 2292
281 Ga0496115_0443316 3300048918 Unclassified 1050
282 Ga0496117_0057362 3300048920 Bacteria 2705
283 Ga0496121_0000578 3300048924 Bacteria 68826
284 Ga0496123_0135653 3300048926 Bacteria 1355
285 Ga0496124_0000023 3300048927 Bacteria 415226
286 Ga0496126_0000602 3300048929 Bacteria 67975
287 Ga0495678_002358 3300049459 Bacteria 12968
288 Ga0495678_029578 3300049459 Bacteria 2299
289 Ga0495682_0000053 3300049460 Bacteria 107313
290 Ga0495682_0000401 3300049460 Bacteria 31088
291 Ga0495682_0039428 3300049460 Bacteria 1734
292 nmdc:mga03683_94177_c1 3300050489 Bacteria 1309
293 nmdc:mga05p37_296087_c1 3300050507 Bacteria 1924
294 nmdc:mga05p37_39565_c1 3300050507 Bacteria 5790
295 nmdc:mga05p37_445421_c1 3300050507 Bacteria 1500
296 nmdc:mga05p37_53881_c1 3300050507 Bacteria 4948
297 nmdc:mga05p37_6930_c1 3300050507 Bacteria 13355
298 nmdc:mga06r32_500240_c1 3300050510 Bacteria 1192
299 nmdc:mga08y16_53069_c1 3300050511 Bacteria 4240
300 nmdc:mga0n895_30627_c1 3300050512 Bacteria 5144
301 nmdc:mga0n895_59967_c1 3300050512 Bacteria 3754
302 nmdc:mga0n895_635635_c1 3300050512 Bacteria 1067
303 nmdc:mga0n895_75578_c1 3300050512 Bacteria 3349
304 nmdc:mga0rr50_15341_c1 3300050513 Bacteria 5054
305 nmdc:mga0rr50_3602_c1 3300050513 Bacteria 8955
306 nmdc:mga0rr50_68704_c1 3300050513 Bacteria 2695
307 nmdc:mga0a205_184518_c1 3300050515 Bacteria 1980
308 nmdc:mga0a205_71484_c1 3300050515 Bacteria 3351
309 Ga0500610_0098028 3300053079 Bacteria 1519
310 Ga0500610_0139316 3300053079 Bacteria 1226
311 Ga0500578_0016027 3300053086 Bacteria 4813
312 Ga0500557_041972 3300053105 Bacteria 1438
313 Ga0500594_0003331 3300053118 Bacteria 3519
314 Ga0500642_0251713 3300053130 Bacteria 811
315 Ga0500658_0004938 3300053134 Bacteria 4974
316 Ga0500568_0083487 3300053139 Bacteria 1211
317 Ga0500588_0056592 3300053146 Bacteria 1241
318 Ga0500616_0022465 3300053153 Bacteria 3521
319 Ga0500627_0050615 3300053158 Bacteria 1810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035091 Ga0373951_0042046 Ga0373951_0042046_330_1064 206
2 3300053130 Ga0500642_0251713 Ga0500642_0251713_25_750 206
3 3300053139 Ga0500568_0083487 Ga0500568_0083487_419_1192 221
4 3300035121 Ga0373960_0099894 Ga0373960_0099894_56_892 222
5 3300035114 Ga0373939_0011113 Ga0373939_0011113_704_1534 223
6 3300048911 Ga0496108_0415983 Ga0496108_0415983_93_929 224
7 3300037853 Ga0436364_0802450 Ga0436364_0802450_1973_2764 228
8 3300050507 nmdc:mga05p37_53881_c1 nmdc:mga05p37_53881_c1_1832_2716 228
9 3300039438 Ga0436360_0428023 Ga0436360_0428023_715_1530 236
10 3300013306 Ga0163162_10264209 Ga0163162_102642092 237
11 3300014968 Ga0157379_10372378 Ga0157379_103723781 237
12 3300039453 Ga0436362_1251981 Ga0436362_1251981_28_846 237
13 3300048907 Ga0496104_0174158 Ga0496104_0174158_825_1646 237
14 3300005842 Ga0068858_100440667 Ga0068858_1004406671 238
15 3300009101 Ga0105247_10023171 Ga0105247_100231713 238
16 3300025900 Ga0207710_10029285 Ga0207710_100292852 238
17 3300026088 Ga0207641_10344330 Ga0207641_103443301 238
18 3300048910 Ga0496107_0109733 Ga0496107_0109733_269_1186 238
19 3300048924 Ga0496121_0000578 Ga0496121_0000578_57073_57990 238
20 3300048929 Ga0496126_0000602 Ga0496126_0000602_58212_59129 238
21 3300028017 Ga0265356_1004591 Ga0265356_10045912 239
22 3300039438 Ga0436360_0382744 Ga0436360_0382744_1624_2538 239
23 3300039450 Ga0436363_0769582 Ga0436363_0769582_275_1189 239
24 3300005518 Ga0070699_100005384 Ga0070699_1000053843 240
25 3300037853 Ga0436364_0333317 Ga0436364_0333317_236_1150 240
26 3300039447 Ga0436361_0353370 Ga0436361_0353370_50_964 240
27 3300046491 Ga0495584_0157710 Ga0495584_0157710_246_1082 240
28 3300005468 Ga0070707_100091972 Ga0070707_1000919722 241
29 3300005471 Ga0070698_100063525 Ga0070698_1000635254 241
30 3300005536 Ga0070697_100063524 Ga0070697_1000635242 241
31 3300025922 Ga0207646_10015999 Ga0207646_100159992 241
32 3300039437 Ga0436365_1796875 Ga0436365_1796875_2509_3423 241
33 3300046519 Ga0495632_0144967 Ga0495632_0144967_92_1009 241
34 3300050512 nmdc:mga0n895_635635_c1 nmdc:mga0n895_635635_c1_18_914 241
35 3300025906 Ga0207699_10004584 Ga0207699_100045844 242
36 3300046474 Ga0495605_0041387 Ga0495605_0041387_241_1158 242
37 3300046499 Ga0495594_0249521 Ga0495594_0249521_18_935 242
38 3300046507 Ga0495606_0114430 Ga0495606_0114430_772_1608 242
39 3300046684 Ga0495669_0047491 Ga0495669_0047491_780_1697 242
40 3300046694 Ga0495649_0112850 Ga0495649_0112850_376_1293 242
41 3300046794 Ga0495589_0022345 Ga0495589_0022345_458_1375 242
42 3300047320 Ga0495672_0175125 Ga0495672_0175125_102_1019 242
43 3300050510 nmdc:mga06r32_500240_c1 nmdc:mga06r32_500240_c1_55_891 242
44 3300025916 Ga0207663_10017641 Ga0207663_100176414 243
45 3300046694 Ga0495649_0229394 Ga0495649_0229394_87_929 243
46 3300047320 Ga0495672_0151374 Ga0495672_0151374_55_897 243
47 3300005439 Ga0070711_100385215 Ga0070711_1003852152 244
48 3300025916 Ga0207663_10114777 Ga0207663_101147772 244
49 3300030521 Ga0307511_10028771 Ga0307511_100287711 245
50 3300005518 Ga0070699_100121602 Ga0070699_1001216022 249
51 3300009147 Ga0114129_10010093 Ga0114129_100100932 249
52 3300039453 Ga0436362_0864037 Ga0436362_0864037_261_1115 249
53 3300046475 Ga0495639_0021888 Ga0495639_0021888_294_1148 249
54 3300046681 Ga0495647_0055252 Ga0495647_0055252_167_1021 249
55 3300050507 nmdc:mga05p37_6930_c1 nmdc:mga05p37_6930_c1_11629_12483 249
56 3300050512 nmdc:mga0n895_59967_c1 nmdc:mga0n895_59967_c1_858_1712 249
57 3300050513 nmdc:mga0rr50_3602_c1 nmdc:mga0rr50_3602_c1_7259_8113 249
58 3300050515 nmdc:mga0a205_184518_c1 nmdc:mga0a205_184518_c1_858_1712 249
59 3300006844 Ga0075428_100475277 Ga0075428_1004752771 250
60 3300021388 Ga0213875_10103576 Ga0213875_101035762 250
61 3300037853 Ga0436364_1258249 Ga0436364_1258249_1738_2691 250
62 3300039437 Ga0436365_0551111 Ga0436365_0551111_687_1625 250
63 3300035084 Ga0373928_0042186 Ga0373928_0042186_48_962 251
64 3300007788 Ga0099795_10001266 Ga0099795_100012662 252
65 3300027512 Ga0209179_1002865 Ga0209179_10028652 252
66 3300005435 Ga0070714_100290684 Ga0070714_1002906842 253
67 3300006175 Ga0070712_100102722 Ga0070712_1001027222 253
68 3300025915 Ga0207693_10280376 Ga0207693_102803762 253
69 3300026023 Ga0207677_10145390 Ga0207677_101453902 253
70 3300006028 Ga0070717_10040474 Ga0070717_100404743 254
71 3300009098 Ga0105245_10535717 Ga0105245_105357172 255
72 3300009101 Ga0105247_10179599 Ga0105247_101795991 255
73 3300011119 Ga0105246_10055508 Ga0105246_100555082 255
74 3300025900 Ga0207710_10116126 Ga0207710_101161261 255
75 3300039447 Ga0436361_0239619 Ga0436361_0239619_1891_2805 255
76 3300048906 Ga0496103_0046187 Ga0496103_0046187_1632_2567 255
77 3300009094 Ga0111539_10050688 Ga0111539_100506883 256
78 3300010159 Ga0099796_10022857 Ga0099796_100228572 256
79 3300039438 Ga0436360_1368254 Ga0436360_1368254_409_1380 256
80 3300046522 Ga0495643_0001012 Ga0495643_0001012_13021_13908 256
81 3300046542 Ga0495597_0001460 Ga0495597_0001460_862_1749 256
82 3300046810 Ga0495660_0001928 Ga0495660_0001928_7026_7913 256
83 3300048918 Ga0496115_0443316 Ga0496115_0443316_156_1037 256
84 3300050511 nmdc:mga08y16_53069_c1 nmdc:mga08y16_53069_c1_1465_2346 256
85 3300005295 Ga0065707_10090782 Ga0065707_100907822 257
86 3300009177 Ga0105248_10062710 Ga0105248_100627102 257
87 3300048913 Ga0496110_0118438 Ga0496110_0118438_526_1461 257
88 3300048915 Ga0496112_0181520 Ga0496112_0181520_571_1506 257
89 3300048918 Ga0496115_0107348 Ga0496115_0107348_192_1127 257
90 3300005467 Ga0070706_100050288 Ga0070706_1000502884 258
91 3300005468 Ga0070707_100110070 Ga0070707_1001100702 258
92 3300005471 Ga0070698_100056981 Ga0070698_1000569812 258
93 3300005518 Ga0070699_100054063 Ga0070699_1000540633 258
94 3300005536 Ga0070697_100261392 Ga0070697_1002613922 258
95 3300025910 Ga0207684_10001499 Ga0207684_100014995 258
96 3300025922 Ga0207646_10017825 Ga0207646_100178255 258
97 3300050513 nmdc:mga0rr50_15341_c1 nmdc:mga0rr50_15341_c1_118_1035 258
98 3300010159 Ga0099796_10038234 Ga0099796_100382341 259
99 3300039450 Ga0436363_1241403 Ga0436363_1241403_492_1421 259
100 iso_pu_bacteria 2932809354 2932816203 259
101 3300005434 Ga0070709_10004455 Ga0070709_100044554 260
102 3300005437 Ga0070710_10018874 Ga0070710_100188743 260
103 3300005983 Ga0081540_1000288 Ga0081540_100028825 260
104 3300006173 Ga0070716_100013055 Ga0070716_1000130552 260
105 3300009177 Ga0105248_10438616 Ga0105248_104386161 260
106 3300025929 Ga0207664_10102461 Ga0207664_101024613 260
107 3300028794 Ga0307515_10000272 Ga0307515_1000027236 260
108 3300031456 Ga0307513_10009858 Ga0307513_100098582 260
109 3300031507 Ga0307509_10301597 Ga0307509_103015972 260
110 3300046506 Ga0495583_0024069 Ga0495583_0024069_1057_1950 260
111 3300046512 Ga0495610_0096760 Ga0495610_0096760_303_1196 260
112 3300046515 Ga0495620_0083952 Ga0495620_0083952_242_1135 260
113 3300046660 Ga0495625_0110185 Ga0495625_0110185_809_1702 260
114 3300046810 Ga0495660_0068674 Ga0495660_0068674_482_1375 260
115 3300047443 Ga0495687_015898 Ga0495687_015898_2421_3320 260
116 3300047443 Ga0495687_015899 Ga0495687_015899_486_1385 260
117 3300048091 Ga0495626_0041869 Ga0495626_0041869_923_1816 260
118 3300053134 Ga0500658_0004938 Ga0500658_0004938_963_1862 260
119 3300005467 Ga0070706_100004568 Ga0070706_10000456810 261
120 3300005471 Ga0070698_100005195 Ga0070698_1000051956 261
121 3300005471 Ga0070698_100181505 Ga0070698_1001815051 261
122 3300005518 Ga0070699_100233840 Ga0070699_1002338403 261
123 3300005536 Ga0070697_100007003 Ga0070697_1000070038 261
124 3300006028 Ga0070717_10002869 Ga0070717_1000286911 261
125 3300025910 Ga0207684_10005585 Ga0207684_100055859 261
126 3300050507 nmdc:mga05p37_296087_c1 nmdc:mga05p37_296087_c1_755_1687 261
127 3300053153 Ga0500616_0022465 Ga0500616_0022465_515_1408 261
128 3300006871 Ga0075434_100102981 Ga0075434_1001029811 262
129 3300028794 Ga0307515_10123349 Ga0307515_101233491 262
130 3300046460 Ga0495638_0116193 Ga0495638_0116193_349_1251 262
131 3300047320 Ga0495672_0017070 Ga0495672_0017070_1769_2671 262
132 3300050512 nmdc:mga0n895_30627_c1 nmdc:mga0n895_30627_c1_236_1165 262
133 3300053079 Ga0500610_0098028 Ga0500610_0098028_394_1293 262
134 3300053146 Ga0500588_0056592 Ga0500588_0056592_298_1197 262
135 3300005843 Ga0068860_100000173 Ga0068860_10000017363 263
136 3300005844 Ga0068862_100100668 Ga0068862_1001006682 263
137 3300006852 Ga0075433_10244304 Ga0075433_102443042 263
138 3300006871 Ga0075434_100211464 Ga0075434_1002114642 263
139 3300007076 Ga0075435_100280055 Ga0075435_1002800551 263
140 3300009147 Ga0114129_10139142 Ga0114129_101391422 263
141 3300009147 Ga0114129_10243225 Ga0114129_102432252 263
142 3300028380 Ga0268265_10079601 Ga0268265_100796012 263
143 3300028381 Ga0268264_10000045 Ga0268264_1000004552 263
144 3300046460 Ga0495638_0000946 Ga0495638_0000946_3739_4683 263
145 3300049460 Ga0495682_0039428 Ga0495682_0039428_282_1223 263
146 3300050507 nmdc:mga05p37_39565_c1 nmdc:mga05p37_39565_c1_814_1749 263
147 3300050512 nmdc:mga0n895_75578_c1 nmdc:mga0n895_75578_c1_360_1295 263
148 3300050515 nmdc:mga0a205_71484_c1 nmdc:mga0a205_71484_c1_2003_2938 263
149 3300005549 Ga0070704_100362420 Ga0070704_1003624201 264
150 3300046684 Ga0495669_0000405 Ga0495669_0000405_19993_20901 264
151 3300047443 Ga0495687_003845 Ga0495687_003845_3316_4224 264
152 3300005983 Ga0081540_1008879 Ga0081540_10088796 265
153 3300046513 Ga0495616_0109333 Ga0495616_0109333_39_980 265
154 3300046616 Ga0495668_0006305 Ga0495668_0006305_3845_4786 265
155 3300053079 Ga0500610_0139316 Ga0500610_0139316_198_1139 265
156 iso_pu_bacteria 2883087390 2883089079 265
157 iso_pu_bacteria 2885409591 2885416156 265
158 iso_pu_bacteria 2904690495 2904695367 265
159 iso_pu_bacteria 2937822353 2937825251 265
160 3300003323 rootH1_10076708 rootH1_100767083 266
161 3300005983 Ga0081540_1010135 Ga0081540_10101355 266
162 3300006177 Ga0075362_10088560 Ga0075362_100885602 266
163 3300006186 Ga0075369_10018163 Ga0075369_100181631 266
164 3300009766 Ga0123342_1000436 Ga0123342_100043645 266
165 3300046474 Ga0495605_0003220 Ga0495605_0003220_5647_6588 266
166 3300046492 Ga0495585_0017642 Ga0495585_0017642_2213_3154 266
167 3300046501 Ga0495607_0135658 Ga0495607_0135658_52_993 266
168 3300046506 Ga0495583_0001800 Ga0495583_0001800_6222_7163 266
169 3300046512 Ga0495610_0076888 Ga0495610_0076888_125_1066 266
170 3300046515 Ga0495620_0003141 Ga0495620_0003141_4987_5928 266
171 3300046518 Ga0495631_0003533 Ga0495631_0003533_4540_5481 266
172 3300046519 Ga0495632_0028176 Ga0495632_0028176_373_1314 266
173 3300046648 Ga0495611_0009807 Ga0495611_0009807_2644_3585 266
174 3300046660 Ga0495625_0007154 Ga0495625_0007154_2729_3670 266
175 3300046691 Ga0495670_0018109 Ga0495670_0018109_1261_2202 266
176 3300046694 Ga0495649_0029582 Ga0495649_0029582_1242_2183 266
177 3300046810 Ga0495660_0024666 Ga0495660_0024666_1777_2718 266
178 3300047323 Ga0495683_0016505 Ga0495683_0016505_574_1515 266
179 3300047443 Ga0495687_001507 Ga0495687_001507_19247_20188 266
180 3300047472 Ga0495686_0094157 Ga0495686_0094157_761_1702 266
181 3300048091 Ga0495626_0005243 Ga0495626_0005243_5807_6748 266
182 3300048907 Ga0496104_0020653 Ga0496104_0020653_2357_3274 266
183 3300048908 Ga0496105_0032861 Ga0496105_0032861_1164_2081 266
184 3300048917 Ga0496114_0199379 Ga0496114_0199379_252_1169 266
185 3300048918 Ga0496115_0008843 Ga0496115_0008843_4030_4947 266
186 3300049459 Ga0495678_029578 Ga0495678_029578_456_1397 266
187 3300050489 nmdc:mga03683_94177_c1 nmdc:mga03683_94177_c1_37_978 266
188 3300053086 Ga0500578_0016027 Ga0500578_0016027_544_1485 266
189 3300053105 Ga0500557_041972 Ga0500557_041972_324_1265 266
190 3300053118 Ga0500594_0003331 Ga0500594_0003331_1065_2006 266
191 3300028794 Ga0307515_10114512 Ga0307515_101145122 267
192 3300031456 Ga0307513_10139182 Ga0307513_101391822 267
193 3300046460 Ga0495638_0008289 Ga0495638_0008289_5906_6865 267
194 3300046491 Ga0495584_0000153 Ga0495584_0000153_33063_33977 267
195 3300046524 Ga0495648_0076784 Ga0495648_0076784_331_1251 267
196 3300005436 Ga0070713_100473424 Ga0070713_1004734241 268
197 3300005983 Ga0081540_1002850 Ga0081540_10028502 268
198 3300006941 Ga0099825_1033226 Ga0099825_10332262 268
199 3300006944 Ga0099823_1000406 Ga0099823_100040615 268
200 3300014969 Ga0157376_10006250 Ga0157376_100062505 268
201 3300027296 Ga0209389_1000111 Ga0209389_10001119 268
202 3300027361 Ga0209489_100220 Ga0209489_10022087 268
203 3300027363 Ga0209700_100041 Ga0209700_100041165 268
204 3300046452 Ga0495617_000445 Ga0495617_000445_175_1101 268
205 3300046457 Ga0495590_0022509 Ga0495590_0022509_120_1115 268
206 3300046460 Ga0495638_0011763 Ga0495638_0011763_763_1689 268
207 3300046474 Ga0495605_0010191 Ga0495605_0010191_3687_4613 268
208 3300046491 Ga0495584_0000585 Ga0495584_0000585_6277_7203 268
209 3300046491 Ga0495584_0112264 Ga0495584_0112264_82_1008 268
210 3300046501 Ga0495607_0029878 Ga0495607_0029878_108_1034 268
211 3300046506 Ga0495583_0000057 Ga0495583_0000057_67241_68167 268
212 3300046507 Ga0495606_0008833 Ga0495606_0008833_2956_3882 268
213 3300046512 Ga0495610_0006963 Ga0495610_0006963_2510_3505 268
214 3300046523 Ga0495644_0000266 Ga0495644_0000266_8563_9489 268
215 3300046523 Ga0495644_0001300 Ga0495644_0001300_165_1091 268
216 3300046524 Ga0495648_0000104 Ga0495648_0000104_35874_36800 268
217 3300046538 Ga0495609_0003027 Ga0495609_0003027_8581_9507 268
218 3300046538 Ga0495609_0067667 Ga0495609_0067667_400_1326 268
219 3300046558 Ga0495633_0035532 Ga0495633_0035532_220_1146 268
220 3300046615 Ga0495656_0029445 Ga0495656_0029445_1122_2048 268
221 3300046648 Ga0495611_0002793 Ga0495611_0002793_76_1002 268
222 3300046648 Ga0495611_0050612 Ga0495611_0050612_400_1326 268
223 3300046660 Ga0495625_0042199 Ga0495625_0042199_1098_2024 268
224 3300046691 Ga0495670_0000961 Ga0495670_0000961_9003_9929 268
225 3300046794 Ga0495589_0011384 Ga0495589_0011384_821_1747 268
226 3300047318 Ga0495636_0067354 Ga0495636_0067354_387_1313 268
227 3300047323 Ga0495683_0002609 Ga0495683_0002609_550_1476 268
228 3300047443 Ga0495687_000362 Ga0495687_000362_30377_31303 268
229 3300047445 Ga0495677_0053047 Ga0495677_0053047_363_1289 268
230 3300047447 Ga0495685_000006 Ga0495685_000006_108726_109652 268
231 3300047469 Ga0495673_0012994 Ga0495673_0012994_1603_2529 268
232 3300048918 Ga0496115_0001576 Ga0496115_0001576_7826_8830 268
233 3300049459 Ga0495678_002358 Ga0495678_002358_3143_4069 268
234 3300049460 Ga0495682_0000053 Ga0495682_0000053_21676_22602 268
235 3300049460 Ga0495682_0000401 Ga0495682_0000401_387_1313 268
236 3300003659 JGI25404J52841_10002078 JGI25404J52841_100020783 269
237 3300005983 Ga0081540_1005479 Ga0081540_10054795 269
238 3300006871 Ga0075434_100278725 Ga0075434_1002787252 269
239 3300021384 Ga0213876_10059681 Ga0213876_100596812 269
240 3300039437 Ga0436365_0618599 Ga0436365_0618599_475_1395 269
241 3300005335 Ga0070666_10028026 Ga0070666_100280264 270
242 3300005436 Ga0070713_100329705 Ga0070713_1003297052 270
243 3300048920 Ga0496117_0057362 Ga0496117_0057362_246_1169 270
244 3300048926 Ga0496123_0135653 Ga0496123_0135653_256_1179 270
245 3300048927 Ga0496124_0000023 Ga0496124_0000023_11957_12880 270
246 iso_pu_bacteria 2582581315 2585324491 270
247 iso_pu_bacteria 2885383462 2885384846 270
248 3300007788 Ga0099795_10003125 Ga0099795_100031254 271
249 3300010159 Ga0099796_10042644 Ga0099796_100426441 271
250 3300021377 Ga0213874_10027346 Ga0213874_100273462 271
251 3300037853 Ga0436364_1425419 Ga0436364_1425419_59_985 271
252 3300039437 Ga0436365_0718974 Ga0436365_0718974_289_1215 271
253 3300048907 Ga0496104_0144221 Ga0496104_0144221_405_1328 271
254 3300048912 Ga0496109_0109504 Ga0496109_0109504_1502_2425 271
255 3300048915 Ga0496112_0038912 Ga0496112_0038912_3486_4409 271
256 3300003659 JGI25404J52841_10022880 JGI25404J52841_100228801 272
257 3300005983 Ga0081540_1000791 Ga0081540_10007916 272
258 3300006844 Ga0075428_100193883 Ga0075428_1001938832 272
259 3300009094 Ga0111539_10584955 Ga0111539_105849551 272
260 3300021377 Ga0213874_10019855 Ga0213874_100198552 272
261 3300026075 Ga0207708_10387198 Ga0207708_103871981 272
262 3300026116 Ga0207674_10295137 Ga0207674_102951371 272
263 3300028381 Ga0268264_10382230 Ga0268264_103822301 272
264 3300031456 Ga0307513_10269534 Ga0307513_102695342 272
265 3300039450 Ga0436363_0211584 Ga0436363_0211584_1305_2252 272
266 iso_pu_bacteria 2510917028 2511183287 272
267 iso_pu_bacteria 2513237088 2513594871 272
268 iso_pu_bacteria 2582581867 2585404145 272
269 iso_pu_bacteria 2585427590 2585820690 272
270 3300009094 Ga0111539_10389239 Ga0111539_103892391 273
271 3300010375 Ga0105239_10121548 Ga0105239_101215484 273
272 3300048916 Ga0496113_0329491 Ga0496113_0329491_245_1180 273
273 iso_pu_bacteria 2874168670 2874174284 273
274 iso_pu_bacteria 2894652903 2894653588 273
275 iso_pu_bacteria 2937822353 2937824123 273
276 3300003659 JGI25404J52841_10000024 JGI25404J52841_100000247 274
277 3300006844 Ga0075428_100120939 Ga0075428_1001209393 274
278 3300009147 Ga0114129_10450782 Ga0114129_104507822 275
279 3300050507 nmdc:mga05p37_445421_c1 nmdc:mga05p37_445421_c1_26_976 275
280 3300053158 Ga0500627_0050615 Ga0500627_0050615_533_1471 275
281 3300005335 Ga0070666_10017437 Ga0070666_100174371 276
282 3300005445 Ga0070708_100188630 Ga0070708_1001886302 276
283 3300005456 Ga0070678_100019806 Ga0070678_1000198063 276
284 3300005457 Ga0070662_100012628 Ga0070662_1000126282 276
285 3300005468 Ga0070707_100158601 Ga0070707_1001586012 276
286 3300005518 Ga0070699_100138357 Ga0070699_1001383572 276
287 3300005548 Ga0070665_100002740 Ga0070665_10000274015 276
288 3300005843 Ga0068860_100080571 Ga0068860_1000805712 276
289 3300006175 Ga0070712_100120720 Ga0070712_1001207202 276
290 3300006237 Ga0097621_100006834 Ga0097621_1000068343 276
291 3300007076 Ga0075435_100077341 Ga0075435_1000773412 276
292 3300009177 Ga0105248_10021151 Ga0105248_100211515 276
293 3300013297 Ga0157378_10009493 Ga0157378_100094935 276
294 3300013306 Ga0163162_10008515 Ga0163162_100085155 276
295 3300013307 Ga0157372_10548159 Ga0157372_105481592 276
296 3300025903 Ga0207680_10005697 Ga0207680_100056974 276
297 3300025910 Ga0207684_10319335 Ga0207684_103193352 276
298 3300025915 Ga0207693_10141793 Ga0207693_101417932 276
299 3300025922 Ga0207646_10129876 Ga0207646_101298763 276
300 3300025926 Ga0207659_10171465 Ga0207659_101714652 276
301 3300025933 Ga0207706_10034575 Ga0207706_100345752 276
302 3300025941 Ga0207711_10012906 Ga0207711_100129062 276
303 3300025986 Ga0207658_10010409 Ga0207658_100104094 276
304 3300026095 Ga0207676_10352296 Ga0207676_103522962 276
305 3300026121 Ga0207683_10031360 Ga0207683_100313603 276
306 3300028379 Ga0268266_10043237 Ga0268266_100432373 276
307 3300028381 Ga0268264_10079677 Ga0268264_100796776 276
308 3300028794 Ga0307515_10142136 Ga0307515_101421362 276
309 3300039437 Ga0436365_1299344 Ga0436365_1299344_52_993 276
310 3300039447 Ga0436361_0400093 Ga0436361_0400093_481_1428 276
311 3300050513 nmdc:mga0rr50_68704_c1 nmdc:mga0rr50_68704_c1_232_1209 276
312 3300002987 JGI25159J45721_1000266 JGI25159J45721_100026615 277
313 3300003203 JGI25406J46586_10012511 JGI25406J46586_100125113 277
314 3300003354 JGI25160J50197_1000271 JGI25160J50197_100027120 277
315 3300003374 JGI25161J50226_1000208 JGI25161J50226_100020814 277
316 3300004625 Ga0055543_1000274 Ga0055543_100027420 277
317 3300005262 Ga0065165_1001956 Ga0065165_100195615 277
318 3300005295 Ga0065707_10090610 Ga0065707_100906102 277
319 3300005985 Ga0081539_10000992 Ga0081539_100009924 277
320 3300006038 Ga0075365_10176160 Ga0075365_101761602 277
321 3300006852 Ga0075433_10123440 Ga0075433_101234402 277
322 3300009093 Ga0105240_10000060 Ga0105240_10000060150 277
323 3300010375 Ga0105239_10398643 Ga0105239_103986432 277
324 3300025208 Ga0209436_111670 Ga0209436_1116702 277
325 3300025284 Ga0209130_1000292 Ga0209130_100029214 277
326 3300025302 Ga0207426_1000269 Ga0207426_100026956 277
327 3300025913 Ga0207695_10000025 Ga0207695_1000002551 277
328 3300028786 Ga0307517_10003177 Ga0307517_1000317715 277
329 3300028794 Ga0307515_10002868 Ga0307515_100028685 277
330 3300033180 Ga0307510_10003963 Ga0307510_100039632 277
331 3300033180 Ga0307510_10070691 Ga0307510_100706913 277
332 3300046522 Ga0495643_0066140 Ga0495643_0066140_446_1390 277
333 3300047318 Ga0495636_0004218 Ga0495636_0004218_1759_2703 277

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2k-assembly1.cif.gz_B structural basis of wnt signaling inhibition by dickkopf binding to lrp5/6. 0.7717 20 270
8em7-assembly1.cif.gz_B cryo-em structure of lrp2 at ph 5.2 0.7697 20 270
8s9p-assembly1.cif.gz_B 1:1:1 agrin/lrp4/musk complex 0.7669 19 269
6h15-assembly1.cif.gz_A structure of lrp6 p3e3p4e4 in complex with vhh l-p2-b10 0.7643 19 269
8dvl-assembly1.cif.gz_A crystal structure of lrp6 e3e4 in complex with disulfide constrained peptide e3.18 0.7628 19 269
ID Description Score Start End Superfamily
af_A4HXD7_5_384_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8425 21 268 2.130.10.10
af_R4GEA5_306_467_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7893 121 261 2.110.10.10
af_A0A1D6H6T3_20_145_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7878 177 268 2.130.10.10
af_Q9NZR2_1261_1572_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7786 22 267 2.120.10.30
af_Q7ZUV2_4_123_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.777 184 263 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A841P3J1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.959 20 270 GO:0005886
GO:0017147
GO:0042813
GO:0060070
AF-A0A511XWV2-F1-model_v4 deleted 0.9554 113 171
AF-Q2UUZ4-F1-model_v4 Low density lipoprotein receptor 0.955 46 266 GO:0005886
GO:0030154
AF-A0A6P1BXP9-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9536 220 272
AF-A0A534WEQ0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9519 113 277 GO:0005886
GO:0017147
GO:0042813
GO:0060070

Feature Viewer

pLDDT pTM Quality
87.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map