F411313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 161 | 333 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300006914|Ga0075436_100000010|Ga0075436_10000001076 |
| Length | 249 |
| Sequence | VRTRALRASTYGTRLPGLPREPLTGRLIVIEGADGSGRTTEVGLLRDWLEIQGHPVVESGLRRSTLVAEQIDRAKQGHTLGGTTLALFYAVDFADQLENKILPALAAGSTVLADRYIYTLMARAIVRGASRAWAEKLYSFALKPDLVLLLDAKPDVLLHRSIGKYGSLDYWESGMDLSLSRDRFESFFLYQARLAAEIDWMVKEYGFYKIDANRSPNAVHADVRRLVQQIYKDGVDRSRNGRARRAAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 18 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 21 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 24 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 25 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 26 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 27 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 28 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 64 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 65 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 66 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 67 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 68 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 69 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 70 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 72 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 73 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 77 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 78 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 83 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 86 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 87 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 89 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 90 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 91 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 92 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 93 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 94 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 95 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 100 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 102 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 103 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 104 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 99.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10133559 | 3300003320 | Bacteria | 4771 |
| 2 | Ga0065707_10211350 | 3300005295 | Bacteria | 1264 |
| 3 | Ga0070658_10332830 | 3300005327 | Bacteria | 1298 |
| 4 | Ga0070690_100001338 | 3300005330 | Bacteria | 12805 |
| 5 | Ga0070690_100219697 | 3300005330 | Bacteria | 1331 |
| 6 | Ga0070670_100246649 | 3300005331 | Bacteria | 1555 |
| 7 | Ga0068869_100379402 | 3300005334 | Unclassified | 1158 |
| 8 | Ga0068869_100447975 | 3300005334 | Bacteria | 1070 |
| 9 | Ga0070680_100211839 | 3300005336 | Unclassified | 1635 |
| 10 | Ga0070689_100017117 | 3300005340 | Bacteria | 5318 |
| 11 | Ga0070689_100094831 | 3300005340 | Bacteria | 2356 |
| 12 | Ga0070689_100559149 | 3300005340 | Bacteria | 986 |
| 13 | Ga0070688_100051220 | 3300005365 | Bacteria | 2575 |
| 14 | Ga0070688_100054959 | 3300005365 | Unclassified | 2496 |
| 15 | Ga0070714_100083529 | 3300005435 | Bacteria | 2785 |
| 16 | Ga0070681_10044186 | 3300005458 | Bacteria | 4459 |
| 17 | Ga0068867_100372525 | 3300005459 | Unclassified | 1197 |
| 18 | Ga0070679_100534764 | 3300005530 | Unclassified | 1116 |
| 19 | Ga0068853_100751131 | 3300005539 | Unclassified | 932 |
| 20 | Ga0070704_100019922 | 3300005549 | Bacteria | 4317 |
| 21 | Ga0070704_100270633 | 3300005549 | Unclassified | 1403 |
| 22 | Ga0068855_100055494 | 3300005563 | Unclassified | 4653 |
| 23 | Ga0068855_100102674 | 3300005563 | Bacteria | 3291 |
| 24 | Ga0068855_100372285 | 3300005563 | Unclassified | 1570 |
| 25 | Ga0068855_100493358 | 3300005563 | Bacteria | 1332 |
| 26 | Ga0068859_100017251 | 3300005617 | Bacteria | 7251 |
| 27 | Ga0068859_100083423 | 3300005617 | Bacteria | 3239 |
| 28 | Ga0068859_100137253 | 3300005617 | Bacteria | 2519 |
| 29 | Ga0068863_100192185 | 3300005841 | Bacteria | 1962 |
| 30 | Ga0068863_100538367 | 3300005841 | Unclassified | 1152 |
| 31 | Ga0068863_100553147 | 3300005841 | Unclassified | 1136 |
| 32 | Ga0068860_100190223 | 3300005843 | Bacteria | 1986 |
| 33 | Ga0068862_100224102 | 3300005844 | Bacteria | 1703 |
| 34 | Ga0070717_10295458 | 3300006028 | Unclassified | 1439 |
| 35 | Ga0070717_10373764 | 3300006028 | Unclassified | 1277 |
| 36 | Ga0097621_100048212 | 3300006237 | Bacteria | 3455 |
| 37 | Ga0097621_100170018 | 3300006237 | Bacteria | 1878 |
| 38 | Ga0097621_100349123 | 3300006237 | Bacteria | 1315 |
| 39 | Ga0068871_100022554 | 3300006358 | Bacteria | 4855 |
| 40 | Ga0075431_100024295 | 3300006847 | Bacteria | 6208 |
| 41 | Ga0075429_100331860 | 3300006880 | Bacteria | 1331 |
| 42 | Ga0068865_100178938 | 3300006881 | Bacteria | 1632 |
| 43 | Ga0075436_100000010 | 3300006914 | Bacteria | 248382 |
| 44 | Ga0075436_100000508 | 3300006914 | Bacteria | 25170 |
| 45 | Ga0097620_100017251 | 3300006931 | Bacteria | 7251 |
| 46 | Ga0097620_100083423 | 3300006931 | Bacteria | 3239 |
| 47 | Ga0097620_100137265 | 3300006931 | Bacteria | 2519 |
| 48 | Ga0105240_10031649 | 3300009093 | Bacteria | 6855 |
| 49 | Ga0105240_10102261 | 3300009093 | Unclassified | 3483 |
| 50 | Ga0105240_10266308 | 3300009093 | Unclassified | 1975 |
| 51 | Ga0105240_10486596 | 3300009093 | Unclassified | 1374 |
| 52 | Ga0105240_10925269 | 3300009093 | Unclassified | 937 |
| 53 | Ga0111539_10032397 | 3300009094 | Bacteria | 6346 |
| 54 | Ga0111539_10086838 | 3300009094 | Unclassified | 3675 |
| 55 | Ga0111539_10403246 | 3300009094 | Unclassified | 1593 |
| 56 | Ga0111539_10660926 | 3300009094 | Bacteria | 1217 |
| 57 | Ga0105245_11299634 | 3300009098 | Unclassified | 776 |
| 58 | Ga0114129_10960975 | 3300009147 | Unclassified | 1078 |
| 59 | Ga0105248_10097826 | 3300009177 | Bacteria | 3306 |
| 60 | Ga0105248_10353209 | 3300009177 | Unclassified | 1655 |
| 61 | Ga0105248_10529843 | 3300009177 | Bacteria | 1329 |
| 62 | Ga0105238_10027652 | 3300009551 | Bacteria | 5781 |
| 63 | Ga0105238_10039645 | 3300009551 | Bacteria | 4776 |
| 64 | Ga0105238_10055881 | 3300009551 | Unclassified | 3961 |
| 65 | Ga0105238_10241885 | 3300009551 | Unclassified | 1782 |
| 66 | Ga0157370_10051303 | 3300013104 | Bacteria | 3940 |
| 67 | Ga0157374_10263774 | 3300013296 | Unclassified | 1697 |
| 68 | Ga0157374_10273072 | 3300013296 | Unclassified | 1667 |
| 69 | Ga0157374_10538911 | 3300013296 | Unclassified | 1174 |
| 70 | Ga0157378_10615758 | 3300013297 | Unclassified | 1098 |
| 71 | Ga0163162_10404114 | 3300013306 | Bacteria | 1498 |
| 72 | Ga0157372_10127089 | 3300013307 | Bacteria | 2931 |
| 73 | Ga0157375_10000081 | 3300013308 | Bacteria | 96625 |
| 74 | Ga0157375_11150729 | 3300013308 | Bacteria | 909 |
| 75 | Ga0163163_10000014 | 3300014325 | Bacteria | 231615 |
| 76 | Ga0157377_10181175 | 3300014745 | Unclassified | 1325 |
| 77 | Ga0157376_10078007 | 3300014969 | Bacteria | 2835 |
| 78 | Ga0206350_10624404 | 3300020080 | Unclassified | 1917 |
| 79 | Ga0224712_10019917 | 3300022467 | Bacteria | 2270 |
| 80 | Ga0207705_10274016 | 3300025909 | Unclassified | 1291 |
| 81 | Ga0207695_10039261 | 3300025913 | Bacteria | 5088 |
| 82 | Ga0207695_10088435 | 3300025913 | Bacteria | 3118 |
| 83 | Ga0207695_10413701 | 3300025913 | Unclassified | 1233 |
| 84 | Ga0207695_10570128 | 3300025913 | Unclassified | 1013 |
| 85 | Ga0207693_10201859 | 3300025915 | Bacteria | 1564 |
| 86 | Ga0207652_10236362 | 3300025921 | Unclassified | 1647 |
| 87 | Ga0207652_10252146 | 3300025921 | Bacteria | 1592 |
| 88 | Ga0207646_10332856 | 3300025922 | Bacteria | 1372 |
| 89 | Ga0207694_10009718 | 3300025924 | Bacteria | 7256 |
| 90 | Ga0207694_10061182 | 3300025924 | Unclassified | 2930 |
| 91 | Ga0207694_10135819 | 3300025924 | Bacteria | 1975 |
| 92 | Ga0207694_10222677 | 3300025924 | Bacteria | 1539 |
| 93 | Ga0207694_10368677 | 3300025924 | Unclassified | 1191 |
| 94 | Ga0207687_10485576 | 3300025927 | Unclassified | 1029 |
| 95 | Ga0207664_10024385 | 3300025929 | Bacteria | 4545 |
| 96 | Ga0207670_10040380 | 3300025936 | Bacteria | 3062 |
| 97 | Ga0207667_10066422 | 3300025949 | Bacteria | 3759 |
| 98 | Ga0207667_10094126 | 3300025949 | Bacteria | 3094 |
| 99 | Ga0207667_10450190 | 3300025949 | Bacteria | 1308 |
| 100 | Ga0207639_10212258 | 3300026041 | Unclassified | 1667 |
| 101 | Ga0207708_10105704 | 3300026075 | Bacteria | 2182 |
| 102 | Ga0207702_10008996 | 3300026078 | Bacteria | 8411 |
| 103 | Ga0207641_10354077 | 3300026088 | Bacteria | 1400 |
| 104 | Ga0207641_10481559 | 3300026088 | Unclassified | 1203 |
| 105 | Ga0207641_10545765 | 3300026088 | Unclassified | 1130 |
| 106 | Ga0207674_10020912 | 3300026116 | Bacteria | 7062 |
| 107 | Ga0207698_10304301 | 3300026142 | Bacteria | 1486 |
| 108 | Ga0268265_10359800 | 3300028380 | Bacteria | 1332 |
| 109 | Ga0265337_1000140 | 3300028556 | Bacteria | 36107 |
| 110 | Ga0265337_1001206 | 3300028556 | Bacteria | 13155 |
| 111 | Ga0265337_1005308 | 3300028556 | Bacteria | 5144 |
| 112 | Ga0265337_1005786 | 3300028556 | Unclassified | 4850 |
| 113 | Ga0265337_1026482 | 3300028556 | Unclassified | 1756 |
| 114 | Ga0265337_1037090 | 3300028556 | Unclassified | 1419 |
| 115 | Ga0265337_1052999 | 3300028556 | Unclassified | 1138 |
| 116 | Ga0265337_1068718 | 3300028556 | Unclassified | 975 |
| 117 | Ga0265326_10007590 | 3300028558 | Bacteria | 3316 |
| 118 | Ga0265326_10011195 | 3300028558 | Bacteria | 2647 |
| 119 | Ga0265319_1000007 | 3300028563 | Bacteria | 217194 |
| 120 | Ga0265319_1005912 | 3300028563 | Bacteria | 5755 |
| 121 | Ga0265319_1006732 | 3300028563 | Bacteria | 5275 |
| 122 | Ga0265319_1012190 | 3300028563 | Bacteria | 3484 |
| 123 | Ga0265334_10033223 | 3300028573 | Unclassified | 2054 |
| 124 | Ga0265318_10013573 | 3300028577 | Bacteria | 3436 |
| 125 | Ga0265323_10000237 | 3300028653 | Bacteria | 32647 |
| 126 | Ga0265323_10004158 | 3300028653 | Bacteria | 6270 |
| 127 | Ga0265323_10113297 | 3300028653 | Unclassified | 888 |
| 128 | Ga0265322_10005305 | 3300028654 | Bacteria | 3815 |
| 129 | Ga0265336_10000819 | 3300028666 | Bacteria | 16328 |
| 130 | Ga0265336_10027537 | 3300028666 | Bacteria | 1779 |
| 131 | Ga0265336_10040388 | 3300028666 | Bacteria | 1428 |
| 132 | Ga0265336_10064436 | 3300028666 | Unclassified | 1097 |
| 133 | Ga0265338_10000053 | 3300028800 | Bacteria | 208184 |
| 134 | Ga0265338_10000077 | 3300028800 | Bacteria | 178033 |
| 135 | Ga0265338_10000431 | 3300028800 | Bacteria | 75210 |
| 136 | Ga0265338_10000945 | 3300028800 | Bacteria | 48867 |
| 137 | Ga0265338_10001555 | 3300028800 | Bacteria | 37061 |
| 138 | Ga0265338_10004123 | 3300028800 | Bacteria | 19904 |
| 139 | Ga0265338_10006708 | 3300028800 | Bacteria | 14545 |
| 140 | Ga0265338_10008187 | 3300028800 | Bacteria | 12743 |
| 141 | Ga0265338_10009242 | 3300028800 | Bacteria | 11797 |
| 142 | Ga0265338_10019978 | 3300028800 | Bacteria | 7071 |
| 143 | Ga0265338_10038737 | 3300028800 | Bacteria | 4509 |
| 144 | Ga0265338_10038772 | 3300028800 | Bacteria | 4507 |
| 145 | Ga0265338_10044035 | 3300028800 | Unclassified | 4127 |
| 146 | Ga0265338_10053208 | 3300028800 | Bacteria | 3624 |
| 147 | Ga0265338_10058553 | 3300028800 | Bacteria | 3399 |
| 148 | Ga0265338_10063334 | 3300028800 | Bacteria | 3224 |
| 149 | Ga0265338_10067922 | 3300028800 | Bacteria | 3075 |
| 150 | Ga0265338_10089433 | 3300028800 | Bacteria | 2551 |
| 151 | Ga0265338_10091761 | 3300028800 | Bacteria | 2508 |
| 152 | Ga0265338_10457515 | 3300028800 | Unclassified | 903 |
| 153 | Ga0265324_10001313 | 3300029957 | Bacteria | 14604 |
| 154 | Ga0265324_10009663 | 3300029957 | Unclassified | 3755 |
| 155 | Ga0265324_10011848 | 3300029957 | Unclassified | 3309 |
| 156 | Ga0265324_10036792 | 3300029957 | Bacteria | 1701 |
| 157 | Ga0265324_10065691 | 3300029957 | Unclassified | 1238 |
| 158 | Ga0265332_10032199 | 3300031238 | Bacteria | 2285 |
| 159 | Ga0265328_10133926 | 3300031239 | Unclassified | 928 |
| 160 | Ga0265320_10000188 | 3300031240 | Bacteria | 51229 |
| 161 | Ga0265320_10000340 | 3300031240 | Bacteria | 38089 |
| 162 | Ga0265320_10007446 | 3300031240 | Bacteria | 6792 |
| 163 | Ga0265320_10017897 | 3300031240 | Unclassified | 3918 |
| 164 | Ga0265320_10039006 | 3300031240 | Unclassified | 2378 |
| 165 | Ga0265320_10077656 | 3300031240 | Unclassified | 1553 |
| 166 | Ga0265329_10002481 | 3300031242 | Bacteria | 8331 |
| 167 | Ga0265340_10000803 | 3300031247 | Bacteria | 17782 |
| 168 | Ga0265340_10048205 | 3300031247 | Bacteria | 2072 |
| 169 | Ga0265340_10068061 | 3300031247 | Bacteria | 1691 |
| 170 | Ga0265340_10235784 | 3300031247 | Unclassified | 817 |
| 171 | Ga0265339_10013563 | 3300031249 | Bacteria | 4935 |
| 172 | Ga0265339_10152803 | 3300031249 | Unclassified | 1166 |
| 173 | Ga0265327_10010259 | 3300031251 | Bacteria | 6608 |
| 174 | Ga0265327_10015959 | 3300031251 | Bacteria | 4808 |
| 175 | Ga0265316_10019839 | 3300031344 | Bacteria | 5739 |
| 176 | Ga0265316_10026613 | 3300031344 | Bacteria | 4806 |
| 177 | Ga0265316_10027692 | 3300031344 | Bacteria | 4686 |
| 178 | Ga0265316_10044485 | 3300031344 | Bacteria | 3532 |
| 179 | Ga0265316_10079495 | 3300031344 | Unclassified | 2516 |
| 180 | Ga0265316_10101225 | 3300031344 | Unclassified | 2189 |
| 181 | Ga0265316_10258565 | 3300031344 | Bacteria | 1277 |
| 182 | Ga0265316_10330635 | 3300031344 | Unclassified | 1106 |
| 183 | Ga0265313_10006728 | 3300031595 | Bacteria | 8040 |
| 184 | Ga0265313_10007547 | 3300031595 | Bacteria | 7394 |
| 185 | Ga0316575_10127735 | 3300031665 | Bacteria | 1042 |
| 186 | Ga0265314_10000234 | 3300031711 | Bacteria | 82654 |
| 187 | Ga0265314_10004107 | 3300031711 | Bacteria | 13720 |
| 188 | Ga0265314_10074318 | 3300031711 | Bacteria | 2264 |
| 189 | Ga0265314_10091629 | 3300031711 | Unclassified | 1978 |
| 190 | Ga0265342_10049892 | 3300031712 | Unclassified | 2502 |
| 191 | Ga0265342_10061610 | 3300031712 | Bacteria | 2210 |
| 192 | Ga0265342_10111003 | 3300031712 | Bacteria | 1552 |
| 193 | Ga0265342_10215947 | 3300031712 | Bacteria | 1035 |
| 194 | Ga0316576_10130455 | 3300031727 | Bacteria | 1891 |
| 195 | Ga0316578_10125421 | 3300031728 | Unclassified | 1544 |
| 196 | Ga0307405_10366450 | 3300031731 | Bacteria | 1117 |
| 197 | Ga0307412_10165186 | 3300031911 | Bacteria | 1650 |
| 198 | Ga0316585_10068001 | 3300032137 | Bacteria | 1155 |
| 199 | Ga0316580_10044893 | 3300032139 | Bacteria | 1363 |
| 200 | Ga0373930_0006890 | 3300034816 | Unclassified | 1938 |
| 201 | Ga0373928_0000124 | 3300035084 | Bacteria | 14419 |
| 202 | Ga0373928_0054406 | 3300035084 | Unclassified | 953 |
| 203 | Ga0373929_0003510 | 3300035085 | Unclassified | 2823 |
| 204 | Ga0373944_0001750 | 3300035089 | Bacteria | 5483 |
| 205 | Ga0373949_0002065 | 3300035090 | Bacteria | 5310 |
| 206 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 207 | Ga0373945_0014422 | 3300035116 | Unclassified | 2648 |
| 208 | Ga0373954_0017890 | 3300035118 | Unclassified | 3187 |
| 209 | Ga0373956_0001448 | 3300035119 | Bacteria | 9796 |
| 210 | Ga0373956_0189500 | 3300035119 | Bacteria | 974 |
| 211 | Ga0373946_0103782 | 3300035171 | Bacteria | 1278 |
| 212 | Ga0373946_0194665 | 3300035171 | Unclassified | 968 |
| 213 | Ga0373955_0027089 | 3300035172 | Bacteria | 2959 |
| 214 | Ga0373962_0000018 | 3300035242 | Bacteria | 47177 |
| 215 | Ga0316574_0036363 | 3300035398 | Bacteria | 3014 |
| 216 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 217 | Ga0373931_0113718 | 3300035691 | Bacteria | 1539 |
| 218 | Ga0373935_0055732 | 3300035692 | Bacteria | 2519 |
| 219 | Ga0373935_0061313 | 3300035692 | Unclassified | 2408 |
| 220 | Ga0373927_0020235 | 3300035695 | Unclassified | 4364 |
| 221 | Ga0373927_0061743 | 3300035695 | Unclassified | 2424 |
| 222 | Ga0373927_0071130 | 3300035695 | Bacteria | 2251 |
| 223 | Ga0373927_0104227 | 3300035695 | Bacteria | 1846 |
| 224 | Ga0373933_0186354 | 3300035724 | Unclassified | 1325 |
| 225 | Ga0373947_0004199 | 3300035725 | Bacteria | 8451 |
| 226 | Ga0373937_0012068 | 3300036401 | Bacteria | 7584 |
| 227 | Ga0373937_0092835 | 3300036401 | Unclassified | 2798 |
| 228 | Ga0316584_0048688 | 3300036712 | Bacteria | 3167 |
| 229 | Ga0373925_0000552 | 3300037068 | Bacteria | 36801 |
| 230 | Ga0373925_0003523 | 3300037068 | Bacteria | 12080 |
| 231 | Ga0373925_0017241 | 3300037068 | Bacteria | 5230 |
| 232 | Ga0451577_0087088 | 3300042876 | Bacteria | 2787 |
| 233 | Ga0451577_0212673 | 3300042876 | Unclassified | 1747 |
| 234 | Ga0451577_0465884 | 3300042876 | Bacteria | 1147 |
| 235 | Ga0451577_0492798 | 3300042876 | Unclassified | 1113 |
| 236 | Ga0453684_0002419 | 3300044712 | Bacteria | 45391 |
| 237 | Ga0453684_0007891 | 3300044712 | Bacteria | 19328 |
| 238 | Ga0453684_0049040 | 3300044712 | Bacteria | 5574 |
| 239 | Ga0453684_0117679 | 3300044712 | Bacteria | 3216 |
| 240 | Ga0453684_0247908 | 3300044712 | Unclassified | 2047 |
| 241 | Ga0453684_0370766 | 3300044712 | Bacteria | 1609 |
| 242 | Ga0453684_0861231 | 3300044712 | Bacteria | 973 |
| 243 | Ga0451576_0032180 | 3300045051 | Bacteria | 5589 |
| 244 | Ga0451576_0033408 | 3300045051 | Bacteria | 5468 |
| 245 | Ga0451576_0083832 | 3300045051 | Bacteria | 3316 |
| 246 | Ga0451576_0156435 | 3300045051 | Unclassified | 2378 |
| 247 | Ga0451576_0208556 | 3300045051 | Bacteria | 2041 |
| 248 | Ga0451576_0225580 | 3300045051 | Bacteria | 1956 |
| 249 | Ga0451576_0432054 | 3300045051 | Bacteria | 1382 |
| 250 | Ga0451576_1021188 | 3300045051 | Unclassified | 866 |
| 251 | Ga0495592_0000071 | 3300046454 | Bacteria | 92699 |
| 252 | Ga0495629_0033474 | 3300046459 | Bacteria | 3635 |
| 253 | Ga0495582_0276401 | 3300046473 | Bacteria | 964 |
| 254 | Ga0495662_0006019 | 3300046476 | Bacteria | 6062 |
| 255 | Ga0495662_0007368 | 3300046476 | Bacteria | 5438 |
| 256 | Ga0495662_0031709 | 3300046476 | Unclassified | 2553 |
| 257 | Ga0495664_0017257 | 3300046477 | Unclassified | 4126 |
| 258 | Ga0495664_0080670 | 3300046477 | Bacteria | 1950 |
| 259 | Ga0495618_0002646 | 3300046514 | Bacteria | 11456 |
| 260 | Ga0495618_0015771 | 3300046514 | Bacteria | 4612 |
| 261 | Ga0495628_0002709 | 3300046516 | Bacteria | 15864 |
| 262 | Ga0495628_0008425 | 3300046516 | Bacteria | 8845 |
| 263 | Ga0495630_0000220 | 3300046517 | Bacteria | 45190 |
| 264 | Ga0495630_0030594 | 3300046517 | Bacteria | 4006 |
| 265 | Ga0495630_0055300 | 3300046517 | Bacteria | 2974 |
| 266 | Ga0495630_0066606 | 3300046517 | Bacteria | 2707 |
| 267 | Ga0495630_0244560 | 3300046517 | Unclassified | 1371 |
| 268 | Ga0495666_0001943 | 3300046526 | Bacteria | 10191 |
| 269 | Ga0495666_0044371 | 3300046526 | Bacteria | 2147 |
| 270 | Ga0495666_0045898 | 3300046526 | Unclassified | 2107 |
| 271 | Ga0495652_0093645 | 3300046529 | Bacteria | 2452 |
| 272 | Ga0495640_0020910 | 3300046533 | Bacteria | 4812 |
| 273 | Ga0495640_0055384 | 3300046533 | Bacteria | 2713 |
| 274 | Ga0495640_0072441 | 3300046533 | Bacteria | 2309 |
| 275 | Ga0495586_0000017 | 3300046535 | Bacteria | 116426 |
| 276 | Ga0495586_0000414 | 3300046535 | Bacteria | 25855 |
| 277 | Ga0495586_0002311 | 3300046535 | Bacteria | 10358 |
| 278 | Ga0495586_0006922 | 3300046535 | Bacteria | 6039 |
| 279 | Ga0495586_0085125 | 3300046535 | Bacteria | 1741 |
| 280 | Ga0495586_0183191 | 3300046535 | Unclassified | 1185 |
| 281 | Ga0495586_0191258 | 3300046535 | Unclassified | 1159 |
| 282 | Ga0495587_0034039 | 3300046536 | Bacteria | 3074 |
| 283 | Ga0495645_0013692 | 3300046543 | Bacteria | 5747 |
| 284 | Ga0495645_0022843 | 3300046543 | Unclassified | 4527 |
| 285 | Ga0495645_0072585 | 3300046543 | Bacteria | 2480 |
| 286 | Ga0495645_0146237 | 3300046543 | Bacteria | 1646 |
| 287 | Ga0495667_0044763 | 3300046559 | Unclassified | 2931 |
| 288 | Ga0495634_0002060 | 3300046642 | Bacteria | 17002 |
| 289 | Ga0495634_0021601 | 3300046642 | Unclassified | 4547 |
| 290 | Ga0495634_0120525 | 3300046642 | Unclassified | 1680 |
| 291 | Ga0495634_0340033 | 3300046642 | Unclassified | 900 |
| 292 | Ga0495635_0051747 | 3300046663 | Bacteria | 2829 |
| 293 | Ga0495599_0008795 | 3300046678 | Bacteria | 6146 |
| 294 | Ga0495599_0028937 | 3300046678 | Bacteria | 3472 |
| 295 | Ga0495658_0033772 | 3300046683 | Unclassified | 2804 |
| 296 | Ga0495669_0120297 | 3300046684 | Bacteria | 1230 |
| 297 | Ga0495613_0007595 | 3300046689 | Bacteria | 8061 |
| 298 | Ga0495613_0008269 | 3300046689 | Bacteria | 7723 |
| 299 | Ga0495613_0451719 | 3300046689 | Unclassified | 871 |
| 300 | Ga0495624_0041943 | 3300046690 | Bacteria | 2925 |
| 301 | Ga0495600_0204788 | 3300046809 | Unclassified | 1266 |
| 302 | Ga0495600_0302029 | 3300046809 | Bacteria | 1010 |
| 303 | Ga0495581_0294822 | 3300047315 | Bacteria | 948 |
| 304 | Ga0495604_0511744 | 3300047317 | Bacteria | 778 |
| 305 | Ga0495674_0000243 | 3300047319 | Bacteria | 45976 |
| 306 | Ga0495674_0057421 | 3300047319 | Unclassified | 3406 |
| 307 | Ga0495676_0280836 | 3300047321 | Bacteria | 1127 |
| 308 | Ga0495680_0013067 | 3300047322 | Bacteria | 7262 |
| 309 | Ga0495680_0460283 | 3300047322 | Bacteria | 869 |
| 310 | Ga0495675_0114655 | 3300047444 | Unclassified | 1681 |
| 311 | Ga0495684_0115880 | 3300047471 | Bacteria | 2020 |
| 312 | Ga0495684_0151268 | 3300047471 | Bacteria | 1735 |
| 313 | Ga0496107_0053685 | 3300048910 | Unclassified | 2907 |
| 314 | Ga0496115_0005450 | 3300048918 | Bacteria | 9256 |
| 315 | Ga0501031_0000199 | 3300049568 | Bacteria | 34157 |
| 316 | Ga0501032_0001311 | 3300049569 | Bacteria | 19950 |
| 317 | Ga0501033_0001401 | 3300049570 | Bacteria | 21393 |
| 318 | Ga0501039_0134925 | 3300049575 | Bacteria | 1938 |
| 319 | Ga0501046_0301475 | 3300049580 | Unclassified | 1170 |
| 320 | Ga0501080_0043677 | 3300049742 | Bacteria | 4173 |
| 321 | Ga0501035_0003191 | 3300049822 | Bacteria | 15717 |
| 322 | Ga0501035_0064556 | 3300049822 | Bacteria | 3254 |
| 323 | Ga0501044_0000125 | 3300049823 | Bacteria | 92969 |
| 324 | Ga0501044_0089719 | 3300049823 | Bacteria | 3102 |
| 325 | Ga0501044_0152331 | 3300049823 | Bacteria | 2294 |
| 326 | nmdc:mga09592_312264_c1 | 3300050508 | Bacteria | 1362 |
| 327 | nmdc:mga0qj67_284763_c1 | 3300050509 | Unclassified | 1339 |
| 328 | nmdc:mga06r32_173170_c1 | 3300050510 | Unclassified | 2143 |
| 329 | nmdc:mga08y16_225015_c1 | 3300050511 | Bacteria | 1941 |
| 330 | nmdc:mga0n895_842549_c1 | 3300050512 | Bacteria | 905 |
| 331 | nmdc:mga08x19_1_c1 | 3300050514 | Bacteria | 2010344 |
| 332 | nmdc:mga08x19_371_c1 | 3300050514 | Bacteria | 31663 |
| 333 | Ga0495601_0038908 | 3300053077 | Bacteria | 2976 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005549 | Ga0070704_100019922 | Ga0070704_1000199227 | 212 |
| 2 | 3300009147 | Ga0114129_10960975 | Ga0114129_109609752 | 212 |
| 3 | 3300013306 | Ga0163162_10404114 | Ga0163162_104041142 | 216 |
| 4 | 3300009094 | Ga0111539_10086838 | Ga0111539_100868382 | 217 |
| 5 | 3300050512 | nmdc:mga0n895_842549_c1 | nmdc:mga0n895_842549_c1_45_707 | 217 |
| 6 | 3300006237 | Ga0097621_100349123 | Ga0097621_1003491232 | 218 |
| 7 | 3300005841 | Ga0068863_100553147 | Ga0068863_1005531471 | 222 |
| 8 | 3300026088 | Ga0207641_10545765 | Ga0207641_105457652 | 222 |
| 9 | 3300035119 | Ga0373956_0189500 | Ga0373956_0189500_198_929 | 222 |
| 10 | 3300006028 | Ga0070717_10295458 | Ga0070717_102954582 | 223 |
| 11 | 3300035171 | Ga0373946_0103782 | Ga0373946_0103782_203_934 | 223 |
| 12 | 3300035692 | Ga0373935_0055732 | Ga0373935_0055732_1152_1883 | 223 |
| 13 | 3300035695 | Ga0373927_0104227 | Ga0373927_0104227_491_1222 | 223 |
| 14 | 3300035725 | Ga0373947_0004199 | Ga0373947_0004199_7068_7799 | 223 |
| 15 | 3300037068 | Ga0373925_0003523 | Ga0373925_0003523_10920_11651 | 223 |
| 16 | 3300044712 | Ga0453684_0007891 | Ga0453684_0007891_14145_14885 | 223 |
| 17 | 3300045051 | Ga0451576_0225580 | Ga0451576_0225580_633_1364 | 223 |
| 18 | 3300046543 | Ga0495645_0022843 | Ga0495645_0022843_3274_4005 | 223 |
| 19 | 3300047321 | Ga0495676_0280836 | Ga0495676_0280836_84_815 | 223 |
| 20 | 3300006914 | Ga0075436_100000508 | Ga0075436_10000050813 | 228 |
| 21 | 3300050514 | nmdc:mga08x19_371_c1 | nmdc:mga08x19_371_c1_11415_12242 | 228 |
| 22 | 3300005295 | Ga0065707_10211350 | Ga0065707_102113502 | 229 |
| 23 | 3300006880 | Ga0075429_100331860 | Ga0075429_1003318602 | 229 |
| 24 | 3300009094 | Ga0111539_10032397 | Ga0111539_100323976 | 229 |
| 25 | 3300020080 | Ga0206350_10624404 | Ga0206350_106244042 | 229 |
| 26 | 3300022467 | Ga0224712_10019917 | Ga0224712_100199172 | 229 |
| 27 | 3300047317 | Ga0495604_0511744 | Ga0495604_0511744_43_753 | 229 |
| 28 | 3300050508 | nmdc:mga09592_312264_c1 | nmdc:mga09592_312264_c1_404_1114 | 229 |
| 29 | 3300050509 | nmdc:mga0qj67_284763_c1 | nmdc:mga0qj67_284763_c1_450_1160 | 229 |
| 30 | 3300050514 | nmdc:mga08x19_1_c1 | nmdc:mga08x19_1_c1_1370167_1370925 | 229 |
| 31 | 3300005331 | Ga0070670_100246649 | Ga0070670_1002466491 | 230 |
| 32 | 3300005563 | Ga0068855_100493358 | Ga0068855_1004933582 | 230 |
| 33 | 3300009551 | Ga0105238_10055881 | Ga0105238_100558812 | 230 |
| 34 | 3300025924 | Ga0207694_10061182 | Ga0207694_100611823 | 230 |
| 35 | 3300025949 | Ga0207667_10450190 | Ga0207667_104501902 | 230 |
| 36 | 3300028380 | Ga0268265_10359800 | Ga0268265_103598002 | 230 |
| 37 | 3300028556 | Ga0265337_1000140 | Ga0265337_100014026 | 230 |
| 38 | 3300028563 | Ga0265319_1005912 | Ga0265319_10059125 | 230 |
| 39 | 3300028666 | Ga0265336_10000819 | Ga0265336_1000081910 | 230 |
| 40 | 3300028666 | Ga0265336_10040388 | Ga0265336_100403882 | 230 |
| 41 | 3300028800 | Ga0265338_10001555 | Ga0265338_1000155512 | 230 |
| 42 | 3300029957 | Ga0265324_10001313 | Ga0265324_100013135 | 230 |
| 43 | 3300031240 | Ga0265320_10007446 | Ga0265320_100074468 | 230 |
| 44 | 3300031247 | Ga0265340_10068061 | Ga0265340_100680612 | 230 |
| 45 | 3300031344 | Ga0265316_10258565 | Ga0265316_102585651 | 230 |
| 46 | 3300044712 | Ga0453684_0861231 | Ga0453684_0861231_154_924 | 230 |
| 47 | 3300045051 | Ga0451576_0083832 | Ga0451576_0083832_806_1558 | 230 |
| 48 | 3300046454 | Ga0495592_0000071 | Ga0495592_0000071_57793_58545 | 230 |
| 49 | 3300046476 | Ga0495662_0006019 | Ga0495662_0006019_4770_5522 | 230 |
| 50 | 3300046477 | Ga0495664_0080670 | Ga0495664_0080670_979_1731 | 230 |
| 51 | 3300046514 | Ga0495618_0015771 | Ga0495618_0015771_951_1703 | 230 |
| 52 | 3300046516 | Ga0495628_0002709 | Ga0495628_0002709_12920_13672 | 230 |
| 53 | 3300046517 | Ga0495630_0055300 | Ga0495630_0055300_292_1044 | 230 |
| 54 | 3300046526 | Ga0495666_0044371 | Ga0495666_0044371_179_931 | 230 |
| 55 | 3300046529 | Ga0495652_0093645 | Ga0495652_0093645_964_1716 | 230 |
| 56 | 3300046535 | Ga0495586_0000414 | Ga0495586_0000414_5423_6175 | 230 |
| 57 | 3300046543 | Ga0495645_0013692 | Ga0495645_0013692_2097_2849 | 230 |
| 58 | 3300046678 | Ga0495599_0028937 | Ga0495599_0028937_1417_2169 | 230 |
| 59 | 3300046690 | Ga0495624_0041943 | Ga0495624_0041943_114_866 | 230 |
| 60 | 3300047315 | Ga0495581_0294822 | Ga0495581_0294822_179_931 | 230 |
| 61 | 3300047471 | Ga0495684_0151268 | Ga0495684_0151268_997_1716 | 230 |
| 62 | 3300048910 | Ga0496107_0053685 | Ga0496107_0053685_932_1651 | 230 |
| 63 | 3300003320 | rootH2_10133559 | rootH2_101335594 | 231 |
| 64 | 3300005327 | Ga0070658_10332830 | Ga0070658_103328302 | 231 |
| 65 | 3300005330 | Ga0070690_100001338 | Ga0070690_10000133812 | 231 |
| 66 | 3300005330 | Ga0070690_100219697 | Ga0070690_1002196972 | 231 |
| 67 | 3300005334 | Ga0068869_100379402 | Ga0068869_1003794022 | 231 |
| 68 | 3300005334 | Ga0068869_100447975 | Ga0068869_1004479751 | 231 |
| 69 | 3300005336 | Ga0070680_100211839 | Ga0070680_1002118392 | 231 |
| 70 | 3300005340 | Ga0070689_100017117 | Ga0070689_1000171175 | 231 |
| 71 | 3300005340 | Ga0070689_100094831 | Ga0070689_1000948312 | 231 |
| 72 | 3300005340 | Ga0070689_100559149 | Ga0070689_1005591491 | 231 |
| 73 | 3300005365 | Ga0070688_100051220 | Ga0070688_1000512203 | 231 |
| 74 | 3300005365 | Ga0070688_100054959 | Ga0070688_1000549593 | 231 |
| 75 | 3300005435 | Ga0070714_100083529 | Ga0070714_1000835293 | 231 |
| 76 | 3300005458 | Ga0070681_10044186 | Ga0070681_100441864 | 231 |
| 77 | 3300005459 | Ga0068867_100372525 | Ga0068867_1003725251 | 231 |
| 78 | 3300005530 | Ga0070679_100534764 | Ga0070679_1005347641 | 231 |
| 79 | 3300005539 | Ga0068853_100751131 | Ga0068853_1007511312 | 231 |
| 80 | 3300005549 | Ga0070704_100270633 | Ga0070704_1002706332 | 231 |
| 81 | 3300005563 | Ga0068855_100055494 | Ga0068855_1000554942 | 231 |
| 82 | 3300005563 | Ga0068855_100102674 | Ga0068855_1001026742 | 231 |
| 83 | 3300005563 | Ga0068855_100372285 | Ga0068855_1003722852 | 231 |
| 84 | 3300005617 | Ga0068859_100017251 | Ga0068859_1000172519 | 231 |
| 85 | 3300005617 | Ga0068859_100083423 | Ga0068859_1000834232 | 231 |
| 86 | 3300005617 | Ga0068859_100137253 | Ga0068859_1001372533 | 231 |
| 87 | 3300005841 | Ga0068863_100192185 | Ga0068863_1001921852 | 231 |
| 88 | 3300005841 | Ga0068863_100538367 | Ga0068863_1005383672 | 231 |
| 89 | 3300005843 | Ga0068860_100190223 | Ga0068860_1001902232 | 231 |
| 90 | 3300005844 | Ga0068862_100224102 | Ga0068862_1002241022 | 231 |
| 91 | 3300006028 | Ga0070717_10373764 | Ga0070717_103737642 | 231 |
| 92 | 3300006237 | Ga0097621_100048212 | Ga0097621_1000482122 | 231 |
| 93 | 3300006237 | Ga0097621_100170018 | Ga0097621_1001700182 | 231 |
| 94 | 3300006358 | Ga0068871_100022554 | Ga0068871_1000225544 | 231 |
| 95 | 3300006847 | Ga0075431_100024295 | Ga0075431_1000242956 | 231 |
| 96 | 3300006881 | Ga0068865_100178938 | Ga0068865_1001789382 | 231 |
| 97 | 3300006914 | Ga0075436_100000010 | Ga0075436_10000001076 | 231 |
| 98 | 3300006931 | Ga0097620_100017251 | Ga0097620_1000172519 | 231 |
| 99 | 3300006931 | Ga0097620_100083423 | Ga0097620_1000834232 | 231 |
| 100 | 3300006931 | Ga0097620_100137265 | Ga0097620_1001372653 | 231 |
| 101 | 3300009093 | Ga0105240_10031649 | Ga0105240_100316498 | 231 |
| 102 | 3300009093 | Ga0105240_10102261 | Ga0105240_101022613 | 231 |
| 103 | 3300009093 | Ga0105240_10266308 | Ga0105240_102663083 | 231 |
| 104 | 3300009093 | Ga0105240_10486596 | Ga0105240_104865962 | 231 |
| 105 | 3300009093 | Ga0105240_10925269 | Ga0105240_109252691 | 231 |
| 106 | 3300009094 | Ga0111539_10403246 | Ga0111539_104032462 | 231 |
| 107 | 3300009094 | Ga0111539_10660926 | Ga0111539_106609262 | 231 |
| 108 | 3300009098 | Ga0105245_11299634 | Ga0105245_112996341 | 231 |
| 109 | 3300009177 | Ga0105248_10097826 | Ga0105248_100978263 | 231 |
| 110 | 3300009177 | Ga0105248_10353209 | Ga0105248_103532092 | 231 |
| 111 | 3300009177 | Ga0105248_10529843 | Ga0105248_105298432 | 231 |
| 112 | 3300009551 | Ga0105238_10027652 | Ga0105238_100276522 | 231 |
| 113 | 3300009551 | Ga0105238_10039645 | Ga0105238_100396452 | 231 |
| 114 | 3300009551 | Ga0105238_10241885 | Ga0105238_102418852 | 231 |
| 115 | 3300013104 | Ga0157370_10051303 | Ga0157370_100513033 | 231 |
| 116 | 3300013296 | Ga0157374_10263774 | Ga0157374_102637742 | 231 |
| 117 | 3300013296 | Ga0157374_10273072 | Ga0157374_102730722 | 231 |
| 118 | 3300013296 | Ga0157374_10538911 | Ga0157374_105389112 | 231 |
| 119 | 3300013297 | Ga0157378_10615758 | Ga0157378_106157582 | 231 |
| 120 | 3300013307 | Ga0157372_10127089 | Ga0157372_101270893 | 231 |
| 121 | 3300013308 | Ga0157375_10000081 | Ga0157375_1000008170 | 231 |
| 122 | 3300013308 | Ga0157375_11150729 | Ga0157375_111507291 | 231 |
| 123 | 3300014325 | Ga0163163_10000014 | Ga0163163_1000001417 | 231 |
| 124 | 3300014745 | Ga0157377_10181175 | Ga0157377_101811752 | 231 |
| 125 | 3300014969 | Ga0157376_10078007 | Ga0157376_100780072 | 231 |
| 126 | 3300025909 | Ga0207705_10274016 | Ga0207705_102740162 | 231 |
| 127 | 3300025913 | Ga0207695_10039261 | Ga0207695_100392616 | 231 |
| 128 | 3300025913 | Ga0207695_10088435 | Ga0207695_100884352 | 231 |
| 129 | 3300025913 | Ga0207695_10413701 | Ga0207695_104137012 | 231 |
| 130 | 3300025913 | Ga0207695_10570128 | Ga0207695_105701282 | 231 |
| 131 | 3300025915 | Ga0207693_10201859 | Ga0207693_102018591 | 231 |
| 132 | 3300025921 | Ga0207652_10236362 | Ga0207652_102363622 | 231 |
| 133 | 3300025921 | Ga0207652_10252146 | Ga0207652_102521462 | 231 |
| 134 | 3300025922 | Ga0207646_10332856 | Ga0207646_103328562 | 231 |
| 135 | 3300025924 | Ga0207694_10009718 | Ga0207694_100097183 | 231 |
| 136 | 3300025924 | Ga0207694_10135819 | Ga0207694_101358191 | 231 |
| 137 | 3300025924 | Ga0207694_10222677 | Ga0207694_102226772 | 231 |
| 138 | 3300025924 | Ga0207694_10368677 | Ga0207694_103686772 | 231 |
| 139 | 3300025927 | Ga0207687_10485576 | Ga0207687_104855761 | 231 |
| 140 | 3300025929 | Ga0207664_10024385 | Ga0207664_100243854 | 231 |
| 141 | 3300025936 | Ga0207670_10040380 | Ga0207670_100403802 | 231 |
| 142 | 3300025949 | Ga0207667_10066422 | Ga0207667_100664225 | 231 |
| 143 | 3300025949 | Ga0207667_10094126 | Ga0207667_100941262 | 231 |
| 144 | 3300026041 | Ga0207639_10212258 | Ga0207639_102122582 | 231 |
| 145 | 3300026075 | Ga0207708_10105704 | Ga0207708_101057042 | 231 |
| 146 | 3300026078 | Ga0207702_10008996 | Ga0207702_100089965 | 231 |
| 147 | 3300026088 | Ga0207641_10354077 | Ga0207641_103540772 | 231 |
| 148 | 3300026088 | Ga0207641_10481559 | Ga0207641_104815592 | 231 |
| 149 | 3300026116 | Ga0207674_10020912 | Ga0207674_100209125 | 231 |
| 150 | 3300026142 | Ga0207698_10304301 | Ga0207698_103043012 | 231 |
| 151 | 3300028556 | Ga0265337_1001206 | Ga0265337_100120614 | 231 |
| 152 | 3300028556 | Ga0265337_1005308 | Ga0265337_10053083 | 231 |
| 153 | 3300028556 | Ga0265337_1005786 | Ga0265337_10057865 | 231 |
| 154 | 3300028556 | Ga0265337_1026482 | Ga0265337_10264822 | 231 |
| 155 | 3300028556 | Ga0265337_1037090 | Ga0265337_10370902 | 231 |
| 156 | 3300028556 | Ga0265337_1052999 | Ga0265337_10529991 | 231 |
| 157 | 3300028556 | Ga0265337_1068718 | Ga0265337_10687182 | 231 |
| 158 | 3300028558 | Ga0265326_10007590 | Ga0265326_100075901 | 231 |
| 159 | 3300028558 | Ga0265326_10011195 | Ga0265326_100111953 | 231 |
| 160 | 3300028563 | Ga0265319_1000007 | Ga0265319_100000791 | 231 |
| 161 | 3300028563 | Ga0265319_1006732 | Ga0265319_10067325 | 231 |
| 162 | 3300028563 | Ga0265319_1012190 | Ga0265319_10121903 | 231 |
| 163 | 3300028573 | Ga0265334_10033223 | Ga0265334_100332233 | 231 |
| 164 | 3300028577 | Ga0265318_10013573 | Ga0265318_100135733 | 231 |
| 165 | 3300028653 | Ga0265323_10000237 | Ga0265323_1000023736 | 231 |
| 166 | 3300028653 | Ga0265323_10004158 | Ga0265323_100041582 | 231 |
| 167 | 3300028653 | Ga0265323_10113297 | Ga0265323_101132972 | 231 |
| 168 | 3300028654 | Ga0265322_10005305 | Ga0265322_100053053 | 231 |
| 169 | 3300028666 | Ga0265336_10027537 | Ga0265336_100275372 | 231 |
| 170 | 3300028666 | Ga0265336_10064436 | Ga0265336_100644362 | 231 |
| 171 | 3300028800 | Ga0265338_10000053 | Ga0265338_1000005385 | 231 |
| 172 | 3300028800 | Ga0265338_10000077 | Ga0265338_1000007726 | 231 |
| 173 | 3300028800 | Ga0265338_10000431 | Ga0265338_100004316 | 231 |
| 174 | 3300028800 | Ga0265338_10000945 | Ga0265338_100009459 | 231 |
| 175 | 3300028800 | Ga0265338_10004123 | Ga0265338_1000412313 | 231 |
| 176 | 3300028800 | Ga0265338_10006708 | Ga0265338_1000670812 | 231 |
| 177 | 3300028800 | Ga0265338_10008187 | Ga0265338_100081874 | 231 |
| 178 | 3300028800 | Ga0265338_10009242 | Ga0265338_1000924213 | 231 |
| 179 | 3300028800 | Ga0265338_10019978 | Ga0265338_100199788 | 231 |
| 180 | 3300028800 | Ga0265338_10038737 | Ga0265338_100387374 | 231 |
| 181 | 3300028800 | Ga0265338_10038772 | Ga0265338_100387727 | 231 |
| 182 | 3300028800 | Ga0265338_10044035 | Ga0265338_100440357 | 231 |
| 183 | 3300028800 | Ga0265338_10053208 | Ga0265338_100532082 | 231 |
| 184 | 3300028800 | Ga0265338_10058553 | Ga0265338_100585533 | 231 |
| 185 | 3300028800 | Ga0265338_10063334 | Ga0265338_100633342 | 231 |
| 186 | 3300028800 | Ga0265338_10067922 | Ga0265338_100679222 | 231 |
| 187 | 3300028800 | Ga0265338_10089433 | Ga0265338_100894333 | 231 |
| 188 | 3300028800 | Ga0265338_10091761 | Ga0265338_100917611 | 231 |
| 189 | 3300028800 | Ga0265338_10457515 | Ga0265338_104575151 | 231 |
| 190 | 3300029957 | Ga0265324_10009663 | Ga0265324_100096632 | 231 |
| 191 | 3300029957 | Ga0265324_10011848 | Ga0265324_100118483 | 231 |
| 192 | 3300029957 | Ga0265324_10036792 | Ga0265324_100367922 | 231 |
| 193 | 3300029957 | Ga0265324_10065691 | Ga0265324_100656911 | 231 |
| 194 | 3300031238 | Ga0265332_10032199 | Ga0265332_100321994 | 231 |
| 195 | 3300031239 | Ga0265328_10133926 | Ga0265328_101339261 | 231 |
| 196 | 3300031240 | Ga0265320_10000188 | Ga0265320_100001886 | 231 |
| 197 | 3300031240 | Ga0265320_10000340 | Ga0265320_100003404 | 231 |
| 198 | 3300031240 | Ga0265320_10017897 | Ga0265320_100178978 | 231 |
| 199 | 3300031240 | Ga0265320_10039006 | Ga0265320_100390062 | 231 |
| 200 | 3300031240 | Ga0265320_10077656 | Ga0265320_100776562 | 231 |
| 201 | 3300031242 | Ga0265329_10002481 | Ga0265329_100024815 | 231 |
| 202 | 3300031247 | Ga0265340_10000803 | Ga0265340_1000080317 | 231 |
| 203 | 3300031247 | Ga0265340_10048205 | Ga0265340_100482052 | 231 |
| 204 | 3300031247 | Ga0265340_10235784 | Ga0265340_102357841 | 231 |
| 205 | 3300031249 | Ga0265339_10013563 | Ga0265339_100135634 | 231 |
| 206 | 3300031249 | Ga0265339_10152803 | Ga0265339_101528032 | 231 |
| 207 | 3300031251 | Ga0265327_10010259 | Ga0265327_100102593 | 231 |
| 208 | 3300031251 | Ga0265327_10015959 | Ga0265327_100159592 | 231 |
| 209 | 3300031344 | Ga0265316_10019839 | Ga0265316_1001983910 | 231 |
| 210 | 3300031344 | Ga0265316_10026613 | Ga0265316_100266135 | 231 |
| 211 | 3300031344 | Ga0265316_10027692 | Ga0265316_100276926 | 231 |
| 212 | 3300031344 | Ga0265316_10044485 | Ga0265316_100444854 | 231 |
| 213 | 3300031344 | Ga0265316_10079495 | Ga0265316_100794953 | 231 |
| 214 | 3300031344 | Ga0265316_10101225 | Ga0265316_101012253 | 231 |
| 215 | 3300031344 | Ga0265316_10330635 | Ga0265316_103306352 | 231 |
| 216 | 3300031595 | Ga0265313_10006728 | Ga0265313_100067281 | 231 |
| 217 | 3300031595 | Ga0265313_10007547 | Ga0265313_1000754711 | 231 |
| 218 | 3300031665 | Ga0316575_10127735 | Ga0316575_101277352 | 231 |
| 219 | 3300031711 | Ga0265314_10000234 | Ga0265314_1000023413 | 231 |
| 220 | 3300031711 | Ga0265314_10004107 | Ga0265314_1000410710 | 231 |
| 221 | 3300031711 | Ga0265314_10074318 | Ga0265314_100743182 | 231 |
| 222 | 3300031711 | Ga0265314_10091629 | Ga0265314_100916294 | 231 |
| 223 | 3300031712 | Ga0265342_10049892 | Ga0265342_100498923 | 231 |
| 224 | 3300031712 | Ga0265342_10061610 | Ga0265342_100616101 | 231 |
| 225 | 3300031712 | Ga0265342_10111003 | Ga0265342_101110032 | 231 |
| 226 | 3300031712 | Ga0265342_10215947 | Ga0265342_102159472 | 231 |
| 227 | 3300031727 | Ga0316576_10130455 | Ga0316576_101304552 | 231 |
| 228 | 3300031728 | Ga0316578_10125421 | Ga0316578_101254212 | 231 |
| 229 | 3300031731 | Ga0307405_10366450 | Ga0307405_103664502 | 231 |
| 230 | 3300031911 | Ga0307412_10165186 | Ga0307412_101651862 | 231 |
| 231 | 3300032137 | Ga0316585_10068001 | Ga0316585_100680012 | 231 |
| 232 | 3300032139 | Ga0316580_10044893 | Ga0316580_100448932 | 231 |
| 233 | 3300034816 | Ga0373930_0006890 | Ga0373930_0006890_385_1086 | 231 |
| 234 | 3300035084 | Ga0373928_0000124 | Ga0373928_0000124_2883_3584 | 231 |
| 235 | 3300035084 | Ga0373928_0054406 | Ga0373928_0054406_156_893 | 231 |
| 236 | 3300035085 | Ga0373929_0003510 | Ga0373929_0003510_1878_2579 | 231 |
| 237 | 3300035089 | Ga0373944_0001750 | Ga0373944_0001750_694_1395 | 231 |
| 238 | 3300035090 | Ga0373949_0002065 | Ga0373949_0002065_3151_3852 | 231 |
| 239 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1158049_1158750 | 231 |
| 240 | 3300035116 | Ga0373945_0014422 | Ga0373945_0014422_1819_2520 | 231 |
| 241 | 3300035118 | Ga0373954_0017890 | Ga0373954_0017890_1991_2716 | 231 |
| 242 | 3300035119 | Ga0373956_0001448 | Ga0373956_0001448_6216_6941 | 231 |
| 243 | 3300035171 | Ga0373946_0194665 | Ga0373946_0194665_244_945 | 231 |
| 244 | 3300035172 | Ga0373955_0027089 | Ga0373955_0027089_1093_1818 | 231 |
| 245 | 3300035242 | Ga0373962_0000018 | Ga0373962_0000018_26018_26719 | 231 |
| 246 | 3300035398 | Ga0316574_0036363 | Ga0316574_0036363_1164_1895 | 231 |
| 247 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_336648_337349 | 231 |
| 248 | 3300035691 | Ga0373931_0113718 | Ga0373931_0113718_423_1160 | 231 |
| 249 | 3300035692 | Ga0373935_0061313 | Ga0373935_0061313_1378_2079 | 231 |
| 250 | 3300035695 | Ga0373927_0020235 | Ga0373927_0020235_3014_3724 | 231 |
| 251 | 3300035695 | Ga0373927_0061743 | Ga0373927_0061743_505_1206 | 231 |
| 252 | 3300035695 | Ga0373927_0071130 | Ga0373927_0071130_22_723 | 231 |
| 253 | 3300035724 | Ga0373933_0186354 | Ga0373933_0186354_46_768 | 231 |
| 254 | 3300036401 | Ga0373937_0012068 | Ga0373937_0012068_5002_5727 | 231 |
| 255 | 3300036401 | Ga0373937_0092835 | Ga0373937_0092835_691_1422 | 231 |
| 256 | 3300036712 | Ga0316584_0048688 | Ga0316584_0048688_923_1654 | 231 |
| 257 | 3300037068 | Ga0373925_0000552 | Ga0373925_0000552_24527_25228 | 231 |
| 258 | 3300037068 | Ga0373925_0017241 | Ga0373925_0017241_4100_4810 | 231 |
| 259 | 3300042876 | Ga0451577_0087088 | Ga0451577_0087088_1644_2381 | 231 |
| 260 | 3300042876 | Ga0451577_0212673 | Ga0451577_0212673_682_1452 | 231 |
| 261 | 3300042876 | Ga0451577_0465884 | Ga0451577_0465884_78_815 | 231 |
| 262 | 3300042876 | Ga0451577_0492798 | Ga0451577_0492798_240_971 | 231 |
| 263 | 3300044712 | Ga0453684_0002419 | Ga0453684_0002419_43246_43983 | 231 |
| 264 | 3300044712 | Ga0453684_0049040 | Ga0453684_0049040_3846_4601 | 231 |
| 265 | 3300044712 | Ga0453684_0117679 | Ga0453684_0117679_1731_2498 | 231 |
| 266 | 3300044712 | Ga0453684_0247908 | Ga0453684_0247908_1035_1787 | 231 |
| 267 | 3300044712 | Ga0453684_0370766 | Ga0453684_0370766_433_1164 | 231 |
| 268 | 3300045051 | Ga0451576_0032180 | Ga0451576_0032180_2308_3039 | 231 |
| 269 | 3300045051 | Ga0451576_0033408 | Ga0451576_0033408_1128_1859 | 231 |
| 270 | 3300045051 | Ga0451576_0156435 | Ga0451576_0156435_857_1588 | 231 |
| 271 | 3300045051 | Ga0451576_0208556 | Ga0451576_0208556_1259_1999 | 231 |
| 272 | 3300045051 | Ga0451576_0432054 | Ga0451576_0432054_364_1098 | 231 |
| 273 | 3300045051 | Ga0451576_1021188 | Ga0451576_1021188_45_791 | 231 |
| 274 | 3300046459 | Ga0495629_0033474 | Ga0495629_0033474_887_1612 | 231 |
| 275 | 3300046473 | Ga0495582_0276401 | Ga0495582_0276401_171_902 | 231 |
| 276 | 3300046476 | Ga0495662_0007368 | Ga0495662_0007368_3113_3844 | 231 |
| 277 | 3300046476 | Ga0495662_0031709 | Ga0495662_0031709_1114_1845 | 231 |
| 278 | 3300046477 | Ga0495664_0017257 | Ga0495664_0017257_1477_2217 | 231 |
| 279 | 3300046514 | Ga0495618_0002646 | Ga0495618_0002646_5305_6030 | 231 |
| 280 | 3300046516 | Ga0495628_0008425 | Ga0495628_0008425_6148_6888 | 231 |
| 281 | 3300046517 | Ga0495630_0000220 | Ga0495630_0000220_34402_35133 | 231 |
| 282 | 3300046517 | Ga0495630_0030594 | Ga0495630_0030594_614_1354 | 231 |
| 283 | 3300046517 | Ga0495630_0066606 | Ga0495630_0066606_1298_2020 | 231 |
| 284 | 3300046517 | Ga0495630_0244560 | Ga0495630_0244560_286_1020 | 231 |
| 285 | 3300046526 | Ga0495666_0001943 | Ga0495666_0001943_3003_3734 | 231 |
| 286 | 3300046526 | Ga0495666_0045898 | Ga0495666_0045898_49_780 | 231 |
| 287 | 3300046533 | Ga0495640_0020910 | Ga0495640_0020910_421_1152 | 231 |
| 288 | 3300046533 | Ga0495640_0055384 | Ga0495640_0055384_607_1332 | 231 |
| 289 | 3300046533 | Ga0495640_0072441 | Ga0495640_0072441_40_762 | 231 |
| 290 | 3300046535 | Ga0495586_0000017 | Ga0495586_0000017_45496_46227 | 231 |
| 291 | 3300046535 | Ga0495586_0002311 | Ga0495586_0002311_4370_5095 | 231 |
| 292 | 3300046535 | Ga0495586_0006922 | Ga0495586_0006922_2837_3568 | 231 |
| 293 | 3300046535 | Ga0495586_0085125 | Ga0495586_0085125_26_748 | 231 |
| 294 | 3300046535 | Ga0495586_0183191 | Ga0495586_0183191_243_998 | 231 |
| 295 | 3300046535 | Ga0495586_0191258 | Ga0495586_0191258_72_803 | 231 |
| 296 | 3300046536 | Ga0495587_0034039 | Ga0495587_0034039_2276_3016 | 231 |
| 297 | 3300046543 | Ga0495645_0072585 | Ga0495645_0072585_1753_2466 | 231 |
| 298 | 3300046543 | Ga0495645_0146237 | Ga0495645_0146237_905_1630 | 231 |
| 299 | 3300046559 | Ga0495667_0044763 | Ga0495667_0044763_232_954 | 231 |
| 300 | 3300046642 | Ga0495634_0002060 | Ga0495634_0002060_10205_10930 | 231 |
| 301 | 3300046642 | Ga0495634_0021601 | Ga0495634_0021601_1653_2384 | 231 |
| 302 | 3300046642 | Ga0495634_0120525 | Ga0495634_0120525_865_1605 | 231 |
| 303 | 3300046642 | Ga0495634_0340033 | Ga0495634_0340033_128_850 | 231 |
| 304 | 3300046663 | Ga0495635_0051747 | Ga0495635_0051747_1248_1973 | 231 |
| 305 | 3300046678 | Ga0495599_0008795 | Ga0495599_0008795_3597_4328 | 231 |
| 306 | 3300046683 | Ga0495658_0033772 | Ga0495658_0033772_1480_2211 | 231 |
| 307 | 3300046684 | Ga0495669_0120297 | Ga0495669_0120297_293_1024 | 231 |
| 308 | 3300046689 | Ga0495613_0007595 | Ga0495613_0007595_2660_3391 | 231 |
| 309 | 3300046689 | Ga0495613_0008269 | Ga0495613_0008269_4511_5236 | 231 |
| 310 | 3300046689 | Ga0495613_0451719 | Ga0495613_0451719_103_825 | 231 |
| 311 | 3300046809 | Ga0495600_0204788 | Ga0495600_0204788_371_1096 | 231 |
| 312 | 3300046809 | Ga0495600_0302029 | Ga0495600_0302029_86_808 | 231 |
| 313 | 3300047319 | Ga0495674_0000243 | Ga0495674_0000243_8517_9248 | 231 |
| 314 | 3300047319 | Ga0495674_0057421 | Ga0495674_0057421_2071_2811 | 231 |
| 315 | 3300047322 | Ga0495680_0013067 | Ga0495680_0013067_1371_2096 | 231 |
| 316 | 3300047322 | Ga0495680_0460283 | Ga0495680_0460283_64_804 | 231 |
| 317 | 3300047444 | Ga0495675_0114655 | Ga0495675_0114655_688_1410 | 231 |
| 318 | 3300047471 | Ga0495684_0115880 | Ga0495684_0115880_517_1242 | 231 |
| 319 | 3300048918 | Ga0496115_0005450 | Ga0496115_0005450_6082_6813 | 231 |
| 320 | 3300049568 | Ga0501031_0000199 | Ga0501031_0000199_3122_3823 | 231 |
| 321 | 3300049569 | Ga0501032_0001311 | Ga0501032_0001311_5358_6059 | 231 |
| 322 | 3300049570 | Ga0501033_0001401 | Ga0501033_0001401_20587_21288 | 231 |
| 323 | 3300049575 | Ga0501039_0134925 | Ga0501039_0134925_1004_1705 | 231 |
| 324 | 3300049580 | Ga0501046_0301475 | Ga0501046_0301475_73_828 | 231 |
| 325 | 3300049742 | Ga0501080_0043677 | Ga0501080_0043677_2740_3435 | 231 |
| 326 | 3300049822 | Ga0501035_0003191 | Ga0501035_0003191_7724_8425 | 231 |
| 327 | 3300049822 | Ga0501035_0064556 | Ga0501035_0064556_537_1292 | 231 |
| 328 | 3300049823 | Ga0501044_0000125 | Ga0501044_0000125_56128_56829 | 231 |
| 329 | 3300049823 | Ga0501044_0089719 | Ga0501044_0089719_1486_2187 | 231 |
| 330 | 3300049823 | Ga0501044_0152331 | Ga0501044_0152331_1557_2252 | 231 |
| 331 | 3300050510 | nmdc:mga06r32_173170_c1 | nmdc:mga06r32_173170_c1_284_1066 | 231 |
| 332 | 3300050511 | nmdc:mga08y16_225015_c1 | nmdc:mga08y16_225015_c1_367_1128 | 231 |
| 333 | 3300053077 | Ga0495601_0038908 | Ga0495601_0038908_1873_2598 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h70-assembly1.cif.gz_A | crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7 | 0.9361 | 22 | 227 |
| 4rzx-assembly1.cif.gz_B | crystal structure (type-3) of dtmp kinase (st1543) from sulfolobus tokodaii strain7 | 0.9331 | 22 | 225 |
| 5h70-assembly1.cif.gz_B | crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7 | 0.9281 | 22 | 227 |
| 5h70-assembly1.cif.gz_A | crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7 | 0.9274 | 22 | 227 |
| 4nzy-assembly1.cif.gz_B | crystal structure (type-2) of dtmp kinase (st1543) from sulfolobus tokodaii strain7 | 0.922 | 22 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rzxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9331 | 22 | 225 | 3.40.50.300 |
| 4rzxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9152 | 22 | 225 | 3.40.50.300 |
| af_A1ZB29_2_211_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9102 | 20 | 228 | 3.40.50.300 |
| af_Q57741_3_187_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9087 | 22 | 225 | 3.40.50.300 |
| af_B7ZZT5_48_255_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9021 | 22 | 227 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5YZY0-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9805 | 4 | 228 |
GO:0004798
GO:0005524 GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A838N989-F1-model_v4 | deleted | 0.9791 | 28 | 228 |
|
| AF-A0A7C4PQB5-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9779 | 3 | 231 |
GO:0004798
GO:0005524 GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A2D6N5P9-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9754 | 5 | 229 |
GO:0004798
GO:0005524 GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A2V5X198-F1-model_v4 | Thymidylate kinase | 0.9745 | 29 | 231 |
GO:0004798
GO:0005737 GO:0006227 GO:0006233 GO:0006235 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar