F411313

General Info

Members Datasets Scaffolds Average Seq Length
333 161 333 241

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100000010|Ga0075436_10000001076
Length 249
Sequence VRTRALRASTYGTRLPGLPREPLTGRLIVIEGADGSGRTTEVGLLRDWLEIQGHPVVESGLRRSTLVAEQIDRAKQGHTLGGTTLALFYAVDFADQLENKILPALAAGSTVLADRYIYTLMARAIVRGASRAWAEKLYSFALKPDLVLLLDAKPDVLLHRSIGKYGSLDYWESGMDLSLSRDRFESFFLYQARLAAEIDWMVKEYGFYKIDANRSPNAVHADVRRLVQQIYKDGVDRSRNGRARRAAAA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
90 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
91 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10133559 3300003320 Bacteria 4771
2 Ga0065707_10211350 3300005295 Bacteria 1264
3 Ga0070658_10332830 3300005327 Bacteria 1298
4 Ga0070690_100001338 3300005330 Bacteria 12805
5 Ga0070690_100219697 3300005330 Bacteria 1331
6 Ga0070670_100246649 3300005331 Bacteria 1555
7 Ga0068869_100379402 3300005334 Unclassified 1158
8 Ga0068869_100447975 3300005334 Bacteria 1070
9 Ga0070680_100211839 3300005336 Unclassified 1635
10 Ga0070689_100017117 3300005340 Bacteria 5318
11 Ga0070689_100094831 3300005340 Bacteria 2356
12 Ga0070689_100559149 3300005340 Bacteria 986
13 Ga0070688_100051220 3300005365 Bacteria 2575
14 Ga0070688_100054959 3300005365 Unclassified 2496
15 Ga0070714_100083529 3300005435 Bacteria 2785
16 Ga0070681_10044186 3300005458 Bacteria 4459
17 Ga0068867_100372525 3300005459 Unclassified 1197
18 Ga0070679_100534764 3300005530 Unclassified 1116
19 Ga0068853_100751131 3300005539 Unclassified 932
20 Ga0070704_100019922 3300005549 Bacteria 4317
21 Ga0070704_100270633 3300005549 Unclassified 1403
22 Ga0068855_100055494 3300005563 Unclassified 4653
23 Ga0068855_100102674 3300005563 Bacteria 3291
24 Ga0068855_100372285 3300005563 Unclassified 1570
25 Ga0068855_100493358 3300005563 Bacteria 1332
26 Ga0068859_100017251 3300005617 Bacteria 7251
27 Ga0068859_100083423 3300005617 Bacteria 3239
28 Ga0068859_100137253 3300005617 Bacteria 2519
29 Ga0068863_100192185 3300005841 Bacteria 1962
30 Ga0068863_100538367 3300005841 Unclassified 1152
31 Ga0068863_100553147 3300005841 Unclassified 1136
32 Ga0068860_100190223 3300005843 Bacteria 1986
33 Ga0068862_100224102 3300005844 Bacteria 1703
34 Ga0070717_10295458 3300006028 Unclassified 1439
35 Ga0070717_10373764 3300006028 Unclassified 1277
36 Ga0097621_100048212 3300006237 Bacteria 3455
37 Ga0097621_100170018 3300006237 Bacteria 1878
38 Ga0097621_100349123 3300006237 Bacteria 1315
39 Ga0068871_100022554 3300006358 Bacteria 4855
40 Ga0075431_100024295 3300006847 Bacteria 6208
41 Ga0075429_100331860 3300006880 Bacteria 1331
42 Ga0068865_100178938 3300006881 Bacteria 1632
43 Ga0075436_100000010 3300006914 Bacteria 248382
44 Ga0075436_100000508 3300006914 Bacteria 25170
45 Ga0097620_100017251 3300006931 Bacteria 7251
46 Ga0097620_100083423 3300006931 Bacteria 3239
47 Ga0097620_100137265 3300006931 Bacteria 2519
48 Ga0105240_10031649 3300009093 Bacteria 6855
49 Ga0105240_10102261 3300009093 Unclassified 3483
50 Ga0105240_10266308 3300009093 Unclassified 1975
51 Ga0105240_10486596 3300009093 Unclassified 1374
52 Ga0105240_10925269 3300009093 Unclassified 937
53 Ga0111539_10032397 3300009094 Bacteria 6346
54 Ga0111539_10086838 3300009094 Unclassified 3675
55 Ga0111539_10403246 3300009094 Unclassified 1593
56 Ga0111539_10660926 3300009094 Bacteria 1217
57 Ga0105245_11299634 3300009098 Unclassified 776
58 Ga0114129_10960975 3300009147 Unclassified 1078
59 Ga0105248_10097826 3300009177 Bacteria 3306
60 Ga0105248_10353209 3300009177 Unclassified 1655
61 Ga0105248_10529843 3300009177 Bacteria 1329
62 Ga0105238_10027652 3300009551 Bacteria 5781
63 Ga0105238_10039645 3300009551 Bacteria 4776
64 Ga0105238_10055881 3300009551 Unclassified 3961
65 Ga0105238_10241885 3300009551 Unclassified 1782
66 Ga0157370_10051303 3300013104 Bacteria 3940
67 Ga0157374_10263774 3300013296 Unclassified 1697
68 Ga0157374_10273072 3300013296 Unclassified 1667
69 Ga0157374_10538911 3300013296 Unclassified 1174
70 Ga0157378_10615758 3300013297 Unclassified 1098
71 Ga0163162_10404114 3300013306 Bacteria 1498
72 Ga0157372_10127089 3300013307 Bacteria 2931
73 Ga0157375_10000081 3300013308 Bacteria 96625
74 Ga0157375_11150729 3300013308 Bacteria 909
75 Ga0163163_10000014 3300014325 Bacteria 231615
76 Ga0157377_10181175 3300014745 Unclassified 1325
77 Ga0157376_10078007 3300014969 Bacteria 2835
78 Ga0206350_10624404 3300020080 Unclassified 1917
79 Ga0224712_10019917 3300022467 Bacteria 2270
80 Ga0207705_10274016 3300025909 Unclassified 1291
81 Ga0207695_10039261 3300025913 Bacteria 5088
82 Ga0207695_10088435 3300025913 Bacteria 3118
83 Ga0207695_10413701 3300025913 Unclassified 1233
84 Ga0207695_10570128 3300025913 Unclassified 1013
85 Ga0207693_10201859 3300025915 Bacteria 1564
86 Ga0207652_10236362 3300025921 Unclassified 1647
87 Ga0207652_10252146 3300025921 Bacteria 1592
88 Ga0207646_10332856 3300025922 Bacteria 1372
89 Ga0207694_10009718 3300025924 Bacteria 7256
90 Ga0207694_10061182 3300025924 Unclassified 2930
91 Ga0207694_10135819 3300025924 Bacteria 1975
92 Ga0207694_10222677 3300025924 Bacteria 1539
93 Ga0207694_10368677 3300025924 Unclassified 1191
94 Ga0207687_10485576 3300025927 Unclassified 1029
95 Ga0207664_10024385 3300025929 Bacteria 4545
96 Ga0207670_10040380 3300025936 Bacteria 3062
97 Ga0207667_10066422 3300025949 Bacteria 3759
98 Ga0207667_10094126 3300025949 Bacteria 3094
99 Ga0207667_10450190 3300025949 Bacteria 1308
100 Ga0207639_10212258 3300026041 Unclassified 1667
101 Ga0207708_10105704 3300026075 Bacteria 2182
102 Ga0207702_10008996 3300026078 Bacteria 8411
103 Ga0207641_10354077 3300026088 Bacteria 1400
104 Ga0207641_10481559 3300026088 Unclassified 1203
105 Ga0207641_10545765 3300026088 Unclassified 1130
106 Ga0207674_10020912 3300026116 Bacteria 7062
107 Ga0207698_10304301 3300026142 Bacteria 1486
108 Ga0268265_10359800 3300028380 Bacteria 1332
109 Ga0265337_1000140 3300028556 Bacteria 36107
110 Ga0265337_1001206 3300028556 Bacteria 13155
111 Ga0265337_1005308 3300028556 Bacteria 5144
112 Ga0265337_1005786 3300028556 Unclassified 4850
113 Ga0265337_1026482 3300028556 Unclassified 1756
114 Ga0265337_1037090 3300028556 Unclassified 1419
115 Ga0265337_1052999 3300028556 Unclassified 1138
116 Ga0265337_1068718 3300028556 Unclassified 975
117 Ga0265326_10007590 3300028558 Bacteria 3316
118 Ga0265326_10011195 3300028558 Bacteria 2647
119 Ga0265319_1000007 3300028563 Bacteria 217194
120 Ga0265319_1005912 3300028563 Bacteria 5755
121 Ga0265319_1006732 3300028563 Bacteria 5275
122 Ga0265319_1012190 3300028563 Bacteria 3484
123 Ga0265334_10033223 3300028573 Unclassified 2054
124 Ga0265318_10013573 3300028577 Bacteria 3436
125 Ga0265323_10000237 3300028653 Bacteria 32647
126 Ga0265323_10004158 3300028653 Bacteria 6270
127 Ga0265323_10113297 3300028653 Unclassified 888
128 Ga0265322_10005305 3300028654 Bacteria 3815
129 Ga0265336_10000819 3300028666 Bacteria 16328
130 Ga0265336_10027537 3300028666 Bacteria 1779
131 Ga0265336_10040388 3300028666 Bacteria 1428
132 Ga0265336_10064436 3300028666 Unclassified 1097
133 Ga0265338_10000053 3300028800 Bacteria 208184
134 Ga0265338_10000077 3300028800 Bacteria 178033
135 Ga0265338_10000431 3300028800 Bacteria 75210
136 Ga0265338_10000945 3300028800 Bacteria 48867
137 Ga0265338_10001555 3300028800 Bacteria 37061
138 Ga0265338_10004123 3300028800 Bacteria 19904
139 Ga0265338_10006708 3300028800 Bacteria 14545
140 Ga0265338_10008187 3300028800 Bacteria 12743
141 Ga0265338_10009242 3300028800 Bacteria 11797
142 Ga0265338_10019978 3300028800 Bacteria 7071
143 Ga0265338_10038737 3300028800 Bacteria 4509
144 Ga0265338_10038772 3300028800 Bacteria 4507
145 Ga0265338_10044035 3300028800 Unclassified 4127
146 Ga0265338_10053208 3300028800 Bacteria 3624
147 Ga0265338_10058553 3300028800 Bacteria 3399
148 Ga0265338_10063334 3300028800 Bacteria 3224
149 Ga0265338_10067922 3300028800 Bacteria 3075
150 Ga0265338_10089433 3300028800 Bacteria 2551
151 Ga0265338_10091761 3300028800 Bacteria 2508
152 Ga0265338_10457515 3300028800 Unclassified 903
153 Ga0265324_10001313 3300029957 Bacteria 14604
154 Ga0265324_10009663 3300029957 Unclassified 3755
155 Ga0265324_10011848 3300029957 Unclassified 3309
156 Ga0265324_10036792 3300029957 Bacteria 1701
157 Ga0265324_10065691 3300029957 Unclassified 1238
158 Ga0265332_10032199 3300031238 Bacteria 2285
159 Ga0265328_10133926 3300031239 Unclassified 928
160 Ga0265320_10000188 3300031240 Bacteria 51229
161 Ga0265320_10000340 3300031240 Bacteria 38089
162 Ga0265320_10007446 3300031240 Bacteria 6792
163 Ga0265320_10017897 3300031240 Unclassified 3918
164 Ga0265320_10039006 3300031240 Unclassified 2378
165 Ga0265320_10077656 3300031240 Unclassified 1553
166 Ga0265329_10002481 3300031242 Bacteria 8331
167 Ga0265340_10000803 3300031247 Bacteria 17782
168 Ga0265340_10048205 3300031247 Bacteria 2072
169 Ga0265340_10068061 3300031247 Bacteria 1691
170 Ga0265340_10235784 3300031247 Unclassified 817
171 Ga0265339_10013563 3300031249 Bacteria 4935
172 Ga0265339_10152803 3300031249 Unclassified 1166
173 Ga0265327_10010259 3300031251 Bacteria 6608
174 Ga0265327_10015959 3300031251 Bacteria 4808
175 Ga0265316_10019839 3300031344 Bacteria 5739
176 Ga0265316_10026613 3300031344 Bacteria 4806
177 Ga0265316_10027692 3300031344 Bacteria 4686
178 Ga0265316_10044485 3300031344 Bacteria 3532
179 Ga0265316_10079495 3300031344 Unclassified 2516
180 Ga0265316_10101225 3300031344 Unclassified 2189
181 Ga0265316_10258565 3300031344 Bacteria 1277
182 Ga0265316_10330635 3300031344 Unclassified 1106
183 Ga0265313_10006728 3300031595 Bacteria 8040
184 Ga0265313_10007547 3300031595 Bacteria 7394
185 Ga0316575_10127735 3300031665 Bacteria 1042
186 Ga0265314_10000234 3300031711 Bacteria 82654
187 Ga0265314_10004107 3300031711 Bacteria 13720
188 Ga0265314_10074318 3300031711 Bacteria 2264
189 Ga0265314_10091629 3300031711 Unclassified 1978
190 Ga0265342_10049892 3300031712 Unclassified 2502
191 Ga0265342_10061610 3300031712 Bacteria 2210
192 Ga0265342_10111003 3300031712 Bacteria 1552
193 Ga0265342_10215947 3300031712 Bacteria 1035
194 Ga0316576_10130455 3300031727 Bacteria 1891
195 Ga0316578_10125421 3300031728 Unclassified 1544
196 Ga0307405_10366450 3300031731 Bacteria 1117
197 Ga0307412_10165186 3300031911 Bacteria 1650
198 Ga0316585_10068001 3300032137 Bacteria 1155
199 Ga0316580_10044893 3300032139 Bacteria 1363
200 Ga0373930_0006890 3300034816 Unclassified 1938
201 Ga0373928_0000124 3300035084 Bacteria 14419
202 Ga0373928_0054406 3300035084 Unclassified 953
203 Ga0373929_0003510 3300035085 Unclassified 2823
204 Ga0373944_0001750 3300035089 Bacteria 5483
205 Ga0373949_0002065 3300035090 Bacteria 5310
206 Ga0373932_0000001 3300035112 Bacteria 1459067
207 Ga0373945_0014422 3300035116 Unclassified 2648
208 Ga0373954_0017890 3300035118 Unclassified 3187
209 Ga0373956_0001448 3300035119 Bacteria 9796
210 Ga0373956_0189500 3300035119 Bacteria 974
211 Ga0373946_0103782 3300035171 Bacteria 1278
212 Ga0373946_0194665 3300035171 Unclassified 968
213 Ga0373955_0027089 3300035172 Bacteria 2959
214 Ga0373962_0000018 3300035242 Bacteria 47177
215 Ga0316574_0036363 3300035398 Bacteria 3014
216 Ga0373931_0000002 3300035691 Bacteria 599830
217 Ga0373931_0113718 3300035691 Bacteria 1539
218 Ga0373935_0055732 3300035692 Bacteria 2519
219 Ga0373935_0061313 3300035692 Unclassified 2408
220 Ga0373927_0020235 3300035695 Unclassified 4364
221 Ga0373927_0061743 3300035695 Unclassified 2424
222 Ga0373927_0071130 3300035695 Bacteria 2251
223 Ga0373927_0104227 3300035695 Bacteria 1846
224 Ga0373933_0186354 3300035724 Unclassified 1325
225 Ga0373947_0004199 3300035725 Bacteria 8451
226 Ga0373937_0012068 3300036401 Bacteria 7584
227 Ga0373937_0092835 3300036401 Unclassified 2798
228 Ga0316584_0048688 3300036712 Bacteria 3167
229 Ga0373925_0000552 3300037068 Bacteria 36801
230 Ga0373925_0003523 3300037068 Bacteria 12080
231 Ga0373925_0017241 3300037068 Bacteria 5230
232 Ga0451577_0087088 3300042876 Bacteria 2787
233 Ga0451577_0212673 3300042876 Unclassified 1747
234 Ga0451577_0465884 3300042876 Bacteria 1147
235 Ga0451577_0492798 3300042876 Unclassified 1113
236 Ga0453684_0002419 3300044712 Bacteria 45391
237 Ga0453684_0007891 3300044712 Bacteria 19328
238 Ga0453684_0049040 3300044712 Bacteria 5574
239 Ga0453684_0117679 3300044712 Bacteria 3216
240 Ga0453684_0247908 3300044712 Unclassified 2047
241 Ga0453684_0370766 3300044712 Bacteria 1609
242 Ga0453684_0861231 3300044712 Bacteria 973
243 Ga0451576_0032180 3300045051 Bacteria 5589
244 Ga0451576_0033408 3300045051 Bacteria 5468
245 Ga0451576_0083832 3300045051 Bacteria 3316
246 Ga0451576_0156435 3300045051 Unclassified 2378
247 Ga0451576_0208556 3300045051 Bacteria 2041
248 Ga0451576_0225580 3300045051 Bacteria 1956
249 Ga0451576_0432054 3300045051 Bacteria 1382
250 Ga0451576_1021188 3300045051 Unclassified 866
251 Ga0495592_0000071 3300046454 Bacteria 92699
252 Ga0495629_0033474 3300046459 Bacteria 3635
253 Ga0495582_0276401 3300046473 Bacteria 964
254 Ga0495662_0006019 3300046476 Bacteria 6062
255 Ga0495662_0007368 3300046476 Bacteria 5438
256 Ga0495662_0031709 3300046476 Unclassified 2553
257 Ga0495664_0017257 3300046477 Unclassified 4126
258 Ga0495664_0080670 3300046477 Bacteria 1950
259 Ga0495618_0002646 3300046514 Bacteria 11456
260 Ga0495618_0015771 3300046514 Bacteria 4612
261 Ga0495628_0002709 3300046516 Bacteria 15864
262 Ga0495628_0008425 3300046516 Bacteria 8845
263 Ga0495630_0000220 3300046517 Bacteria 45190
264 Ga0495630_0030594 3300046517 Bacteria 4006
265 Ga0495630_0055300 3300046517 Bacteria 2974
266 Ga0495630_0066606 3300046517 Bacteria 2707
267 Ga0495630_0244560 3300046517 Unclassified 1371
268 Ga0495666_0001943 3300046526 Bacteria 10191
269 Ga0495666_0044371 3300046526 Bacteria 2147
270 Ga0495666_0045898 3300046526 Unclassified 2107
271 Ga0495652_0093645 3300046529 Bacteria 2452
272 Ga0495640_0020910 3300046533 Bacteria 4812
273 Ga0495640_0055384 3300046533 Bacteria 2713
274 Ga0495640_0072441 3300046533 Bacteria 2309
275 Ga0495586_0000017 3300046535 Bacteria 116426
276 Ga0495586_0000414 3300046535 Bacteria 25855
277 Ga0495586_0002311 3300046535 Bacteria 10358
278 Ga0495586_0006922 3300046535 Bacteria 6039
279 Ga0495586_0085125 3300046535 Bacteria 1741
280 Ga0495586_0183191 3300046535 Unclassified 1185
281 Ga0495586_0191258 3300046535 Unclassified 1159
282 Ga0495587_0034039 3300046536 Bacteria 3074
283 Ga0495645_0013692 3300046543 Bacteria 5747
284 Ga0495645_0022843 3300046543 Unclassified 4527
285 Ga0495645_0072585 3300046543 Bacteria 2480
286 Ga0495645_0146237 3300046543 Bacteria 1646
287 Ga0495667_0044763 3300046559 Unclassified 2931
288 Ga0495634_0002060 3300046642 Bacteria 17002
289 Ga0495634_0021601 3300046642 Unclassified 4547
290 Ga0495634_0120525 3300046642 Unclassified 1680
291 Ga0495634_0340033 3300046642 Unclassified 900
292 Ga0495635_0051747 3300046663 Bacteria 2829
293 Ga0495599_0008795 3300046678 Bacteria 6146
294 Ga0495599_0028937 3300046678 Bacteria 3472
295 Ga0495658_0033772 3300046683 Unclassified 2804
296 Ga0495669_0120297 3300046684 Bacteria 1230
297 Ga0495613_0007595 3300046689 Bacteria 8061
298 Ga0495613_0008269 3300046689 Bacteria 7723
299 Ga0495613_0451719 3300046689 Unclassified 871
300 Ga0495624_0041943 3300046690 Bacteria 2925
301 Ga0495600_0204788 3300046809 Unclassified 1266
302 Ga0495600_0302029 3300046809 Bacteria 1010
303 Ga0495581_0294822 3300047315 Bacteria 948
304 Ga0495604_0511744 3300047317 Bacteria 778
305 Ga0495674_0000243 3300047319 Bacteria 45976
306 Ga0495674_0057421 3300047319 Unclassified 3406
307 Ga0495676_0280836 3300047321 Bacteria 1127
308 Ga0495680_0013067 3300047322 Bacteria 7262
309 Ga0495680_0460283 3300047322 Bacteria 869
310 Ga0495675_0114655 3300047444 Unclassified 1681
311 Ga0495684_0115880 3300047471 Bacteria 2020
312 Ga0495684_0151268 3300047471 Bacteria 1735
313 Ga0496107_0053685 3300048910 Unclassified 2907
314 Ga0496115_0005450 3300048918 Bacteria 9256
315 Ga0501031_0000199 3300049568 Bacteria 34157
316 Ga0501032_0001311 3300049569 Bacteria 19950
317 Ga0501033_0001401 3300049570 Bacteria 21393
318 Ga0501039_0134925 3300049575 Bacteria 1938
319 Ga0501046_0301475 3300049580 Unclassified 1170
320 Ga0501080_0043677 3300049742 Bacteria 4173
321 Ga0501035_0003191 3300049822 Bacteria 15717
322 Ga0501035_0064556 3300049822 Bacteria 3254
323 Ga0501044_0000125 3300049823 Bacteria 92969
324 Ga0501044_0089719 3300049823 Bacteria 3102
325 Ga0501044_0152331 3300049823 Bacteria 2294
326 nmdc:mga09592_312264_c1 3300050508 Bacteria 1362
327 nmdc:mga0qj67_284763_c1 3300050509 Unclassified 1339
328 nmdc:mga06r32_173170_c1 3300050510 Unclassified 2143
329 nmdc:mga08y16_225015_c1 3300050511 Bacteria 1941
330 nmdc:mga0n895_842549_c1 3300050512 Bacteria 905
331 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
332 nmdc:mga08x19_371_c1 3300050514 Bacteria 31663
333 Ga0495601_0038908 3300053077 Bacteria 2976

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100019922 Ga0070704_1000199227 212
2 3300009147 Ga0114129_10960975 Ga0114129_109609752 212
3 3300013306 Ga0163162_10404114 Ga0163162_104041142 216
4 3300009094 Ga0111539_10086838 Ga0111539_100868382 217
5 3300050512 nmdc:mga0n895_842549_c1 nmdc:mga0n895_842549_c1_45_707 217
6 3300006237 Ga0097621_100349123 Ga0097621_1003491232 218
7 3300005841 Ga0068863_100553147 Ga0068863_1005531471 222
8 3300026088 Ga0207641_10545765 Ga0207641_105457652 222
9 3300035119 Ga0373956_0189500 Ga0373956_0189500_198_929 222
10 3300006028 Ga0070717_10295458 Ga0070717_102954582 223
11 3300035171 Ga0373946_0103782 Ga0373946_0103782_203_934 223
12 3300035692 Ga0373935_0055732 Ga0373935_0055732_1152_1883 223
13 3300035695 Ga0373927_0104227 Ga0373927_0104227_491_1222 223
14 3300035725 Ga0373947_0004199 Ga0373947_0004199_7068_7799 223
15 3300037068 Ga0373925_0003523 Ga0373925_0003523_10920_11651 223
16 3300044712 Ga0453684_0007891 Ga0453684_0007891_14145_14885 223
17 3300045051 Ga0451576_0225580 Ga0451576_0225580_633_1364 223
18 3300046543 Ga0495645_0022843 Ga0495645_0022843_3274_4005 223
19 3300047321 Ga0495676_0280836 Ga0495676_0280836_84_815 223
20 3300006914 Ga0075436_100000508 Ga0075436_10000050813 228
21 3300050514 nmdc:mga08x19_371_c1 nmdc:mga08x19_371_c1_11415_12242 228
22 3300005295 Ga0065707_10211350 Ga0065707_102113502 229
23 3300006880 Ga0075429_100331860 Ga0075429_1003318602 229
24 3300009094 Ga0111539_10032397 Ga0111539_100323976 229
25 3300020080 Ga0206350_10624404 Ga0206350_106244042 229
26 3300022467 Ga0224712_10019917 Ga0224712_100199172 229
27 3300047317 Ga0495604_0511744 Ga0495604_0511744_43_753 229
28 3300050508 nmdc:mga09592_312264_c1 nmdc:mga09592_312264_c1_404_1114 229
29 3300050509 nmdc:mga0qj67_284763_c1 nmdc:mga0qj67_284763_c1_450_1160 229
30 3300050514 nmdc:mga08x19_1_c1 nmdc:mga08x19_1_c1_1370167_1370925 229
31 3300005331 Ga0070670_100246649 Ga0070670_1002466491 230
32 3300005563 Ga0068855_100493358 Ga0068855_1004933582 230
33 3300009551 Ga0105238_10055881 Ga0105238_100558812 230
34 3300025924 Ga0207694_10061182 Ga0207694_100611823 230
35 3300025949 Ga0207667_10450190 Ga0207667_104501902 230
36 3300028380 Ga0268265_10359800 Ga0268265_103598002 230
37 3300028556 Ga0265337_1000140 Ga0265337_100014026 230
38 3300028563 Ga0265319_1005912 Ga0265319_10059125 230
39 3300028666 Ga0265336_10000819 Ga0265336_1000081910 230
40 3300028666 Ga0265336_10040388 Ga0265336_100403882 230
41 3300028800 Ga0265338_10001555 Ga0265338_1000155512 230
42 3300029957 Ga0265324_10001313 Ga0265324_100013135 230
43 3300031240 Ga0265320_10007446 Ga0265320_100074468 230
44 3300031247 Ga0265340_10068061 Ga0265340_100680612 230
45 3300031344 Ga0265316_10258565 Ga0265316_102585651 230
46 3300044712 Ga0453684_0861231 Ga0453684_0861231_154_924 230
47 3300045051 Ga0451576_0083832 Ga0451576_0083832_806_1558 230
48 3300046454 Ga0495592_0000071 Ga0495592_0000071_57793_58545 230
49 3300046476 Ga0495662_0006019 Ga0495662_0006019_4770_5522 230
50 3300046477 Ga0495664_0080670 Ga0495664_0080670_979_1731 230
51 3300046514 Ga0495618_0015771 Ga0495618_0015771_951_1703 230
52 3300046516 Ga0495628_0002709 Ga0495628_0002709_12920_13672 230
53 3300046517 Ga0495630_0055300 Ga0495630_0055300_292_1044 230
54 3300046526 Ga0495666_0044371 Ga0495666_0044371_179_931 230
55 3300046529 Ga0495652_0093645 Ga0495652_0093645_964_1716 230
56 3300046535 Ga0495586_0000414 Ga0495586_0000414_5423_6175 230
57 3300046543 Ga0495645_0013692 Ga0495645_0013692_2097_2849 230
58 3300046678 Ga0495599_0028937 Ga0495599_0028937_1417_2169 230
59 3300046690 Ga0495624_0041943 Ga0495624_0041943_114_866 230
60 3300047315 Ga0495581_0294822 Ga0495581_0294822_179_931 230
61 3300047471 Ga0495684_0151268 Ga0495684_0151268_997_1716 230
62 3300048910 Ga0496107_0053685 Ga0496107_0053685_932_1651 230
63 3300003320 rootH2_10133559 rootH2_101335594 231
64 3300005327 Ga0070658_10332830 Ga0070658_103328302 231
65 3300005330 Ga0070690_100001338 Ga0070690_10000133812 231
66 3300005330 Ga0070690_100219697 Ga0070690_1002196972 231
67 3300005334 Ga0068869_100379402 Ga0068869_1003794022 231
68 3300005334 Ga0068869_100447975 Ga0068869_1004479751 231
69 3300005336 Ga0070680_100211839 Ga0070680_1002118392 231
70 3300005340 Ga0070689_100017117 Ga0070689_1000171175 231
71 3300005340 Ga0070689_100094831 Ga0070689_1000948312 231
72 3300005340 Ga0070689_100559149 Ga0070689_1005591491 231
73 3300005365 Ga0070688_100051220 Ga0070688_1000512203 231
74 3300005365 Ga0070688_100054959 Ga0070688_1000549593 231
75 3300005435 Ga0070714_100083529 Ga0070714_1000835293 231
76 3300005458 Ga0070681_10044186 Ga0070681_100441864 231
77 3300005459 Ga0068867_100372525 Ga0068867_1003725251 231
78 3300005530 Ga0070679_100534764 Ga0070679_1005347641 231
79 3300005539 Ga0068853_100751131 Ga0068853_1007511312 231
80 3300005549 Ga0070704_100270633 Ga0070704_1002706332 231
81 3300005563 Ga0068855_100055494 Ga0068855_1000554942 231
82 3300005563 Ga0068855_100102674 Ga0068855_1001026742 231
83 3300005563 Ga0068855_100372285 Ga0068855_1003722852 231
84 3300005617 Ga0068859_100017251 Ga0068859_1000172519 231
85 3300005617 Ga0068859_100083423 Ga0068859_1000834232 231
86 3300005617 Ga0068859_100137253 Ga0068859_1001372533 231
87 3300005841 Ga0068863_100192185 Ga0068863_1001921852 231
88 3300005841 Ga0068863_100538367 Ga0068863_1005383672 231
89 3300005843 Ga0068860_100190223 Ga0068860_1001902232 231
90 3300005844 Ga0068862_100224102 Ga0068862_1002241022 231
91 3300006028 Ga0070717_10373764 Ga0070717_103737642 231
92 3300006237 Ga0097621_100048212 Ga0097621_1000482122 231
93 3300006237 Ga0097621_100170018 Ga0097621_1001700182 231
94 3300006358 Ga0068871_100022554 Ga0068871_1000225544 231
95 3300006847 Ga0075431_100024295 Ga0075431_1000242956 231
96 3300006881 Ga0068865_100178938 Ga0068865_1001789382 231
97 3300006914 Ga0075436_100000010 Ga0075436_10000001076 231
98 3300006931 Ga0097620_100017251 Ga0097620_1000172519 231
99 3300006931 Ga0097620_100083423 Ga0097620_1000834232 231
100 3300006931 Ga0097620_100137265 Ga0097620_1001372653 231
101 3300009093 Ga0105240_10031649 Ga0105240_100316498 231
102 3300009093 Ga0105240_10102261 Ga0105240_101022613 231
103 3300009093 Ga0105240_10266308 Ga0105240_102663083 231
104 3300009093 Ga0105240_10486596 Ga0105240_104865962 231
105 3300009093 Ga0105240_10925269 Ga0105240_109252691 231
106 3300009094 Ga0111539_10403246 Ga0111539_104032462 231
107 3300009094 Ga0111539_10660926 Ga0111539_106609262 231
108 3300009098 Ga0105245_11299634 Ga0105245_112996341 231
109 3300009177 Ga0105248_10097826 Ga0105248_100978263 231
110 3300009177 Ga0105248_10353209 Ga0105248_103532092 231
111 3300009177 Ga0105248_10529843 Ga0105248_105298432 231
112 3300009551 Ga0105238_10027652 Ga0105238_100276522 231
113 3300009551 Ga0105238_10039645 Ga0105238_100396452 231
114 3300009551 Ga0105238_10241885 Ga0105238_102418852 231
115 3300013104 Ga0157370_10051303 Ga0157370_100513033 231
116 3300013296 Ga0157374_10263774 Ga0157374_102637742 231
117 3300013296 Ga0157374_10273072 Ga0157374_102730722 231
118 3300013296 Ga0157374_10538911 Ga0157374_105389112 231
119 3300013297 Ga0157378_10615758 Ga0157378_106157582 231
120 3300013307 Ga0157372_10127089 Ga0157372_101270893 231
121 3300013308 Ga0157375_10000081 Ga0157375_1000008170 231
122 3300013308 Ga0157375_11150729 Ga0157375_111507291 231
123 3300014325 Ga0163163_10000014 Ga0163163_1000001417 231
124 3300014745 Ga0157377_10181175 Ga0157377_101811752 231
125 3300014969 Ga0157376_10078007 Ga0157376_100780072 231
126 3300025909 Ga0207705_10274016 Ga0207705_102740162 231
127 3300025913 Ga0207695_10039261 Ga0207695_100392616 231
128 3300025913 Ga0207695_10088435 Ga0207695_100884352 231
129 3300025913 Ga0207695_10413701 Ga0207695_104137012 231
130 3300025913 Ga0207695_10570128 Ga0207695_105701282 231
131 3300025915 Ga0207693_10201859 Ga0207693_102018591 231
132 3300025921 Ga0207652_10236362 Ga0207652_102363622 231
133 3300025921 Ga0207652_10252146 Ga0207652_102521462 231
134 3300025922 Ga0207646_10332856 Ga0207646_103328562 231
135 3300025924 Ga0207694_10009718 Ga0207694_100097183 231
136 3300025924 Ga0207694_10135819 Ga0207694_101358191 231
137 3300025924 Ga0207694_10222677 Ga0207694_102226772 231
138 3300025924 Ga0207694_10368677 Ga0207694_103686772 231
139 3300025927 Ga0207687_10485576 Ga0207687_104855761 231
140 3300025929 Ga0207664_10024385 Ga0207664_100243854 231
141 3300025936 Ga0207670_10040380 Ga0207670_100403802 231
142 3300025949 Ga0207667_10066422 Ga0207667_100664225 231
143 3300025949 Ga0207667_10094126 Ga0207667_100941262 231
144 3300026041 Ga0207639_10212258 Ga0207639_102122582 231
145 3300026075 Ga0207708_10105704 Ga0207708_101057042 231
146 3300026078 Ga0207702_10008996 Ga0207702_100089965 231
147 3300026088 Ga0207641_10354077 Ga0207641_103540772 231
148 3300026088 Ga0207641_10481559 Ga0207641_104815592 231
149 3300026116 Ga0207674_10020912 Ga0207674_100209125 231
150 3300026142 Ga0207698_10304301 Ga0207698_103043012 231
151 3300028556 Ga0265337_1001206 Ga0265337_100120614 231
152 3300028556 Ga0265337_1005308 Ga0265337_10053083 231
153 3300028556 Ga0265337_1005786 Ga0265337_10057865 231
154 3300028556 Ga0265337_1026482 Ga0265337_10264822 231
155 3300028556 Ga0265337_1037090 Ga0265337_10370902 231
156 3300028556 Ga0265337_1052999 Ga0265337_10529991 231
157 3300028556 Ga0265337_1068718 Ga0265337_10687182 231
158 3300028558 Ga0265326_10007590 Ga0265326_100075901 231
159 3300028558 Ga0265326_10011195 Ga0265326_100111953 231
160 3300028563 Ga0265319_1000007 Ga0265319_100000791 231
161 3300028563 Ga0265319_1006732 Ga0265319_10067325 231
162 3300028563 Ga0265319_1012190 Ga0265319_10121903 231
163 3300028573 Ga0265334_10033223 Ga0265334_100332233 231
164 3300028577 Ga0265318_10013573 Ga0265318_100135733 231
165 3300028653 Ga0265323_10000237 Ga0265323_1000023736 231
166 3300028653 Ga0265323_10004158 Ga0265323_100041582 231
167 3300028653 Ga0265323_10113297 Ga0265323_101132972 231
168 3300028654 Ga0265322_10005305 Ga0265322_100053053 231
169 3300028666 Ga0265336_10027537 Ga0265336_100275372 231
170 3300028666 Ga0265336_10064436 Ga0265336_100644362 231
171 3300028800 Ga0265338_10000053 Ga0265338_1000005385 231
172 3300028800 Ga0265338_10000077 Ga0265338_1000007726 231
173 3300028800 Ga0265338_10000431 Ga0265338_100004316 231
174 3300028800 Ga0265338_10000945 Ga0265338_100009459 231
175 3300028800 Ga0265338_10004123 Ga0265338_1000412313 231
176 3300028800 Ga0265338_10006708 Ga0265338_1000670812 231
177 3300028800 Ga0265338_10008187 Ga0265338_100081874 231
178 3300028800 Ga0265338_10009242 Ga0265338_1000924213 231
179 3300028800 Ga0265338_10019978 Ga0265338_100199788 231
180 3300028800 Ga0265338_10038737 Ga0265338_100387374 231
181 3300028800 Ga0265338_10038772 Ga0265338_100387727 231
182 3300028800 Ga0265338_10044035 Ga0265338_100440357 231
183 3300028800 Ga0265338_10053208 Ga0265338_100532082 231
184 3300028800 Ga0265338_10058553 Ga0265338_100585533 231
185 3300028800 Ga0265338_10063334 Ga0265338_100633342 231
186 3300028800 Ga0265338_10067922 Ga0265338_100679222 231
187 3300028800 Ga0265338_10089433 Ga0265338_100894333 231
188 3300028800 Ga0265338_10091761 Ga0265338_100917611 231
189 3300028800 Ga0265338_10457515 Ga0265338_104575151 231
190 3300029957 Ga0265324_10009663 Ga0265324_100096632 231
191 3300029957 Ga0265324_10011848 Ga0265324_100118483 231
192 3300029957 Ga0265324_10036792 Ga0265324_100367922 231
193 3300029957 Ga0265324_10065691 Ga0265324_100656911 231
194 3300031238 Ga0265332_10032199 Ga0265332_100321994 231
195 3300031239 Ga0265328_10133926 Ga0265328_101339261 231
196 3300031240 Ga0265320_10000188 Ga0265320_100001886 231
197 3300031240 Ga0265320_10000340 Ga0265320_100003404 231
198 3300031240 Ga0265320_10017897 Ga0265320_100178978 231
199 3300031240 Ga0265320_10039006 Ga0265320_100390062 231
200 3300031240 Ga0265320_10077656 Ga0265320_100776562 231
201 3300031242 Ga0265329_10002481 Ga0265329_100024815 231
202 3300031247 Ga0265340_10000803 Ga0265340_1000080317 231
203 3300031247 Ga0265340_10048205 Ga0265340_100482052 231
204 3300031247 Ga0265340_10235784 Ga0265340_102357841 231
205 3300031249 Ga0265339_10013563 Ga0265339_100135634 231
206 3300031249 Ga0265339_10152803 Ga0265339_101528032 231
207 3300031251 Ga0265327_10010259 Ga0265327_100102593 231
208 3300031251 Ga0265327_10015959 Ga0265327_100159592 231
209 3300031344 Ga0265316_10019839 Ga0265316_1001983910 231
210 3300031344 Ga0265316_10026613 Ga0265316_100266135 231
211 3300031344 Ga0265316_10027692 Ga0265316_100276926 231
212 3300031344 Ga0265316_10044485 Ga0265316_100444854 231
213 3300031344 Ga0265316_10079495 Ga0265316_100794953 231
214 3300031344 Ga0265316_10101225 Ga0265316_101012253 231
215 3300031344 Ga0265316_10330635 Ga0265316_103306352 231
216 3300031595 Ga0265313_10006728 Ga0265313_100067281 231
217 3300031595 Ga0265313_10007547 Ga0265313_1000754711 231
218 3300031665 Ga0316575_10127735 Ga0316575_101277352 231
219 3300031711 Ga0265314_10000234 Ga0265314_1000023413 231
220 3300031711 Ga0265314_10004107 Ga0265314_1000410710 231
221 3300031711 Ga0265314_10074318 Ga0265314_100743182 231
222 3300031711 Ga0265314_10091629 Ga0265314_100916294 231
223 3300031712 Ga0265342_10049892 Ga0265342_100498923 231
224 3300031712 Ga0265342_10061610 Ga0265342_100616101 231
225 3300031712 Ga0265342_10111003 Ga0265342_101110032 231
226 3300031712 Ga0265342_10215947 Ga0265342_102159472 231
227 3300031727 Ga0316576_10130455 Ga0316576_101304552 231
228 3300031728 Ga0316578_10125421 Ga0316578_101254212 231
229 3300031731 Ga0307405_10366450 Ga0307405_103664502 231
230 3300031911 Ga0307412_10165186 Ga0307412_101651862 231
231 3300032137 Ga0316585_10068001 Ga0316585_100680012 231
232 3300032139 Ga0316580_10044893 Ga0316580_100448932 231
233 3300034816 Ga0373930_0006890 Ga0373930_0006890_385_1086 231
234 3300035084 Ga0373928_0000124 Ga0373928_0000124_2883_3584 231
235 3300035084 Ga0373928_0054406 Ga0373928_0054406_156_893 231
236 3300035085 Ga0373929_0003510 Ga0373929_0003510_1878_2579 231
237 3300035089 Ga0373944_0001750 Ga0373944_0001750_694_1395 231
238 3300035090 Ga0373949_0002065 Ga0373949_0002065_3151_3852 231
239 3300035112 Ga0373932_0000001 Ga0373932_0000001_1158049_1158750 231
240 3300035116 Ga0373945_0014422 Ga0373945_0014422_1819_2520 231
241 3300035118 Ga0373954_0017890 Ga0373954_0017890_1991_2716 231
242 3300035119 Ga0373956_0001448 Ga0373956_0001448_6216_6941 231
243 3300035171 Ga0373946_0194665 Ga0373946_0194665_244_945 231
244 3300035172 Ga0373955_0027089 Ga0373955_0027089_1093_1818 231
245 3300035242 Ga0373962_0000018 Ga0373962_0000018_26018_26719 231
246 3300035398 Ga0316574_0036363 Ga0316574_0036363_1164_1895 231
247 3300035691 Ga0373931_0000002 Ga0373931_0000002_336648_337349 231
248 3300035691 Ga0373931_0113718 Ga0373931_0113718_423_1160 231
249 3300035692 Ga0373935_0061313 Ga0373935_0061313_1378_2079 231
250 3300035695 Ga0373927_0020235 Ga0373927_0020235_3014_3724 231
251 3300035695 Ga0373927_0061743 Ga0373927_0061743_505_1206 231
252 3300035695 Ga0373927_0071130 Ga0373927_0071130_22_723 231
253 3300035724 Ga0373933_0186354 Ga0373933_0186354_46_768 231
254 3300036401 Ga0373937_0012068 Ga0373937_0012068_5002_5727 231
255 3300036401 Ga0373937_0092835 Ga0373937_0092835_691_1422 231
256 3300036712 Ga0316584_0048688 Ga0316584_0048688_923_1654 231
257 3300037068 Ga0373925_0000552 Ga0373925_0000552_24527_25228 231
258 3300037068 Ga0373925_0017241 Ga0373925_0017241_4100_4810 231
259 3300042876 Ga0451577_0087088 Ga0451577_0087088_1644_2381 231
260 3300042876 Ga0451577_0212673 Ga0451577_0212673_682_1452 231
261 3300042876 Ga0451577_0465884 Ga0451577_0465884_78_815 231
262 3300042876 Ga0451577_0492798 Ga0451577_0492798_240_971 231
263 3300044712 Ga0453684_0002419 Ga0453684_0002419_43246_43983 231
264 3300044712 Ga0453684_0049040 Ga0453684_0049040_3846_4601 231
265 3300044712 Ga0453684_0117679 Ga0453684_0117679_1731_2498 231
266 3300044712 Ga0453684_0247908 Ga0453684_0247908_1035_1787 231
267 3300044712 Ga0453684_0370766 Ga0453684_0370766_433_1164 231
268 3300045051 Ga0451576_0032180 Ga0451576_0032180_2308_3039 231
269 3300045051 Ga0451576_0033408 Ga0451576_0033408_1128_1859 231
270 3300045051 Ga0451576_0156435 Ga0451576_0156435_857_1588 231
271 3300045051 Ga0451576_0208556 Ga0451576_0208556_1259_1999 231
272 3300045051 Ga0451576_0432054 Ga0451576_0432054_364_1098 231
273 3300045051 Ga0451576_1021188 Ga0451576_1021188_45_791 231
274 3300046459 Ga0495629_0033474 Ga0495629_0033474_887_1612 231
275 3300046473 Ga0495582_0276401 Ga0495582_0276401_171_902 231
276 3300046476 Ga0495662_0007368 Ga0495662_0007368_3113_3844 231
277 3300046476 Ga0495662_0031709 Ga0495662_0031709_1114_1845 231
278 3300046477 Ga0495664_0017257 Ga0495664_0017257_1477_2217 231
279 3300046514 Ga0495618_0002646 Ga0495618_0002646_5305_6030 231
280 3300046516 Ga0495628_0008425 Ga0495628_0008425_6148_6888 231
281 3300046517 Ga0495630_0000220 Ga0495630_0000220_34402_35133 231
282 3300046517 Ga0495630_0030594 Ga0495630_0030594_614_1354 231
283 3300046517 Ga0495630_0066606 Ga0495630_0066606_1298_2020 231
284 3300046517 Ga0495630_0244560 Ga0495630_0244560_286_1020 231
285 3300046526 Ga0495666_0001943 Ga0495666_0001943_3003_3734 231
286 3300046526 Ga0495666_0045898 Ga0495666_0045898_49_780 231
287 3300046533 Ga0495640_0020910 Ga0495640_0020910_421_1152 231
288 3300046533 Ga0495640_0055384 Ga0495640_0055384_607_1332 231
289 3300046533 Ga0495640_0072441 Ga0495640_0072441_40_762 231
290 3300046535 Ga0495586_0000017 Ga0495586_0000017_45496_46227 231
291 3300046535 Ga0495586_0002311 Ga0495586_0002311_4370_5095 231
292 3300046535 Ga0495586_0006922 Ga0495586_0006922_2837_3568 231
293 3300046535 Ga0495586_0085125 Ga0495586_0085125_26_748 231
294 3300046535 Ga0495586_0183191 Ga0495586_0183191_243_998 231
295 3300046535 Ga0495586_0191258 Ga0495586_0191258_72_803 231
296 3300046536 Ga0495587_0034039 Ga0495587_0034039_2276_3016 231
297 3300046543 Ga0495645_0072585 Ga0495645_0072585_1753_2466 231
298 3300046543 Ga0495645_0146237 Ga0495645_0146237_905_1630 231
299 3300046559 Ga0495667_0044763 Ga0495667_0044763_232_954 231
300 3300046642 Ga0495634_0002060 Ga0495634_0002060_10205_10930 231
301 3300046642 Ga0495634_0021601 Ga0495634_0021601_1653_2384 231
302 3300046642 Ga0495634_0120525 Ga0495634_0120525_865_1605 231
303 3300046642 Ga0495634_0340033 Ga0495634_0340033_128_850 231
304 3300046663 Ga0495635_0051747 Ga0495635_0051747_1248_1973 231
305 3300046678 Ga0495599_0008795 Ga0495599_0008795_3597_4328 231
306 3300046683 Ga0495658_0033772 Ga0495658_0033772_1480_2211 231
307 3300046684 Ga0495669_0120297 Ga0495669_0120297_293_1024 231
308 3300046689 Ga0495613_0007595 Ga0495613_0007595_2660_3391 231
309 3300046689 Ga0495613_0008269 Ga0495613_0008269_4511_5236 231
310 3300046689 Ga0495613_0451719 Ga0495613_0451719_103_825 231
311 3300046809 Ga0495600_0204788 Ga0495600_0204788_371_1096 231
312 3300046809 Ga0495600_0302029 Ga0495600_0302029_86_808 231
313 3300047319 Ga0495674_0000243 Ga0495674_0000243_8517_9248 231
314 3300047319 Ga0495674_0057421 Ga0495674_0057421_2071_2811 231
315 3300047322 Ga0495680_0013067 Ga0495680_0013067_1371_2096 231
316 3300047322 Ga0495680_0460283 Ga0495680_0460283_64_804 231
317 3300047444 Ga0495675_0114655 Ga0495675_0114655_688_1410 231
318 3300047471 Ga0495684_0115880 Ga0495684_0115880_517_1242 231
319 3300048918 Ga0496115_0005450 Ga0496115_0005450_6082_6813 231
320 3300049568 Ga0501031_0000199 Ga0501031_0000199_3122_3823 231
321 3300049569 Ga0501032_0001311 Ga0501032_0001311_5358_6059 231
322 3300049570 Ga0501033_0001401 Ga0501033_0001401_20587_21288 231
323 3300049575 Ga0501039_0134925 Ga0501039_0134925_1004_1705 231
324 3300049580 Ga0501046_0301475 Ga0501046_0301475_73_828 231
325 3300049742 Ga0501080_0043677 Ga0501080_0043677_2740_3435 231
326 3300049822 Ga0501035_0003191 Ga0501035_0003191_7724_8425 231
327 3300049822 Ga0501035_0064556 Ga0501035_0064556_537_1292 231
328 3300049823 Ga0501044_0000125 Ga0501044_0000125_56128_56829 231
329 3300049823 Ga0501044_0089719 Ga0501044_0089719_1486_2187 231
330 3300049823 Ga0501044_0152331 Ga0501044_0152331_1557_2252 231
331 3300050510 nmdc:mga06r32_173170_c1 nmdc:mga06r32_173170_c1_284_1066 231
332 3300050511 nmdc:mga08y16_225015_c1 nmdc:mga08y16_225015_c1_367_1128 231
333 3300053077 Ga0495601_0038908 Ga0495601_0038908_1873_2598 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

30

223

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h70-assembly1.cif.gz_A crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7 0.9361 22 227
4rzx-assembly1.cif.gz_B crystal structure (type-3) of dtmp kinase (st1543) from sulfolobus tokodaii strain7 0.9331 22 225
5h70-assembly1.cif.gz_B crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7 0.9281 22 227
5h70-assembly1.cif.gz_A crystal structure of adp bound dtmp kinase (st1543) from sulfolobus tokodaii strain7 0.9274 22 227
4nzy-assembly1.cif.gz_B crystal structure (type-2) of dtmp kinase (st1543) from sulfolobus tokodaii strain7 0.922 22 229
ID Description Score Start End Superfamily
4rzxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 22 225 3.40.50.300
4rzxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9152 22 225 3.40.50.300
af_A1ZB29_2_211_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9102 20 228 3.40.50.300
af_Q57741_3_187_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9087 22 225 3.40.50.300
af_B7ZZT5_48_255_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9021 22 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P5YZY0-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9805 4 228 GO:0004798
GO:0005524
GO:0005737
GO:0006227
GO:0006233
GO:0006235
AF-A0A838N989-F1-model_v4 deleted 0.9791 28 228
AF-A0A7C4PQB5-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9779 3 231 GO:0004798
GO:0005524
GO:0005737
GO:0006227
GO:0006233
GO:0006235
AF-A0A2D6N5P9-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9754 5 229 GO:0004798
GO:0005524
GO:0005737
GO:0006227
GO:0006233
GO:0006235
AF-A0A2V5X198-F1-model_v4 Thymidylate kinase 0.9745 29 231 GO:0004798
GO:0005737
GO:0006227
GO:0006233
GO:0006235

Feature Viewer

pLDDT pTM Quality
90.69 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map