F411228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 167 | 333 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100890855|Ga0070670_1008908551 |
| Length | 113 |
| Sequence | LCNSELRSIEKNLDKLRAAGIRPVAISIDTPEESRKLSQQMGYTFTILSDSNAEVIKRYDLVHAGAGENGRDIARPAEFLVDTSGTVRWVNLTENYTVRARPEQILNAANSLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 127 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 128 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 136 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 137 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 144 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 145 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 146 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 148 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 149 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 150 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 151 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 152 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 163 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.5 |
| Metatranscriptomes | 1.5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 98.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_967573 | 2162886007 | Unclassified | 1572 |
| 2 | Ga0065704_10002238 | 3300005289 | Bacteria | 5587 |
| 3 | Ga0065715_10004674 | 3300005293 | Bacteria | 6035 |
| 4 | Ga0065715_10012430 | 3300005293 | Bacteria | 2290 |
| 5 | Ga0065715_10093259 | 3300005293 | Bacteria | 4749 |
| 6 | Ga0065707_10090524 | 3300005295 | Bacteria | 4123 |
| 7 | Ga0070670_100333213 | 3300005331 | Unclassified | 1331 |
| 8 | Ga0070670_100890855 | 3300005331 | Bacteria | 806 |
| 9 | Ga0068869_100098173 | 3300005334 | Bacteria | 2212 |
| 10 | Ga0068869_100540549 | 3300005334 | Unclassified | 977 |
| 11 | Ga0070682_100003672 | 3300005337 | Bacteria | 8518 |
| 12 | Ga0070689_100000044 | 3300005340 | Bacteria | 76920 |
| 13 | Ga0070692_10015599 | 3300005345 | Bacteria | 3597 |
| 14 | Ga0070692_10022395 | 3300005345 | Bacteria | 3086 |
| 15 | Ga0070692_10024124 | 3300005345 | Unclassified | 2987 |
| 16 | Ga0070692_10878778 | 3300005345 | Unclassified | 618 |
| 17 | Ga0070671_100009571 | 3300005355 | Bacteria | 7786 |
| 18 | Ga0070673_100139960 | 3300005364 | Unclassified | 2040 |
| 19 | Ga0070667_100749196 | 3300005367 | Unclassified | 905 |
| 20 | Ga0070705_100027544 | 3300005440 | Bacteria | 3104 |
| 21 | Ga0070705_100342432 | 3300005440 | Unclassified | 1087 |
| 22 | Ga0070700_100050152 | 3300005441 | Unclassified | 2594 |
| 23 | Ga0070694_100056781 | 3300005444 | Unclassified | 2660 |
| 24 | Ga0070694_100182087 | 3300005444 | Bacteria | 1555 |
| 25 | Ga0070694_100355373 | 3300005444 | Bacteria | 1136 |
| 26 | Ga0070708_100123090 | 3300005445 | Bacteria | 2394 |
| 27 | Ga0070708_100213926 | 3300005445 | Bacteria | 1806 |
| 28 | Ga0070708_100311683 | 3300005445 | Bacteria | 1482 |
| 29 | Ga0070681_10001188 | 3300005458 | Bacteria | 22550 |
| 30 | Ga0068867_100192410 | 3300005459 | Bacteria | 1629 |
| 31 | Ga0070706_100099568 | 3300005467 | Unclassified | 2700 |
| 32 | Ga0070706_100829882 | 3300005467 | Unclassified | 855 |
| 33 | Ga0070698_100000157 | 3300005471 | Bacteria | 61949 |
| 34 | Ga0070698_100082132 | 3300005471 | Bacteria | 3215 |
| 35 | Ga0070698_100182228 | 3300005471 | Bacteria | 2038 |
| 36 | Ga0070699_100018829 | 3300005518 | Bacteria | 5931 |
| 37 | Ga0070699_100175368 | 3300005518 | Bacteria | 1901 |
| 38 | Ga0070679_100262202 | 3300005530 | Unclassified | 1683 |
| 39 | Ga0070679_101214720 | 3300005530 | Unclassified | 699 |
| 40 | Ga0070697_100000715 | 3300005536 | Bacteria | 24741 |
| 41 | Ga0070697_100004826 | 3300005536 | Bacteria | 10335 |
| 42 | Ga0070672_100239334 | 3300005543 | Bacteria | 1526 |
| 43 | Ga0070695_100035208 | 3300005545 | Bacteria | 3144 |
| 44 | Ga0070695_100161167 | 3300005545 | Unclassified | 1574 |
| 45 | Ga0070695_100217588 | 3300005545 | Unclassified | 1375 |
| 46 | Ga0070696_100049558 | 3300005546 | Bacteria | 2917 |
| 47 | Ga0070696_100149888 | 3300005546 | Bacteria | 1711 |
| 48 | Ga0070696_100231247 | 3300005546 | Unclassified | 1391 |
| 49 | Ga0070696_100667189 | 3300005546 | Bacteria | 844 |
| 50 | Ga0070696_100717892 | 3300005546 | Unclassified | 816 |
| 51 | Ga0070693_101119016 | 3300005547 | Bacteria | 601 |
| 52 | Ga0070704_100349197 | 3300005549 | Bacteria | 1248 |
| 53 | Ga0070704_100659729 | 3300005549 | Archaea | 924 |
| 54 | Ga0070704_101251411 | 3300005549 | Unclassified | 678 |
| 55 | Ga0070704_101459066 | 3300005549 | Unclassified | 629 |
| 56 | Ga0070664_100535776 | 3300005564 | Unclassified | 1082 |
| 57 | Ga0068857_100032538 | 3300005577 | Bacteria | 4612 |
| 58 | Ga0068857_100103535 | 3300005577 | Bacteria | 2555 |
| 59 | Ga0068857_100948383 | 3300005577 | Unclassified | 826 |
| 60 | Ga0068857_101378123 | 3300005577 | Bacteria | 686 |
| 61 | Ga0068857_101864329 | 3300005577 | Unclassified | 589 |
| 62 | Ga0068854_101093292 | 3300005578 | Bacteria | 710 |
| 63 | Ga0068856_100148785 | 3300005614 | Bacteria | 2350 |
| 64 | Ga0070702_100010214 | 3300005615 | Bacteria | 4616 |
| 65 | Ga0070702_100100149 | 3300005615 | Bacteria | 1776 |
| 66 | Ga0070702_100732292 | 3300005615 | Unclassified | 757 |
| 67 | Ga0070702_101159142 | 3300005615 | Unclassified | 621 |
| 68 | Ga0068852_100147652 | 3300005616 | Bacteria | 2183 |
| 69 | Ga0068852_102076529 | 3300005616 | Unclassified | 590 |
| 70 | Ga0068852_102690587 | 3300005616 | Unclassified | 517 |
| 71 | Ga0068859_100036887 | 3300005617 | Bacteria | 4907 |
| 72 | Ga0068859_100043013 | 3300005617 | Bacteria | 4539 |
| 73 | Ga0068859_100113264 | 3300005617 | Bacteria | 2776 |
| 74 | Ga0068859_100125570 | 3300005617 | Bacteria | 2635 |
| 75 | Ga0068864_100050616 | 3300005618 | Bacteria | 3576 |
| 76 | Ga0068864_100194808 | 3300005618 | Bacteria | 1859 |
| 77 | Ga0068864_100396682 | 3300005618 | Unclassified | 1310 |
| 78 | Ga0068864_100834192 | 3300005618 | Bacteria | 908 |
| 79 | Ga0068870_10013706 | 3300005840 | Bacteria | 3816 |
| 80 | Ga0068870_10155010 | 3300005840 | Unclassified | 1353 |
| 81 | Ga0068863_100008575 | 3300005841 | Bacteria | 9990 |
| 82 | Ga0068863_100056908 | 3300005841 | Bacteria | 3702 |
| 83 | Ga0068863_101126255 | 3300005841 | Unclassified | 790 |
| 84 | Ga0068863_101274770 | 3300005841 | Unclassified | 741 |
| 85 | Ga0068863_101421557 | 3300005841 | Unclassified | 701 |
| 86 | Ga0068858_100427862 | 3300005842 | Bacteria | 1274 |
| 87 | Ga0068858_101771821 | 3300005842 | Unclassified | 610 |
| 88 | Ga0068860_100008952 | 3300005843 | Bacteria | 9971 |
| 89 | Ga0068860_100086297 | 3300005843 | Bacteria | 2987 |
| 90 | Ga0068860_100540543 | 3300005843 | Unclassified | 1166 |
| 91 | Ga0068860_100587621 | 3300005843 | Unclassified | 1118 |
| 92 | Ga0068860_101664978 | 3300005843 | Unclassified | 660 |
| 93 | Ga0068862_100077990 | 3300005844 | Bacteria | 2869 |
| 94 | Ga0081539_10000631 | 3300005985 | Bacteria | 71279 |
| 95 | Ga0075432_10063638 | 3300006058 | Bacteria | 1317 |
| 96 | Ga0070716_100050800 | 3300006173 | Unclassified | 2355 |
| 97 | Ga0070716_100132002 | 3300006173 | Bacteria | 1580 |
| 98 | Ga0097621_100009441 | 3300006237 | Bacteria | 7080 |
| 99 | Ga0097621_100356055 | 3300006237 | Unclassified | 1303 |
| 100 | Ga0075430_100036512 | 3300006846 | Bacteria | 4166 |
| 101 | Ga0075430_100729334 | 3300006846 | Unclassified | 817 |
| 102 | Ga0075431_100248584 | 3300006847 | Bacteria | 1807 |
| 103 | Ga0075431_100962748 | 3300006847 | Bacteria | 821 |
| 104 | Ga0075433_10043768 | 3300006852 | Bacteria | 3888 |
| 105 | Ga0075433_10324831 | 3300006852 | Unclassified | 1361 |
| 106 | Ga0075433_10631770 | 3300006852 | Bacteria | 939 |
| 107 | Ga0075433_11417562 | 3300006852 | Bacteria | 601 |
| 108 | Ga0075434_100015382 | 3300006871 | Bacteria | 7331 |
| 109 | Ga0075434_100443683 | 3300006871 | Unclassified | 1319 |
| 110 | Ga0075434_100875822 | 3300006871 | Unclassified | 913 |
| 111 | Ga0075434_100886106 | 3300006871 | Bacteria | 907 |
| 112 | Ga0075429_100019970 | 3300006880 | Bacteria | 5810 |
| 113 | Ga0075429_100067436 | 3300006880 | Unclassified | 3113 |
| 114 | Ga0075429_100480257 | 3300006880 | Bacteria | 1089 |
| 115 | Ga0075429_100524553 | 3300006880 | Bacteria | 1038 |
| 116 | Ga0097620_100036888 | 3300006931 | Bacteria | 4907 |
| 117 | Ga0097620_100043012 | 3300006931 | Bacteria | 4539 |
| 118 | Ga0097620_100113267 | 3300006931 | Bacteria | 2776 |
| 119 | Ga0097620_100125565 | 3300006931 | Bacteria | 2635 |
| 120 | Ga0075435_100491753 | 3300007076 | Bacteria | 1060 |
| 121 | Ga0099794_10266716 | 3300007265 | Bacteria | 884 |
| 122 | Ga0105251_10144702 | 3300009011 | Unclassified | 1075 |
| 123 | Ga0105240_10078772 | 3300009093 | Bacteria | 4057 |
| 124 | Ga0111539_10021514 | 3300009094 | Bacteria | 7935 |
| 125 | Ga0105247_10202701 | 3300009101 | Unclassified | 1334 |
| 126 | Ga0105247_10312357 | 3300009101 | Bacteria | 1094 |
| 127 | Ga0105247_10685115 | 3300009101 | Unclassified | 770 |
| 128 | Ga0114129_10019631 | 3300009147 | Bacteria | 9619 |
| 129 | Ga0114129_10157711 | 3300009147 | Bacteria | 3103 |
| 130 | Ga0114129_10204705 | 3300009147 | Unclassified | 2671 |
| 131 | Ga0114129_10212972 | 3300009147 | Bacteria | 2611 |
| 132 | Ga0114129_10822207 | 3300009147 | Bacteria | 1183 |
| 133 | Ga0114129_12269658 | 3300009147 | Bacteria | 652 |
| 134 | Ga0114129_12470847 | 3300009147 | Unclassified | 621 |
| 135 | Ga0105243_10002037 | 3300009148 | Bacteria | 17142 |
| 136 | Ga0105243_10177770 | 3300009148 | Bacteria | 1848 |
| 137 | Ga0105243_10233966 | 3300009148 | Bacteria | 1632 |
| 138 | Ga0105243_10255439 | 3300009148 | Bacteria | 1567 |
| 139 | Ga0105243_10339654 | 3300009148 | Bacteria | 1375 |
| 140 | Ga0105241_10026486 | 3300009174 | Bacteria | 4315 |
| 141 | Ga0105241_10232188 | 3300009174 | Unclassified | 1556 |
| 142 | Ga0105241_10266042 | 3300009174 | Unclassified | 1459 |
| 143 | Ga0105241_10352030 | 3300009174 | Unclassified | 1279 |
| 144 | Ga0105241_10401103 | 3300009174 | Bacteria | 1203 |
| 145 | Ga0105241_10584416 | 3300009174 | Bacteria | 1007 |
| 146 | Ga0105241_10601804 | 3300009174 | Unclassified | 993 |
| 147 | Ga0105241_11112667 | 3300009174 | Bacteria | 744 |
| 148 | Ga0105241_11658862 | 3300009174 | Unclassified | 620 |
| 149 | Ga0105241_11680820 | 3300009174 | Bacteria | 616 |
| 150 | Ga0105242_12713070 | 3300009176 | Unclassified | 545 |
| 151 | Ga0105248_10394872 | 3300009177 | Bacteria | 1557 |
| 152 | Ga0105248_10582565 | 3300009177 | Unclassified | 1262 |
| 153 | Ga0105248_13357415 | 3300009177 | Bacteria | 509 |
| 154 | Ga0105237_10226644 | 3300009545 | Bacteria | 1869 |
| 155 | Ga0105238_10046989 | 3300009551 | Bacteria | 4353 |
| 156 | Ga0105249_10037982 | 3300009553 | Unclassified | 4370 |
| 157 | Ga0105249_10910688 | 3300009553 | Bacteria | 946 |
| 158 | Ga0105239_10707470 | 3300010375 | Bacteria | 1152 |
| 159 | Ga0105239_11856163 | 3300010375 | Unclassified | 699 |
| 160 | Ga0105246_10073205 | 3300011119 | Bacteria | 2418 |
| 161 | Ga0105246_10532140 | 3300011119 | Unclassified | 1004 |
| 162 | Ga0105246_10641796 | 3300011119 | Unclassified | 923 |
| 163 | Ga0105246_11270748 | 3300011119 | Unclassified | 681 |
| 164 | Ga0105246_12238265 | 3300011119 | Unclassified | 533 |
| 165 | Ga0157373_10019089 | 3300013100 | Bacteria | 4991 |
| 166 | Ga0157373_10041966 | 3300013100 | Bacteria | 3271 |
| 167 | Ga0157373_10046354 | 3300013100 | Unclassified | 3101 |
| 168 | Ga0157373_10150885 | 3300013100 | Bacteria | 1635 |
| 169 | Ga0157373_10445131 | 3300013100 | Unclassified | 932 |
| 170 | Ga0157371_10362182 | 3300013102 | Bacteria | 1057 |
| 171 | Ga0163162_11492177 | 3300013306 | Unclassified | 770 |
| 172 | Ga0163162_11572787 | 3300013306 | Bacteria | 750 |
| 173 | Ga0157372_10603763 | 3300013307 | Bacteria | 1279 |
| 174 | Ga0157372_11967760 | 3300013307 | Bacteria | 672 |
| 175 | Ga0157372_13474855 | 3300013307 | Unclassified | 501 |
| 176 | Ga0157375_11368242 | 3300013308 | Unclassified | 833 |
| 177 | Ga0163163_10549872 | 3300014325 | Bacteria | 1217 |
| 178 | Ga0163163_10602739 | 3300014325 | Unclassified | 1161 |
| 179 | Ga0163163_10723146 | 3300014325 | Bacteria | 1059 |
| 180 | Ga0157380_10064983 | 3300014326 | Bacteria | 2931 |
| 181 | Ga0157380_10946497 | 3300014326 | Bacteria | 891 |
| 182 | Ga0157376_10952984 | 3300014969 | Unclassified | 879 |
| 183 | Ga0182007_10068279 | 3300015262 | Bacteria | 1165 |
| 184 | Ga0207710_10278948 | 3300025900 | Unclassified | 841 |
| 185 | Ga0207710_10538421 | 3300025900 | Unclassified | 608 |
| 186 | Ga0207647_10000659 | 3300025904 | Bacteria | 26975 |
| 187 | Ga0207645_10736522 | 3300025907 | Bacteria | 670 |
| 188 | Ga0207643_10023332 | 3300025908 | Bacteria | 3410 |
| 189 | Ga0207643_10048386 | 3300025908 | Unclassified | 2408 |
| 190 | Ga0207643_10609910 | 3300025908 | Unclassified | 703 |
| 191 | Ga0207654_10464234 | 3300025911 | Bacteria | 890 |
| 192 | Ga0207654_10749008 | 3300025911 | Unclassified | 704 |
| 193 | Ga0207707_10007101 | 3300025912 | Bacteria | 9758 |
| 194 | Ga0207695_10211870 | 3300025913 | Bacteria | 1848 |
| 195 | Ga0207671_10654867 | 3300025914 | Bacteria | 836 |
| 196 | Ga0207652_10211784 | 3300025921 | Unclassified | 1745 |
| 197 | Ga0207652_11342949 | 3300025921 | Unclassified | 618 |
| 198 | Ga0207646_11002734 | 3300025922 | Bacteria | 738 |
| 199 | Ga0207694_10042707 | 3300025924 | Bacteria | 3498 |
| 200 | Ga0207650_10164730 | 3300025925 | Bacteria | 1758 |
| 201 | Ga0207650_10214997 | 3300025925 | Unclassified | 1545 |
| 202 | Ga0207650_10736294 | 3300025925 | Unclassified | 834 |
| 203 | Ga0207664_10615773 | 3300025929 | Unclassified | 975 |
| 204 | Ga0207644_10009622 | 3300025931 | Bacteria | 6347 |
| 205 | Ga0207709_10003731 | 3300025935 | Bacteria | 8968 |
| 206 | Ga0207709_10487026 | 3300025935 | Bacteria | 960 |
| 207 | Ga0207709_11527524 | 3300025935 | Unclassified | 554 |
| 208 | Ga0207670_10498612 | 3300025936 | Bacteria | 988 |
| 209 | Ga0207665_10046742 | 3300025939 | Bacteria | 2900 |
| 210 | Ga0207665_10527294 | 3300025939 | Bacteria | 915 |
| 211 | Ga0207711_10027100 | 3300025941 | Bacteria | 4811 |
| 212 | Ga0207689_10113321 | 3300025942 | Unclassified | 2229 |
| 213 | Ga0207689_10189213 | 3300025942 | Bacteria | 1698 |
| 214 | Ga0207689_10260187 | 3300025942 | Unclassified | 1435 |
| 215 | Ga0207689_11498210 | 3300025942 | Bacteria | 563 |
| 216 | Ga0207679_10561288 | 3300025945 | Unclassified | 1025 |
| 217 | Ga0207667_11232588 | 3300025949 | Bacteria | 727 |
| 218 | Ga0207651_10072289 | 3300025960 | Unclassified | 2448 |
| 219 | Ga0207651_10278220 | 3300025960 | Bacteria | 1382 |
| 220 | Ga0207651_11471694 | 3300025960 | Unclassified | 613 |
| 221 | Ga0207712_10013261 | 3300025961 | Bacteria | 5282 |
| 222 | Ga0207640_10113826 | 3300025981 | Bacteria | 1924 |
| 223 | Ga0207703_10043940 | 3300026035 | Bacteria | 3588 |
| 224 | Ga0207703_10313492 | 3300026035 | Bacteria | 1434 |
| 225 | Ga0207703_10513791 | 3300026035 | Bacteria | 1126 |
| 226 | Ga0207639_10052289 | 3300026041 | Bacteria | 3112 |
| 227 | Ga0207708_10023008 | 3300026075 | Bacteria | 4707 |
| 228 | Ga0207708_10030760 | 3300026075 | Unclassified | 4072 |
| 229 | Ga0207708_10600361 | 3300026075 | Unclassified | 932 |
| 230 | Ga0207708_11514252 | 3300026075 | Unclassified | 589 |
| 231 | Ga0207702_10107400 | 3300026078 | Bacteria | 2475 |
| 232 | Ga0207641_10029580 | 3300026088 | Bacteria | 4532 |
| 233 | Ga0207641_10296288 | 3300026088 | Bacteria | 1526 |
| 234 | Ga0207648_10405149 | 3300026089 | Bacteria | 1236 |
| 235 | Ga0207648_11737232 | 3300026089 | Unclassified | 585 |
| 236 | Ga0207676_10697074 | 3300026095 | Unclassified | 983 |
| 237 | Ga0207676_11494642 | 3300026095 | Unclassified | 672 |
| 238 | Ga0207676_11873996 | 3300026095 | Bacteria | 598 |
| 239 | Ga0207676_12144330 | 3300026095 | Unclassified | 557 |
| 240 | Ga0207676_12179170 | 3300026095 | Unclassified | 552 |
| 241 | Ga0207676_12341257 | 3300026095 | Unclassified | 531 |
| 242 | Ga0207674_10021115 | 3300026116 | Bacteria | 7020 |
| 243 | Ga0207674_10049583 | 3300026116 | Bacteria | 4294 |
| 244 | Ga0207674_10655511 | 3300026116 | Bacteria | 1014 |
| 245 | Ga0207674_11690765 | 3300026116 | Unclassified | 601 |
| 246 | Ga0207675_100327312 | 3300026118 | Unclassified | 1497 |
| 247 | Ga0207683_11863608 | 3300026121 | Unclassified | 550 |
| 248 | Ga0207698_11743120 | 3300026142 | Unclassified | 638 |
| 249 | Ga0207428_10031098 | 3300027907 | Bacteria | 4410 |
| 250 | Ga0207428_10153633 | 3300027907 | Unclassified | 1751 |
| 251 | Ga0207428_10878703 | 3300027907 | Unclassified | 634 |
| 252 | Ga0268265_10074127 | 3300028380 | Bacteria | 2661 |
| 253 | Ga0268264_10582702 | 3300028381 | Unclassified | 1101 |
| 254 | Ga0268264_10671129 | 3300028381 | Bacteria | 1027 |
| 255 | Ga0307408_100053612 | 3300031548 | Unclassified | 2913 |
| 256 | Ga0307408_100204194 | 3300031548 | Bacteria | 1602 |
| 257 | Ga0307408_100489393 | 3300031548 | Bacteria | 1075 |
| 258 | Ga0307405_10117080 | 3300031731 | Unclassified | 1816 |
| 259 | Ga0307405_10269566 | 3300031731 | Bacteria | 1276 |
| 260 | Ga0307416_100048933 | 3300032002 | Unclassified | 3358 |
| 261 | Ga0307416_100250053 | 3300032002 | Bacteria | 1725 |
| 262 | Ga0307414_10482138 | 3300032004 | Bacteria | 1094 |
| 263 | Ga0307411_10273531 | 3300032005 | Bacteria | 1341 |
| 264 | Ga0307415_100883886 | 3300032126 | Unclassified | 822 |
| 265 | Ga0373950_0078014 | 3300034818 | Bacteria | 688 |
| 266 | Ga0373940_0007898 | 3300035088 | Unclassified | 2420 |
| 267 | Ga0373951_0037777 | 3300035091 | Unclassified | 1156 |
| 268 | Ga0373941_0324944 | 3300035115 | Unclassified | 620 |
| 269 | Ga0395900_0155581 | 3300037418 | Bacteria | 2335 |
| 270 | Ga0395900_0236250 | 3300037418 | Bacteria | 1836 |
| 271 | Ga0439448_0190983 | 3300042005 | Unclassified | 717 |
| 272 | Ga0439458_0004183 | 3300042157 | Bacteria | 3333 |
| 273 | Ga0453683_0108856 | 3300044673 | Unclassified | 1742 |
| 274 | Ga0451576_1200081 | 3300045051 | Unclassified | 792 |
| 275 | Ga0496104_0373822 | 3300048907 | Unclassified | 1338 |
| 276 | Ga0496108_0290623 | 3300048911 | Bacteria | 1423 |
| 277 | Ga0496110_0087766 | 3300048913 | Bacteria | 2778 |
| 278 | Ga0496111_0320070 | 3300048914 | Unclassified | 1149 |
| 279 | Ga0496112_0598314 | 3300048915 | Bacteria | 1035 |
| 280 | Ga0501291_044844 | 3300049514 | Unclassified | 789 |
| 281 | Ga0501297_026062 | 3300049520 | Unclassified | 756 |
| 282 | Ga0501031_0527582 | 3300049568 | Unclassified | 761 |
| 283 | Ga0501038_0023486 | 3300049574 | Bacteria | 5511 |
| 284 | Ga0501039_1252847 | 3300049575 | Unclassified | 573 |
| 285 | Ga0501040_0346335 | 3300049576 | Unclassified | 1064 |
| 286 | Ga0501042_0787998 | 3300049578 | Unclassified | 692 |
| 287 | Ga0501048_0445493 | 3300049582 | Unclassified | 927 |
| 288 | Ga0501202_100263 | 3300049652 | Bacteria | 704 |
| 289 | Ga0501217_330292 | 3300049661 | Bacteria | 509 |
| 290 | Ga0501223_031816 | 3300049663 | Unclassified | 1026 |
| 291 | Ga0501235_018347 | 3300049669 | Bacteria | 1552 |
| 292 | Ga0501257_020345 | 3300049686 | Bacteria | 1558 |
| 293 | Ga0501258_056852 | 3300049687 | Unclassified | 558 |
| 294 | Ga0501259_110896 | 3300049688 | Bacteria | 641 |
| 295 | Ga0501261_075837 | 3300049690 | Unclassified | 599 |
| 296 | Ga0501221_032473 | 3300049704 | Unclassified | 1097 |
| 297 | Ga0501225_0078271 | 3300049705 | Unclassified | 947 |
| 298 | Ga0501079_0195245 | 3300049741 | Unclassified | 1580 |
| 299 | nmdc:mga05p37_1383299_c1 | 3300050507 | Unclassified | 710 |
| 300 | nmdc:mga05p37_253578_c1 | 3300050507 | Bacteria | 2109 |
| 301 | nmdc:mga05p37_267027_c1 | 3300050507 | Bacteria | 2046 |
| 302 | nmdc:mga05p37_863461_c1 | 3300050507 | Bacteria | 981 |
| 303 | nmdc:mga05p37_990624_c1 | 3300050507 | Bacteria | 894 |
| 304 | nmdc:mga09592_1557664_c1 | 3300050508 | Bacteria | 536 |
| 305 | nmdc:mga09592_1659673_c1 | 3300050508 | Unclassified | 516 |
| 306 | nmdc:mga09592_193092_c1 | 3300050508 | Bacteria | 1762 |
| 307 | nmdc:mga09592_357764_c1 | 3300050508 | Bacteria | 1263 |
| 308 | nmdc:mga09592_930527_c1 | 3300050508 | Unclassified | 729 |
| 309 | nmdc:mga0qj67_344187_c1 | 3300050509 | Unclassified | 1206 |
| 310 | nmdc:mga0qj67_6751_c1 | 3300050509 | Bacteria | 8435 |
| 311 | nmdc:mga06r32_137712_c1 | 3300050510 | Bacteria | 2416 |
| 312 | nmdc:mga06r32_1561455_c1 | 3300050510 | Unclassified | 599 |
| 313 | nmdc:mga06r32_172925_c1 | 3300050510 | Bacteria | 2144 |
| 314 | nmdc:mga06r32_507151_c1 | 3300050510 | Bacteria | 1183 |
| 315 | nmdc:mga08y16_19166_c1 | 3300050511 | Bacteria | 7210 |
| 316 | nmdc:mga08y16_43412_c1 | 3300050511 | Unclassified | 4711 |
| 317 | nmdc:mga0n895_141481_c1 | 3300050512 | Bacteria | 2435 |
| 318 | nmdc:mga0n895_1423092_c1 | 3300050512 | Unclassified | 661 |
| 319 | nmdc:mga0n895_697322_c1 | 3300050512 | Unclassified | 1011 |
| 320 | nmdc:mga0rr50_301426_c1 | 3300050513 | Bacteria | 1341 |
| 321 | nmdc:mga0rr50_646700_c1 | 3300050513 | Unclassified | 902 |
| 322 | nmdc:mga0a205_221266_c1 | 3300050515 | Unclassified | 1778 |
| 323 | nmdc:mga0a205_28144_c1 | 3300050515 | Bacteria | 5372 |
| 324 | nmdc:mga0a205_389683_c1 | 3300050515 | Unclassified | 1258 |
| 325 | nmdc:mga0a205_53625_c1 | 3300050515 | Bacteria | 3892 |
| 326 | nmdc:mga0a205_68981_c1 | 3300050515 | Bacteria | 3415 |
| 327 | Ga0500616_0000897 | 3300053153 | Bacteria | 32667 |
| 328 | Ga0587083_0088154 | 3300059505 | Unclassified | 752 |
| 329 | Ga0587091_021316 | 3300059511 | Bacteria | 1134 |
| 330 | Ga0587091_053156 | 3300059511 | Unclassified | 838 |
| 331 | Ga0587072_065763 | 3300059643 | Unclassified | 756 |
| 332 | Ga0587107_013040 | 3300059652 | Bacteria | 1047 |
| 333 | Ga0501082_0821735 | 3300060353 | Unclassified | 813 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100213926 | Ga0070708_1002139263 | 91 |
| 2 | 3300005518 | Ga0070699_100175368 | Ga0070699_1001753682 | 91 |
| 3 | 3300006871 | Ga0075434_100015382 | Ga0075434_1000153829 | 91 |
| 4 | 3300005293 | Ga0065715_10093259 | Ga0065715_100932591 | 95 |
| 5 | 3300005615 | Ga0070702_100732292 | Ga0070702_1007322921 | 95 |
| 6 | 3300009147 | Ga0114129_10822207 | Ga0114129_108222073 | 95 |
| 7 | 3300009148 | Ga0105243_10339654 | Ga0105243_103396542 | 95 |
| 8 | 3300013306 | Ga0163162_11492177 | Ga0163162_114921772 | 95 |
| 9 | 3300025929 | Ga0207664_10615773 | Ga0207664_106157732 | 95 |
| 10 | 3300050507 | nmdc:mga05p37_863461_c1 | nmdc:mga05p37_863461_c1_295_585 | 96 |
| 11 | 3300005367 | Ga0070667_100749196 | Ga0070667_1007491962 | 98 |
| 12 | 3300005564 | Ga0070664_100535776 | Ga0070664_1005357763 | 98 |
| 13 | 3300005616 | Ga0068852_102076529 | Ga0068852_1020765291 | 98 |
| 14 | 3300005842 | Ga0068858_101771821 | Ga0068858_1017718212 | 98 |
| 15 | 3300026142 | Ga0207698_11743120 | Ga0207698_117431202 | 98 |
| 16 | 3300031548 | Ga0307408_100204194 | Ga0307408_1002041943 | 98 |
| 17 | 3300031731 | Ga0307405_10269566 | Ga0307405_102695662 | 98 |
| 18 | 3300032002 | Ga0307416_100250053 | Ga0307416_1002500533 | 98 |
| 19 | 3300032004 | Ga0307414_10482138 | Ga0307414_104821382 | 98 |
| 20 | 3300032126 | Ga0307415_100883886 | Ga0307415_1008838861 | 98 |
| 21 | 3300048914 | Ga0496111_0320070 | Ga0496111_0320070_810_1106 | 98 |
| 22 | 3300005334 | Ga0068869_100540549 | Ga0068869_1005405492 | 101 |
| 23 | 3300005345 | Ga0070692_10878778 | Ga0070692_108787781 | 101 |
| 24 | 3300005364 | Ga0070673_100139960 | Ga0070673_1001399602 | 101 |
| 25 | 3300005444 | Ga0070694_100182087 | Ga0070694_1001820871 | 101 |
| 26 | 3300005467 | Ga0070706_100829882 | Ga0070706_1008298822 | 101 |
| 27 | 3300005530 | Ga0070679_101214720 | Ga0070679_1012147201 | 101 |
| 28 | 3300005546 | Ga0070696_100231247 | Ga0070696_1002312471 | 101 |
| 29 | 3300005549 | Ga0070704_100659729 | Ga0070704_1006597291 | 101 |
| 30 | 3300005577 | Ga0068857_100948383 | Ga0068857_1009483832 | 101 |
| 31 | 3300005615 | Ga0070702_100100149 | Ga0070702_1001001494 | 101 |
| 32 | 3300005617 | Ga0068859_100043013 | Ga0068859_1000430136 | 101 |
| 33 | 3300005618 | Ga0068864_100050616 | Ga0068864_1000506163 | 101 |
| 34 | 3300005618 | Ga0068864_100834192 | Ga0068864_1008341921 | 101 |
| 35 | 3300005841 | Ga0068863_101126255 | Ga0068863_1011262552 | 101 |
| 36 | 3300005841 | Ga0068863_101421557 | Ga0068863_1014215571 | 101 |
| 37 | 3300005843 | Ga0068860_100587621 | Ga0068860_1005876213 | 101 |
| 38 | 3300006058 | Ga0075432_10063638 | Ga0075432_100636382 | 101 |
| 39 | 3300006173 | Ga0070716_100050800 | Ga0070716_1000508003 | 101 |
| 40 | 3300006852 | Ga0075433_10631770 | Ga0075433_106317702 | 101 |
| 41 | 3300006852 | Ga0075433_11417562 | Ga0075433_114175621 | 101 |
| 42 | 3300006871 | Ga0075434_100443683 | Ga0075434_1004436832 | 101 |
| 43 | 3300006880 | Ga0075429_100524553 | Ga0075429_1005245533 | 101 |
| 44 | 3300006931 | Ga0097620_100043012 | Ga0097620_1000430126 | 101 |
| 45 | 3300007076 | Ga0075435_100491753 | Ga0075435_1004917532 | 101 |
| 46 | 3300009101 | Ga0105247_10312357 | Ga0105247_103123572 | 101 |
| 47 | 3300009148 | Ga0105243_10255439 | Ga0105243_102554392 | 101 |
| 48 | 3300009174 | Ga0105241_10266042 | Ga0105241_102660422 | 101 |
| 49 | 3300009174 | Ga0105241_10401103 | Ga0105241_104011032 | 101 |
| 50 | 3300009174 | Ga0105241_11658862 | Ga0105241_116588622 | 101 |
| 51 | 3300009177 | Ga0105248_10582565 | Ga0105248_105825651 | 101 |
| 52 | 3300009553 | Ga0105249_10037982 | Ga0105249_100379825 | 101 |
| 53 | 3300009553 | Ga0105249_10910688 | Ga0105249_109106881 | 101 |
| 54 | 3300010375 | Ga0105239_11856163 | Ga0105239_118561631 | 101 |
| 55 | 3300011119 | Ga0105246_11270748 | Ga0105246_112707481 | 101 |
| 56 | 3300011119 | Ga0105246_12238265 | Ga0105246_122382652 | 101 |
| 57 | 3300013100 | Ga0157373_10445131 | Ga0157373_104451312 | 101 |
| 58 | 3300013306 | Ga0163162_11572787 | Ga0163162_115727872 | 101 |
| 59 | 3300014325 | Ga0163163_10602739 | Ga0163163_106027392 | 101 |
| 60 | 3300014326 | Ga0157380_10064983 | Ga0157380_100649835 | 101 |
| 61 | 3300025911 | Ga0207654_10749008 | Ga0207654_107490082 | 101 |
| 62 | 3300025914 | Ga0207671_10654867 | Ga0207671_106548671 | 101 |
| 63 | 3300025921 | Ga0207652_11342949 | Ga0207652_113429491 | 101 |
| 64 | 3300025935 | Ga0207709_10487026 | Ga0207709_104870262 | 101 |
| 65 | 3300025939 | Ga0207665_10046742 | Ga0207665_100467425 | 101 |
| 66 | 3300025942 | Ga0207689_10260187 | Ga0207689_102601872 | 101 |
| 67 | 3300025949 | Ga0207667_11232588 | Ga0207667_112325881 | 101 |
| 68 | 3300025960 | Ga0207651_10072289 | Ga0207651_100722893 | 101 |
| 69 | 3300025960 | Ga0207651_11471694 | Ga0207651_114716941 | 101 |
| 70 | 3300025961 | Ga0207712_10013261 | Ga0207712_100132616 | 101 |
| 71 | 3300025981 | Ga0207640_10113826 | Ga0207640_101138261 | 101 |
| 72 | 3300026088 | Ga0207641_10296288 | Ga0207641_102962881 | 101 |
| 73 | 3300026089 | Ga0207648_11737232 | Ga0207648_117372321 | 101 |
| 74 | 3300026095 | Ga0207676_10697074 | Ga0207676_106970741 | 101 |
| 75 | 3300026095 | Ga0207676_12179170 | Ga0207676_121791701 | 101 |
| 76 | 3300026116 | Ga0207674_10049583 | Ga0207674_100495836 | 101 |
| 77 | 3300026118 | Ga0207675_100327312 | Ga0207675_1003273123 | 101 |
| 78 | 3300027907 | Ga0207428_10878703 | Ga0207428_108787031 | 101 |
| 79 | 3300035088 | Ga0373940_0007898 | Ga0373940_0007898_805_1110 | 101 |
| 80 | 3300035091 | Ga0373951_0037777 | Ga0373951_0037777_708_1013 | 101 |
| 81 | 3300037418 | Ga0395900_0155581 | Ga0395900_0155581_1524_1829 | 101 |
| 82 | 3300048907 | Ga0496104_0373822 | Ga0496104_0373822_319_624 | 101 |
| 83 | 3300049661 | Ga0501217_330292 | Ga0501217_330292_65_370 | 101 |
| 84 | 3300050508 | nmdc:mga09592_357764_c1 | nmdc:mga09592_357764_c1_885_1190 | 101 |
| 85 | 3300050509 | nmdc:mga0qj67_344187_c1 | nmdc:mga0qj67_344187_c1_210_515 | 101 |
| 86 | 3300050510 | nmdc:mga06r32_507151_c1 | nmdc:mga06r32_507151_c1_165_470 | 101 |
| 87 | 3300050512 | nmdc:mga0n895_697322_c1 | nmdc:mga0n895_697322_c1_301_606 | 101 |
| 88 | 3300050513 | nmdc:mga0rr50_646700_c1 | nmdc:mga0rr50_646700_c1_422_727 | 101 |
| 89 | 3300005293 | Ga0065715_10012430 | Ga0065715_100124305 | 105 |
| 90 | 3300006846 | Ga0075430_100036512 | Ga0075430_1000365123 | 105 |
| 91 | 3300006847 | Ga0075431_100248584 | Ga0075431_1002485841 | 105 |
| 92 | 3300006847 | Ga0075431_100962748 | Ga0075431_1009627481 | 105 |
| 93 | 3300006880 | Ga0075429_100067436 | Ga0075429_1000674366 | 105 |
| 94 | 3300009148 | Ga0105243_10233966 | Ga0105243_102339663 | 105 |
| 95 | 3300025935 | Ga0207709_11527524 | Ga0207709_115275242 | 105 |
| 96 | 3300026035 | Ga0207703_10313492 | Ga0207703_103134922 | 105 |
| 97 | 3300049568 | Ga0501031_0527582 | Ga0501031_0527582_231_548 | 105 |
| 98 | 3300049575 | Ga0501039_1252847 | Ga0501039_1252847_71_388 | 105 |
| 99 | 3300049576 | Ga0501040_0346335 | Ga0501040_0346335_592_909 | 105 |
| 100 | 3300049578 | Ga0501042_0787998 | Ga0501042_0787998_279_596 | 105 |
| 101 | 3300049741 | Ga0501079_0195245 | Ga0501079_0195245_1051_1368 | 105 |
| 102 | 3300050508 | nmdc:mga09592_1557664_c1 | nmdc:mga09592_1557664_c1_84_401 | 105 |
| 103 | 3300050508 | nmdc:mga09592_193092_c1 | nmdc:mga09592_193092_c1_858_1175 | 105 |
| 104 | 3300050509 | nmdc:mga0qj67_6751_c1 | nmdc:mga0qj67_6751_c1_4275_4592 | 105 |
| 105 | 3300050510 | nmdc:mga06r32_137712_c1 | nmdc:mga06r32_137712_c1_1956_2273 | 105 |
| 106 | 3300060353 | Ga0501082_0821735 | Ga0501082_0821735_300_617 | 105 |
| 107 | 3300026075 | Ga0207708_10600361 | Ga0207708_106003612 | 107 |
| 108 | 2162886007 | SwRhRL2b_contig_967573 | SwRhRL2b_0004.00002640 | 108 |
| 109 | 3300005289 | Ga0065704_10002238 | Ga0065704_100022389 | 108 |
| 110 | 3300005293 | Ga0065715_10004674 | Ga0065715_100046747 | 108 |
| 111 | 3300005295 | Ga0065707_10090524 | Ga0065707_100905247 | 108 |
| 112 | 3300005331 | Ga0070670_100333213 | Ga0070670_1003332132 | 108 |
| 113 | 3300005331 | Ga0070670_100890855 | Ga0070670_1008908551 | 108 |
| 114 | 3300005334 | Ga0068869_100098173 | Ga0068869_1000981732 | 108 |
| 115 | 3300005337 | Ga0070682_100003672 | Ga0070682_1000036729 | 108 |
| 116 | 3300005340 | Ga0070689_100000044 | Ga0070689_10000004413 | 108 |
| 117 | 3300005345 | Ga0070692_10015599 | Ga0070692_100155994 | 108 |
| 118 | 3300005345 | Ga0070692_10022395 | Ga0070692_100223954 | 108 |
| 119 | 3300005345 | Ga0070692_10024124 | Ga0070692_100241243 | 108 |
| 120 | 3300005355 | Ga0070671_100009571 | Ga0070671_1000095713 | 108 |
| 121 | 3300005440 | Ga0070705_100027544 | Ga0070705_1000275444 | 108 |
| 122 | 3300005440 | Ga0070705_100342432 | Ga0070705_1003424322 | 108 |
| 123 | 3300005441 | Ga0070700_100050152 | Ga0070700_1000501522 | 108 |
| 124 | 3300005444 | Ga0070694_100056781 | Ga0070694_1000567814 | 108 |
| 125 | 3300005444 | Ga0070694_100355373 | Ga0070694_1003553732 | 108 |
| 126 | 3300005445 | Ga0070708_100123090 | Ga0070708_1001230902 | 108 |
| 127 | 3300005445 | Ga0070708_100311683 | Ga0070708_1003116831 | 108 |
| 128 | 3300005458 | Ga0070681_10001188 | Ga0070681_1000118821 | 108 |
| 129 | 3300005459 | Ga0068867_100192410 | Ga0068867_1001924103 | 108 |
| 130 | 3300005467 | Ga0070706_100099568 | Ga0070706_1000995683 | 108 |
| 131 | 3300005471 | Ga0070698_100000157 | Ga0070698_10000015734 | 108 |
| 132 | 3300005471 | Ga0070698_100082132 | Ga0070698_1000821326 | 108 |
| 133 | 3300005471 | Ga0070698_100182228 | Ga0070698_1001822282 | 108 |
| 134 | 3300005518 | Ga0070699_100018829 | Ga0070699_1000188295 | 108 |
| 135 | 3300005530 | Ga0070679_100262202 | Ga0070679_1002622022 | 108 |
| 136 | 3300005536 | Ga0070697_100000715 | Ga0070697_1000007155 | 108 |
| 137 | 3300005536 | Ga0070697_100004826 | Ga0070697_1000048262 | 108 |
| 138 | 3300005543 | Ga0070672_100239334 | Ga0070672_1002393342 | 108 |
| 139 | 3300005545 | Ga0070695_100035208 | Ga0070695_1000352084 | 108 |
| 140 | 3300005545 | Ga0070695_100161167 | Ga0070695_1001611673 | 108 |
| 141 | 3300005545 | Ga0070695_100217588 | Ga0070695_1002175881 | 108 |
| 142 | 3300005546 | Ga0070696_100049558 | Ga0070696_1000495582 | 108 |
| 143 | 3300005546 | Ga0070696_100149888 | Ga0070696_1001498882 | 108 |
| 144 | 3300005546 | Ga0070696_100667189 | Ga0070696_1006671892 | 108 |
| 145 | 3300005546 | Ga0070696_100717892 | Ga0070696_1007178922 | 108 |
| 146 | 3300005547 | Ga0070693_101119016 | Ga0070693_1011190162 | 108 |
| 147 | 3300005549 | Ga0070704_100349197 | Ga0070704_1003491971 | 108 |
| 148 | 3300005549 | Ga0070704_101251411 | Ga0070704_1012514111 | 108 |
| 149 | 3300005549 | Ga0070704_101459066 | Ga0070704_1014590662 | 108 |
| 150 | 3300005577 | Ga0068857_100032538 | Ga0068857_1000325381 | 108 |
| 151 | 3300005577 | Ga0068857_100103535 | Ga0068857_1001035352 | 108 |
| 152 | 3300005577 | Ga0068857_101378123 | Ga0068857_1013781231 | 108 |
| 153 | 3300005577 | Ga0068857_101864329 | Ga0068857_1018643291 | 108 |
| 154 | 3300005578 | Ga0068854_101093292 | Ga0068854_1010932922 | 108 |
| 155 | 3300005614 | Ga0068856_100148785 | Ga0068856_1001487852 | 108 |
| 156 | 3300005615 | Ga0070702_100010214 | Ga0070702_1000102141 | 108 |
| 157 | 3300005615 | Ga0070702_101159142 | Ga0070702_1011591421 | 108 |
| 158 | 3300005616 | Ga0068852_100147652 | Ga0068852_1001476524 | 108 |
| 159 | 3300005616 | Ga0068852_102690587 | Ga0068852_1026905871 | 108 |
| 160 | 3300005617 | Ga0068859_100036887 | Ga0068859_1000368875 | 108 |
| 161 | 3300005617 | Ga0068859_100113264 | Ga0068859_1001132642 | 108 |
| 162 | 3300005617 | Ga0068859_100125570 | Ga0068859_1001255702 | 108 |
| 163 | 3300005618 | Ga0068864_100194808 | Ga0068864_1001948082 | 108 |
| 164 | 3300005618 | Ga0068864_100396682 | Ga0068864_1003966823 | 108 |
| 165 | 3300005840 | Ga0068870_10013706 | Ga0068870_100137063 | 108 |
| 166 | 3300005840 | Ga0068870_10155010 | Ga0068870_101550101 | 108 |
| 167 | 3300005841 | Ga0068863_100008575 | Ga0068863_1000085755 | 108 |
| 168 | 3300005841 | Ga0068863_100056908 | Ga0068863_1000569083 | 108 |
| 169 | 3300005841 | Ga0068863_101274770 | Ga0068863_1012747702 | 108 |
| 170 | 3300005842 | Ga0068858_100427862 | Ga0068858_1004278623 | 108 |
| 171 | 3300005843 | Ga0068860_100008952 | Ga0068860_1000089522 | 108 |
| 172 | 3300005843 | Ga0068860_100086297 | Ga0068860_1000862972 | 108 |
| 173 | 3300005843 | Ga0068860_100540543 | Ga0068860_1005405431 | 108 |
| 174 | 3300005843 | Ga0068860_101664978 | Ga0068860_1016649782 | 108 |
| 175 | 3300005844 | Ga0068862_100077990 | Ga0068862_1000779902 | 108 |
| 176 | 3300005985 | Ga0081539_10000631 | Ga0081539_1000063156 | 108 |
| 177 | 3300006173 | Ga0070716_100132002 | Ga0070716_1001320023 | 108 |
| 178 | 3300006237 | Ga0097621_100009441 | Ga0097621_1000094414 | 108 |
| 179 | 3300006237 | Ga0097621_100356055 | Ga0097621_1003560553 | 108 |
| 180 | 3300006846 | Ga0075430_100729334 | Ga0075430_1007293342 | 108 |
| 181 | 3300006852 | Ga0075433_10043768 | Ga0075433_100437682 | 108 |
| 182 | 3300006852 | Ga0075433_10324831 | Ga0075433_103248313 | 108 |
| 183 | 3300006871 | Ga0075434_100875822 | Ga0075434_1008758222 | 108 |
| 184 | 3300006871 | Ga0075434_100886106 | Ga0075434_1008861061 | 108 |
| 185 | 3300006880 | Ga0075429_100019970 | Ga0075429_1000199708 | 108 |
| 186 | 3300006880 | Ga0075429_100480257 | Ga0075429_1004802572 | 108 |
| 187 | 3300006931 | Ga0097620_100036888 | Ga0097620_1000368885 | 108 |
| 188 | 3300006931 | Ga0097620_100113267 | Ga0097620_1001132672 | 108 |
| 189 | 3300006931 | Ga0097620_100125565 | Ga0097620_1001255654 | 108 |
| 190 | 3300007265 | Ga0099794_10266716 | Ga0099794_102667162 | 108 |
| 191 | 3300009011 | Ga0105251_10144702 | Ga0105251_101447022 | 108 |
| 192 | 3300009093 | Ga0105240_10078772 | Ga0105240_100787724 | 108 |
| 193 | 3300009094 | Ga0111539_10021514 | Ga0111539_100215143 | 108 |
| 194 | 3300009101 | Ga0105247_10202701 | Ga0105247_102027012 | 108 |
| 195 | 3300009101 | Ga0105247_10685115 | Ga0105247_106851152 | 108 |
| 196 | 3300009147 | Ga0114129_10019631 | Ga0114129_100196317 | 108 |
| 197 | 3300009147 | Ga0114129_10157711 | Ga0114129_101577113 | 108 |
| 198 | 3300009147 | Ga0114129_10204705 | Ga0114129_102047055 | 108 |
| 199 | 3300009147 | Ga0114129_10212972 | Ga0114129_102129722 | 108 |
| 200 | 3300009147 | Ga0114129_12269658 | Ga0114129_122696581 | 108 |
| 201 | 3300009147 | Ga0114129_12470847 | Ga0114129_124708471 | 108 |
| 202 | 3300009148 | Ga0105243_10002037 | Ga0105243_100020376 | 108 |
| 203 | 3300009148 | Ga0105243_10177770 | Ga0105243_101777704 | 108 |
| 204 | 3300009174 | Ga0105241_10026486 | Ga0105241_100264863 | 108 |
| 205 | 3300009174 | Ga0105241_10232188 | Ga0105241_102321883 | 108 |
| 206 | 3300009174 | Ga0105241_10352030 | Ga0105241_103520302 | 108 |
| 207 | 3300009174 | Ga0105241_10584416 | Ga0105241_105844162 | 108 |
| 208 | 3300009174 | Ga0105241_10601804 | Ga0105241_106018042 | 108 |
| 209 | 3300009174 | Ga0105241_11112667 | Ga0105241_111126672 | 108 |
| 210 | 3300009174 | Ga0105241_11680820 | Ga0105241_116808201 | 108 |
| 211 | 3300009176 | Ga0105242_12713070 | Ga0105242_127130701 | 108 |
| 212 | 3300009177 | Ga0105248_10394872 | Ga0105248_103948723 | 108 |
| 213 | 3300009177 | Ga0105248_13357415 | Ga0105248_133574151 | 108 |
| 214 | 3300009545 | Ga0105237_10226644 | Ga0105237_102266442 | 108 |
| 215 | 3300009551 | Ga0105238_10046989 | Ga0105238_100469894 | 108 |
| 216 | 3300010375 | Ga0105239_10707470 | Ga0105239_107074701 | 108 |
| 217 | 3300011119 | Ga0105246_10073205 | Ga0105246_100732051 | 108 |
| 218 | 3300011119 | Ga0105246_10532140 | Ga0105246_105321402 | 108 |
| 219 | 3300011119 | Ga0105246_10641796 | Ga0105246_106417962 | 108 |
| 220 | 3300013100 | Ga0157373_10019089 | Ga0157373_100190892 | 108 |
| 221 | 3300013100 | Ga0157373_10041966 | Ga0157373_100419666 | 108 |
| 222 | 3300013100 | Ga0157373_10046354 | Ga0157373_100463545 | 108 |
| 223 | 3300013100 | Ga0157373_10150885 | Ga0157373_101508853 | 108 |
| 224 | 3300013102 | Ga0157371_10362182 | Ga0157371_103621823 | 108 |
| 225 | 3300013307 | Ga0157372_10603763 | Ga0157372_106037632 | 108 |
| 226 | 3300013307 | Ga0157372_11967760 | Ga0157372_119677602 | 108 |
| 227 | 3300013307 | Ga0157372_13474855 | Ga0157372_134748552 | 108 |
| 228 | 3300013308 | Ga0157375_11368242 | Ga0157375_113682422 | 108 |
| 229 | 3300014325 | Ga0163163_10549872 | Ga0163163_105498721 | 108 |
| 230 | 3300014325 | Ga0163163_10723146 | Ga0163163_107231462 | 108 |
| 231 | 3300014326 | Ga0157380_10946497 | Ga0157380_109464972 | 108 |
| 232 | 3300014969 | Ga0157376_10952984 | Ga0157376_109529842 | 108 |
| 233 | 3300015262 | Ga0182007_10068279 | Ga0182007_100682792 | 108 |
| 234 | 3300025900 | Ga0207710_10278948 | Ga0207710_102789482 | 108 |
| 235 | 3300025900 | Ga0207710_10538421 | Ga0207710_105384211 | 108 |
| 236 | 3300025904 | Ga0207647_10000659 | Ga0207647_1000065918 | 108 |
| 237 | 3300025907 | Ga0207645_10736522 | Ga0207645_107365221 | 108 |
| 238 | 3300025908 | Ga0207643_10023332 | Ga0207643_100233327 | 108 |
| 239 | 3300025908 | Ga0207643_10048386 | Ga0207643_100483864 | 108 |
| 240 | 3300025908 | Ga0207643_10609910 | Ga0207643_106099102 | 108 |
| 241 | 3300025911 | Ga0207654_10464234 | Ga0207654_104642342 | 108 |
| 242 | 3300025912 | Ga0207707_10007101 | Ga0207707_100071016 | 108 |
| 243 | 3300025913 | Ga0207695_10211870 | Ga0207695_102118703 | 108 |
| 244 | 3300025921 | Ga0207652_10211784 | Ga0207652_102117843 | 108 |
| 245 | 3300025922 | Ga0207646_11002734 | Ga0207646_110027342 | 108 |
| 246 | 3300025924 | Ga0207694_10042707 | Ga0207694_100427074 | 108 |
| 247 | 3300025925 | Ga0207650_10164730 | Ga0207650_101647303 | 108 |
| 248 | 3300025925 | Ga0207650_10214997 | Ga0207650_102149973 | 108 |
| 249 | 3300025925 | Ga0207650_10736294 | Ga0207650_107362941 | 108 |
| 250 | 3300025931 | Ga0207644_10009622 | Ga0207644_100096223 | 108 |
| 251 | 3300025935 | Ga0207709_10003731 | Ga0207709_1000373110 | 108 |
| 252 | 3300025936 | Ga0207670_10498612 | Ga0207670_104986122 | 108 |
| 253 | 3300025939 | Ga0207665_10527294 | Ga0207665_105272942 | 108 |
| 254 | 3300025941 | Ga0207711_10027100 | Ga0207711_100271005 | 108 |
| 255 | 3300025942 | Ga0207689_10113321 | Ga0207689_101133212 | 108 |
| 256 | 3300025942 | Ga0207689_10189213 | Ga0207689_101892132 | 108 |
| 257 | 3300025942 | Ga0207689_11498210 | Ga0207689_114982102 | 108 |
| 258 | 3300025945 | Ga0207679_10561288 | Ga0207679_105612882 | 108 |
| 259 | 3300025960 | Ga0207651_10278220 | Ga0207651_102782202 | 108 |
| 260 | 3300026035 | Ga0207703_10043940 | Ga0207703_100439402 | 108 |
| 261 | 3300026035 | Ga0207703_10513791 | Ga0207703_105137911 | 108 |
| 262 | 3300026041 | Ga0207639_10052289 | Ga0207639_100522895 | 108 |
| 263 | 3300026075 | Ga0207708_10023008 | Ga0207708_100230085 | 108 |
| 264 | 3300026075 | Ga0207708_10030760 | Ga0207708_100307604 | 108 |
| 265 | 3300026075 | Ga0207708_11514252 | Ga0207708_115142521 | 108 |
| 266 | 3300026078 | Ga0207702_10107400 | Ga0207702_101074002 | 108 |
| 267 | 3300026088 | Ga0207641_10029580 | Ga0207641_100295808 | 108 |
| 268 | 3300026089 | Ga0207648_10405149 | Ga0207648_104051491 | 108 |
| 269 | 3300026095 | Ga0207676_11494642 | Ga0207676_114946422 | 108 |
| 270 | 3300026095 | Ga0207676_11873996 | Ga0207676_118739962 | 108 |
| 271 | 3300026095 | Ga0207676_12144330 | Ga0207676_121443301 | 108 |
| 272 | 3300026095 | Ga0207676_12341257 | Ga0207676_123412571 | 108 |
| 273 | 3300026116 | Ga0207674_10021115 | Ga0207674_100211158 | 108 |
| 274 | 3300026116 | Ga0207674_10655511 | Ga0207674_106555112 | 108 |
| 275 | 3300026116 | Ga0207674_11690765 | Ga0207674_116907651 | 108 |
| 276 | 3300026121 | Ga0207683_11863608 | Ga0207683_118636082 | 108 |
| 277 | 3300027907 | Ga0207428_10031098 | Ga0207428_100310982 | 108 |
| 278 | 3300027907 | Ga0207428_10153633 | Ga0207428_101536331 | 108 |
| 279 | 3300028380 | Ga0268265_10074127 | Ga0268265_100741272 | 108 |
| 280 | 3300028381 | Ga0268264_10582702 | Ga0268264_105827022 | 108 |
| 281 | 3300028381 | Ga0268264_10671129 | Ga0268264_106711291 | 108 |
| 282 | 3300031548 | Ga0307408_100053612 | Ga0307408_1000536123 | 108 |
| 283 | 3300031548 | Ga0307408_100489393 | Ga0307408_1004893932 | 108 |
| 284 | 3300031731 | Ga0307405_10117080 | Ga0307405_101170802 | 108 |
| 285 | 3300032002 | Ga0307416_100048933 | Ga0307416_1000489332 | 108 |
| 286 | 3300032005 | Ga0307411_10273531 | Ga0307411_102735313 | 108 |
| 287 | 3300034818 | Ga0373950_0078014 | Ga0373950_0078014_133_459 | 108 |
| 288 | 3300035115 | Ga0373941_0324944 | Ga0373941_0324944_210_536 | 108 |
| 289 | 3300037418 | Ga0395900_0236250 | Ga0395900_0236250_752_1078 | 108 |
| 290 | 3300042005 | Ga0439448_0190983 | Ga0439448_0190983_95_421 | 108 |
| 291 | 3300042157 | Ga0439458_0004183 | Ga0439458_0004183_533_859 | 108 |
| 292 | 3300044673 | Ga0453683_0108856 | Ga0453683_0108856_536_862 | 108 |
| 293 | 3300045051 | Ga0451576_1200081 | Ga0451576_1200081_108_434 | 108 |
| 294 | 3300048911 | Ga0496108_0290623 | Ga0496108_0290623_661_990 | 108 |
| 295 | 3300048913 | Ga0496110_0087766 | Ga0496110_0087766_20_346 | 108 |
| 296 | 3300048915 | Ga0496112_0598314 | Ga0496112_0598314_158_484 | 108 |
| 297 | 3300049514 | Ga0501291_044844 | Ga0501291_044844_363_689 | 108 |
| 298 | 3300049520 | Ga0501297_026062 | Ga0501297_026062_100_426 | 108 |
| 299 | 3300049574 | Ga0501038_0023486 | Ga0501038_0023486_4289_4615 | 108 |
| 300 | 3300049582 | Ga0501048_0445493 | Ga0501048_0445493_259_585 | 108 |
| 301 | 3300049652 | Ga0501202_100263 | Ga0501202_100263_195_521 | 108 |
| 302 | 3300049663 | Ga0501223_031816 | Ga0501223_031816_195_521 | 108 |
| 303 | 3300049669 | Ga0501235_018347 | Ga0501235_018347_781_1107 | 108 |
| 304 | 3300049686 | Ga0501257_020345 | Ga0501257_020345_506_832 | 108 |
| 305 | 3300049687 | Ga0501258_056852 | Ga0501258_056852_179_505 | 108 |
| 306 | 3300049688 | Ga0501259_110896 | Ga0501259_110896_173_499 | 108 |
| 307 | 3300049690 | Ga0501261_075837 | Ga0501261_075837_160_486 | 108 |
| 308 | 3300049704 | Ga0501221_032473 | Ga0501221_032473_67_393 | 108 |
| 309 | 3300049705 | Ga0501225_0078271 | Ga0501225_0078271_400_726 | 108 |
| 310 | 3300050507 | nmdc:mga05p37_1383299_c1 | nmdc:mga05p37_1383299_c1_362_688 | 108 |
| 311 | 3300050507 | nmdc:mga05p37_253578_c1 | nmdc:mga05p37_253578_c1_333_659 | 108 |
| 312 | 3300050507 | nmdc:mga05p37_267027_c1 | nmdc:mga05p37_267027_c1_271_597 | 108 |
| 313 | 3300050507 | nmdc:mga05p37_990624_c1 | nmdc:mga05p37_990624_c1_384_710 | 108 |
| 314 | 3300050508 | nmdc:mga09592_1659673_c1 | nmdc:mga09592_1659673_c1_61_387 | 108 |
| 315 | 3300050508 | nmdc:mga09592_930527_c1 | nmdc:mga09592_930527_c1_273_599 | 108 |
| 316 | 3300050510 | nmdc:mga06r32_1561455_c1 | nmdc:mga06r32_1561455_c1_39_365 | 108 |
| 317 | 3300050510 | nmdc:mga06r32_172925_c1 | nmdc:mga06r32_172925_c1_784_1110 | 108 |
| 318 | 3300050511 | nmdc:mga08y16_19166_c1 | nmdc:mga08y16_19166_c1_3114_3440 | 108 |
| 319 | 3300050511 | nmdc:mga08y16_43412_c1 | nmdc:mga08y16_43412_c1_3712_4038 | 108 |
| 320 | 3300050512 | nmdc:mga0n895_141481_c1 | nmdc:mga0n895_141481_c1_814_1140 | 108 |
| 321 | 3300050512 | nmdc:mga0n895_1423092_c1 | nmdc:mga0n895_1423092_c1_287_613 | 108 |
| 322 | 3300050513 | nmdc:mga0rr50_301426_c1 | nmdc:mga0rr50_301426_c1_205_531 | 108 |
| 323 | 3300050515 | nmdc:mga0a205_221266_c1 | nmdc:mga0a205_221266_c1_735_1061 | 108 |
| 324 | 3300050515 | nmdc:mga0a205_28144_c1 | nmdc:mga0a205_28144_c1_4922_5248 | 108 |
| 325 | 3300050515 | nmdc:mga0a205_389683_c1 | nmdc:mga0a205_389683_c1_921_1247 | 108 |
| 326 | 3300050515 | nmdc:mga0a205_53625_c1 | nmdc:mga0a205_53625_c1_2794_3120 | 108 |
| 327 | 3300050515 | nmdc:mga0a205_68981_c1 | nmdc:mga0a205_68981_c1_162_488 | 108 |
| 328 | 3300053153 | Ga0500616_0000897 | Ga0500616_0000897_12982_13311 | 108 |
| 329 | 3300059505 | Ga0587083_0088154 | Ga0587083_0088154_84_410 | 108 |
| 330 | 3300059511 | Ga0587091_021316 | Ga0587091_021316_646_975 | 108 |
| 331 | 3300059511 | Ga0587091_053156 | Ga0587091_053156_104_430 | 108 |
| 332 | 3300059643 | Ga0587072_065763 | Ga0587072_065763_49_378 | 108 |
| 333 | 3300059652 | Ga0587107_013040 | Ga0587107_013040_82_411 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.8785 | 4 | 107 |
| 2pwj-assembly2.cif.gz_B | structure of a mitochondrial type ii peroxiredoxin from pisum sativum | 0.8585 | 3 | 103 |
| 2wfc-assembly1.cif.gz_D | crystal structure of peroxiredoxin 5 from arenicola marina | 0.8451 | 3 | 103 |
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.8417 | 4 | 107 |
| 5k2j-assembly4.cif.gz_H | crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus | 0.8415 | 3 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D1A0_27_140_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9087 | 9 | 56 | 3.40.30.10 |
| af_Q9ZUU2_69_247_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9086 | 2 | 57 | 3.40.30.10 |
| af_A0A0R4J5B9_27_197_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8615 | 3 | 102 | 3.40.30.10 |
| af_Q54N76_3_172_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8543 | 3 | 103 | 3.40.30.10 |
| af_A0A2R8QV36_125_297_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.854 | 2 | 106 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9HH60-F1-model_v4 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein | 0.989 | 1 | 56 |
GO:0016209
GO:0016491 |
| AF-A0A7C7C715-F1-model_v4 | deleted | 0.9489 | 5 | 55 |
|
| AF-A0A537Z0U6-F1-model_v4 | Redoxin domain-containing protein | 0.9367 | 1 | 84 |
GO:0016209
GO:0016491 |
| AF-A0A817N411-F1-model_v4 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein | 0.9364 | 4 | 55 |
GO:0016209
GO:0016491 |
| AF-A0A2E1A0N9-F1-model_v4 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein | 0.9353 | 4 | 60 |
GO:0016209
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar