F411228

General Info

Members Datasets Scaffolds Average Seq Length
333 167 333 106

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100890855|Ga0070670_1008908551
Length 113
Sequence LCNSELRSIEKNLDKLRAAGIRPVAISIDTPEESRKLSQQMGYTFTILSDSNAEVIKRYDLVHAGAGENGRDIARPAEFLVDTSGTVRWVNLTENYTVRARPEQILNAANSLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
136 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
151 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
152 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 1.5
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_967573 2162886007 Unclassified 1572
2 Ga0065704_10002238 3300005289 Bacteria 5587
3 Ga0065715_10004674 3300005293 Bacteria 6035
4 Ga0065715_10012430 3300005293 Bacteria 2290
5 Ga0065715_10093259 3300005293 Bacteria 4749
6 Ga0065707_10090524 3300005295 Bacteria 4123
7 Ga0070670_100333213 3300005331 Unclassified 1331
8 Ga0070670_100890855 3300005331 Bacteria 806
9 Ga0068869_100098173 3300005334 Bacteria 2212
10 Ga0068869_100540549 3300005334 Unclassified 977
11 Ga0070682_100003672 3300005337 Bacteria 8518
12 Ga0070689_100000044 3300005340 Bacteria 76920
13 Ga0070692_10015599 3300005345 Bacteria 3597
14 Ga0070692_10022395 3300005345 Bacteria 3086
15 Ga0070692_10024124 3300005345 Unclassified 2987
16 Ga0070692_10878778 3300005345 Unclassified 618
17 Ga0070671_100009571 3300005355 Bacteria 7786
18 Ga0070673_100139960 3300005364 Unclassified 2040
19 Ga0070667_100749196 3300005367 Unclassified 905
20 Ga0070705_100027544 3300005440 Bacteria 3104
21 Ga0070705_100342432 3300005440 Unclassified 1087
22 Ga0070700_100050152 3300005441 Unclassified 2594
23 Ga0070694_100056781 3300005444 Unclassified 2660
24 Ga0070694_100182087 3300005444 Bacteria 1555
25 Ga0070694_100355373 3300005444 Bacteria 1136
26 Ga0070708_100123090 3300005445 Bacteria 2394
27 Ga0070708_100213926 3300005445 Bacteria 1806
28 Ga0070708_100311683 3300005445 Bacteria 1482
29 Ga0070681_10001188 3300005458 Bacteria 22550
30 Ga0068867_100192410 3300005459 Bacteria 1629
31 Ga0070706_100099568 3300005467 Unclassified 2700
32 Ga0070706_100829882 3300005467 Unclassified 855
33 Ga0070698_100000157 3300005471 Bacteria 61949
34 Ga0070698_100082132 3300005471 Bacteria 3215
35 Ga0070698_100182228 3300005471 Bacteria 2038
36 Ga0070699_100018829 3300005518 Bacteria 5931
37 Ga0070699_100175368 3300005518 Bacteria 1901
38 Ga0070679_100262202 3300005530 Unclassified 1683
39 Ga0070679_101214720 3300005530 Unclassified 699
40 Ga0070697_100000715 3300005536 Bacteria 24741
41 Ga0070697_100004826 3300005536 Bacteria 10335
42 Ga0070672_100239334 3300005543 Bacteria 1526
43 Ga0070695_100035208 3300005545 Bacteria 3144
44 Ga0070695_100161167 3300005545 Unclassified 1574
45 Ga0070695_100217588 3300005545 Unclassified 1375
46 Ga0070696_100049558 3300005546 Bacteria 2917
47 Ga0070696_100149888 3300005546 Bacteria 1711
48 Ga0070696_100231247 3300005546 Unclassified 1391
49 Ga0070696_100667189 3300005546 Bacteria 844
50 Ga0070696_100717892 3300005546 Unclassified 816
51 Ga0070693_101119016 3300005547 Bacteria 601
52 Ga0070704_100349197 3300005549 Bacteria 1248
53 Ga0070704_100659729 3300005549 Archaea 924
54 Ga0070704_101251411 3300005549 Unclassified 678
55 Ga0070704_101459066 3300005549 Unclassified 629
56 Ga0070664_100535776 3300005564 Unclassified 1082
57 Ga0068857_100032538 3300005577 Bacteria 4612
58 Ga0068857_100103535 3300005577 Bacteria 2555
59 Ga0068857_100948383 3300005577 Unclassified 826
60 Ga0068857_101378123 3300005577 Bacteria 686
61 Ga0068857_101864329 3300005577 Unclassified 589
62 Ga0068854_101093292 3300005578 Bacteria 710
63 Ga0068856_100148785 3300005614 Bacteria 2350
64 Ga0070702_100010214 3300005615 Bacteria 4616
65 Ga0070702_100100149 3300005615 Bacteria 1776
66 Ga0070702_100732292 3300005615 Unclassified 757
67 Ga0070702_101159142 3300005615 Unclassified 621
68 Ga0068852_100147652 3300005616 Bacteria 2183
69 Ga0068852_102076529 3300005616 Unclassified 590
70 Ga0068852_102690587 3300005616 Unclassified 517
71 Ga0068859_100036887 3300005617 Bacteria 4907
72 Ga0068859_100043013 3300005617 Bacteria 4539
73 Ga0068859_100113264 3300005617 Bacteria 2776
74 Ga0068859_100125570 3300005617 Bacteria 2635
75 Ga0068864_100050616 3300005618 Bacteria 3576
76 Ga0068864_100194808 3300005618 Bacteria 1859
77 Ga0068864_100396682 3300005618 Unclassified 1310
78 Ga0068864_100834192 3300005618 Bacteria 908
79 Ga0068870_10013706 3300005840 Bacteria 3816
80 Ga0068870_10155010 3300005840 Unclassified 1353
81 Ga0068863_100008575 3300005841 Bacteria 9990
82 Ga0068863_100056908 3300005841 Bacteria 3702
83 Ga0068863_101126255 3300005841 Unclassified 790
84 Ga0068863_101274770 3300005841 Unclassified 741
85 Ga0068863_101421557 3300005841 Unclassified 701
86 Ga0068858_100427862 3300005842 Bacteria 1274
87 Ga0068858_101771821 3300005842 Unclassified 610
88 Ga0068860_100008952 3300005843 Bacteria 9971
89 Ga0068860_100086297 3300005843 Bacteria 2987
90 Ga0068860_100540543 3300005843 Unclassified 1166
91 Ga0068860_100587621 3300005843 Unclassified 1118
92 Ga0068860_101664978 3300005843 Unclassified 660
93 Ga0068862_100077990 3300005844 Bacteria 2869
94 Ga0081539_10000631 3300005985 Bacteria 71279
95 Ga0075432_10063638 3300006058 Bacteria 1317
96 Ga0070716_100050800 3300006173 Unclassified 2355
97 Ga0070716_100132002 3300006173 Bacteria 1580
98 Ga0097621_100009441 3300006237 Bacteria 7080
99 Ga0097621_100356055 3300006237 Unclassified 1303
100 Ga0075430_100036512 3300006846 Bacteria 4166
101 Ga0075430_100729334 3300006846 Unclassified 817
102 Ga0075431_100248584 3300006847 Bacteria 1807
103 Ga0075431_100962748 3300006847 Bacteria 821
104 Ga0075433_10043768 3300006852 Bacteria 3888
105 Ga0075433_10324831 3300006852 Unclassified 1361
106 Ga0075433_10631770 3300006852 Bacteria 939
107 Ga0075433_11417562 3300006852 Bacteria 601
108 Ga0075434_100015382 3300006871 Bacteria 7331
109 Ga0075434_100443683 3300006871 Unclassified 1319
110 Ga0075434_100875822 3300006871 Unclassified 913
111 Ga0075434_100886106 3300006871 Bacteria 907
112 Ga0075429_100019970 3300006880 Bacteria 5810
113 Ga0075429_100067436 3300006880 Unclassified 3113
114 Ga0075429_100480257 3300006880 Bacteria 1089
115 Ga0075429_100524553 3300006880 Bacteria 1038
116 Ga0097620_100036888 3300006931 Bacteria 4907
117 Ga0097620_100043012 3300006931 Bacteria 4539
118 Ga0097620_100113267 3300006931 Bacteria 2776
119 Ga0097620_100125565 3300006931 Bacteria 2635
120 Ga0075435_100491753 3300007076 Bacteria 1060
121 Ga0099794_10266716 3300007265 Bacteria 884
122 Ga0105251_10144702 3300009011 Unclassified 1075
123 Ga0105240_10078772 3300009093 Bacteria 4057
124 Ga0111539_10021514 3300009094 Bacteria 7935
125 Ga0105247_10202701 3300009101 Unclassified 1334
126 Ga0105247_10312357 3300009101 Bacteria 1094
127 Ga0105247_10685115 3300009101 Unclassified 770
128 Ga0114129_10019631 3300009147 Bacteria 9619
129 Ga0114129_10157711 3300009147 Bacteria 3103
130 Ga0114129_10204705 3300009147 Unclassified 2671
131 Ga0114129_10212972 3300009147 Bacteria 2611
132 Ga0114129_10822207 3300009147 Bacteria 1183
133 Ga0114129_12269658 3300009147 Bacteria 652
134 Ga0114129_12470847 3300009147 Unclassified 621
135 Ga0105243_10002037 3300009148 Bacteria 17142
136 Ga0105243_10177770 3300009148 Bacteria 1848
137 Ga0105243_10233966 3300009148 Bacteria 1632
138 Ga0105243_10255439 3300009148 Bacteria 1567
139 Ga0105243_10339654 3300009148 Bacteria 1375
140 Ga0105241_10026486 3300009174 Bacteria 4315
141 Ga0105241_10232188 3300009174 Unclassified 1556
142 Ga0105241_10266042 3300009174 Unclassified 1459
143 Ga0105241_10352030 3300009174 Unclassified 1279
144 Ga0105241_10401103 3300009174 Bacteria 1203
145 Ga0105241_10584416 3300009174 Bacteria 1007
146 Ga0105241_10601804 3300009174 Unclassified 993
147 Ga0105241_11112667 3300009174 Bacteria 744
148 Ga0105241_11658862 3300009174 Unclassified 620
149 Ga0105241_11680820 3300009174 Bacteria 616
150 Ga0105242_12713070 3300009176 Unclassified 545
151 Ga0105248_10394872 3300009177 Bacteria 1557
152 Ga0105248_10582565 3300009177 Unclassified 1262
153 Ga0105248_13357415 3300009177 Bacteria 509
154 Ga0105237_10226644 3300009545 Bacteria 1869
155 Ga0105238_10046989 3300009551 Bacteria 4353
156 Ga0105249_10037982 3300009553 Unclassified 4370
157 Ga0105249_10910688 3300009553 Bacteria 946
158 Ga0105239_10707470 3300010375 Bacteria 1152
159 Ga0105239_11856163 3300010375 Unclassified 699
160 Ga0105246_10073205 3300011119 Bacteria 2418
161 Ga0105246_10532140 3300011119 Unclassified 1004
162 Ga0105246_10641796 3300011119 Unclassified 923
163 Ga0105246_11270748 3300011119 Unclassified 681
164 Ga0105246_12238265 3300011119 Unclassified 533
165 Ga0157373_10019089 3300013100 Bacteria 4991
166 Ga0157373_10041966 3300013100 Bacteria 3271
167 Ga0157373_10046354 3300013100 Unclassified 3101
168 Ga0157373_10150885 3300013100 Bacteria 1635
169 Ga0157373_10445131 3300013100 Unclassified 932
170 Ga0157371_10362182 3300013102 Bacteria 1057
171 Ga0163162_11492177 3300013306 Unclassified 770
172 Ga0163162_11572787 3300013306 Bacteria 750
173 Ga0157372_10603763 3300013307 Bacteria 1279
174 Ga0157372_11967760 3300013307 Bacteria 672
175 Ga0157372_13474855 3300013307 Unclassified 501
176 Ga0157375_11368242 3300013308 Unclassified 833
177 Ga0163163_10549872 3300014325 Bacteria 1217
178 Ga0163163_10602739 3300014325 Unclassified 1161
179 Ga0163163_10723146 3300014325 Bacteria 1059
180 Ga0157380_10064983 3300014326 Bacteria 2931
181 Ga0157380_10946497 3300014326 Bacteria 891
182 Ga0157376_10952984 3300014969 Unclassified 879
183 Ga0182007_10068279 3300015262 Bacteria 1165
184 Ga0207710_10278948 3300025900 Unclassified 841
185 Ga0207710_10538421 3300025900 Unclassified 608
186 Ga0207647_10000659 3300025904 Bacteria 26975
187 Ga0207645_10736522 3300025907 Bacteria 670
188 Ga0207643_10023332 3300025908 Bacteria 3410
189 Ga0207643_10048386 3300025908 Unclassified 2408
190 Ga0207643_10609910 3300025908 Unclassified 703
191 Ga0207654_10464234 3300025911 Bacteria 890
192 Ga0207654_10749008 3300025911 Unclassified 704
193 Ga0207707_10007101 3300025912 Bacteria 9758
194 Ga0207695_10211870 3300025913 Bacteria 1848
195 Ga0207671_10654867 3300025914 Bacteria 836
196 Ga0207652_10211784 3300025921 Unclassified 1745
197 Ga0207652_11342949 3300025921 Unclassified 618
198 Ga0207646_11002734 3300025922 Bacteria 738
199 Ga0207694_10042707 3300025924 Bacteria 3498
200 Ga0207650_10164730 3300025925 Bacteria 1758
201 Ga0207650_10214997 3300025925 Unclassified 1545
202 Ga0207650_10736294 3300025925 Unclassified 834
203 Ga0207664_10615773 3300025929 Unclassified 975
204 Ga0207644_10009622 3300025931 Bacteria 6347
205 Ga0207709_10003731 3300025935 Bacteria 8968
206 Ga0207709_10487026 3300025935 Bacteria 960
207 Ga0207709_11527524 3300025935 Unclassified 554
208 Ga0207670_10498612 3300025936 Bacteria 988
209 Ga0207665_10046742 3300025939 Bacteria 2900
210 Ga0207665_10527294 3300025939 Bacteria 915
211 Ga0207711_10027100 3300025941 Bacteria 4811
212 Ga0207689_10113321 3300025942 Unclassified 2229
213 Ga0207689_10189213 3300025942 Bacteria 1698
214 Ga0207689_10260187 3300025942 Unclassified 1435
215 Ga0207689_11498210 3300025942 Bacteria 563
216 Ga0207679_10561288 3300025945 Unclassified 1025
217 Ga0207667_11232588 3300025949 Bacteria 727
218 Ga0207651_10072289 3300025960 Unclassified 2448
219 Ga0207651_10278220 3300025960 Bacteria 1382
220 Ga0207651_11471694 3300025960 Unclassified 613
221 Ga0207712_10013261 3300025961 Bacteria 5282
222 Ga0207640_10113826 3300025981 Bacteria 1924
223 Ga0207703_10043940 3300026035 Bacteria 3588
224 Ga0207703_10313492 3300026035 Bacteria 1434
225 Ga0207703_10513791 3300026035 Bacteria 1126
226 Ga0207639_10052289 3300026041 Bacteria 3112
227 Ga0207708_10023008 3300026075 Bacteria 4707
228 Ga0207708_10030760 3300026075 Unclassified 4072
229 Ga0207708_10600361 3300026075 Unclassified 932
230 Ga0207708_11514252 3300026075 Unclassified 589
231 Ga0207702_10107400 3300026078 Bacteria 2475
232 Ga0207641_10029580 3300026088 Bacteria 4532
233 Ga0207641_10296288 3300026088 Bacteria 1526
234 Ga0207648_10405149 3300026089 Bacteria 1236
235 Ga0207648_11737232 3300026089 Unclassified 585
236 Ga0207676_10697074 3300026095 Unclassified 983
237 Ga0207676_11494642 3300026095 Unclassified 672
238 Ga0207676_11873996 3300026095 Bacteria 598
239 Ga0207676_12144330 3300026095 Unclassified 557
240 Ga0207676_12179170 3300026095 Unclassified 552
241 Ga0207676_12341257 3300026095 Unclassified 531
242 Ga0207674_10021115 3300026116 Bacteria 7020
243 Ga0207674_10049583 3300026116 Bacteria 4294
244 Ga0207674_10655511 3300026116 Bacteria 1014
245 Ga0207674_11690765 3300026116 Unclassified 601
246 Ga0207675_100327312 3300026118 Unclassified 1497
247 Ga0207683_11863608 3300026121 Unclassified 550
248 Ga0207698_11743120 3300026142 Unclassified 638
249 Ga0207428_10031098 3300027907 Bacteria 4410
250 Ga0207428_10153633 3300027907 Unclassified 1751
251 Ga0207428_10878703 3300027907 Unclassified 634
252 Ga0268265_10074127 3300028380 Bacteria 2661
253 Ga0268264_10582702 3300028381 Unclassified 1101
254 Ga0268264_10671129 3300028381 Bacteria 1027
255 Ga0307408_100053612 3300031548 Unclassified 2913
256 Ga0307408_100204194 3300031548 Bacteria 1602
257 Ga0307408_100489393 3300031548 Bacteria 1075
258 Ga0307405_10117080 3300031731 Unclassified 1816
259 Ga0307405_10269566 3300031731 Bacteria 1276
260 Ga0307416_100048933 3300032002 Unclassified 3358
261 Ga0307416_100250053 3300032002 Bacteria 1725
262 Ga0307414_10482138 3300032004 Bacteria 1094
263 Ga0307411_10273531 3300032005 Bacteria 1341
264 Ga0307415_100883886 3300032126 Unclassified 822
265 Ga0373950_0078014 3300034818 Bacteria 688
266 Ga0373940_0007898 3300035088 Unclassified 2420
267 Ga0373951_0037777 3300035091 Unclassified 1156
268 Ga0373941_0324944 3300035115 Unclassified 620
269 Ga0395900_0155581 3300037418 Bacteria 2335
270 Ga0395900_0236250 3300037418 Bacteria 1836
271 Ga0439448_0190983 3300042005 Unclassified 717
272 Ga0439458_0004183 3300042157 Bacteria 3333
273 Ga0453683_0108856 3300044673 Unclassified 1742
274 Ga0451576_1200081 3300045051 Unclassified 792
275 Ga0496104_0373822 3300048907 Unclassified 1338
276 Ga0496108_0290623 3300048911 Bacteria 1423
277 Ga0496110_0087766 3300048913 Bacteria 2778
278 Ga0496111_0320070 3300048914 Unclassified 1149
279 Ga0496112_0598314 3300048915 Bacteria 1035
280 Ga0501291_044844 3300049514 Unclassified 789
281 Ga0501297_026062 3300049520 Unclassified 756
282 Ga0501031_0527582 3300049568 Unclassified 761
283 Ga0501038_0023486 3300049574 Bacteria 5511
284 Ga0501039_1252847 3300049575 Unclassified 573
285 Ga0501040_0346335 3300049576 Unclassified 1064
286 Ga0501042_0787998 3300049578 Unclassified 692
287 Ga0501048_0445493 3300049582 Unclassified 927
288 Ga0501202_100263 3300049652 Bacteria 704
289 Ga0501217_330292 3300049661 Bacteria 509
290 Ga0501223_031816 3300049663 Unclassified 1026
291 Ga0501235_018347 3300049669 Bacteria 1552
292 Ga0501257_020345 3300049686 Bacteria 1558
293 Ga0501258_056852 3300049687 Unclassified 558
294 Ga0501259_110896 3300049688 Bacteria 641
295 Ga0501261_075837 3300049690 Unclassified 599
296 Ga0501221_032473 3300049704 Unclassified 1097
297 Ga0501225_0078271 3300049705 Unclassified 947
298 Ga0501079_0195245 3300049741 Unclassified 1580
299 nmdc:mga05p37_1383299_c1 3300050507 Unclassified 710
300 nmdc:mga05p37_253578_c1 3300050507 Bacteria 2109
301 nmdc:mga05p37_267027_c1 3300050507 Bacteria 2046
302 nmdc:mga05p37_863461_c1 3300050507 Bacteria 981
303 nmdc:mga05p37_990624_c1 3300050507 Bacteria 894
304 nmdc:mga09592_1557664_c1 3300050508 Bacteria 536
305 nmdc:mga09592_1659673_c1 3300050508 Unclassified 516
306 nmdc:mga09592_193092_c1 3300050508 Bacteria 1762
307 nmdc:mga09592_357764_c1 3300050508 Bacteria 1263
308 nmdc:mga09592_930527_c1 3300050508 Unclassified 729
309 nmdc:mga0qj67_344187_c1 3300050509 Unclassified 1206
310 nmdc:mga0qj67_6751_c1 3300050509 Bacteria 8435
311 nmdc:mga06r32_137712_c1 3300050510 Bacteria 2416
312 nmdc:mga06r32_1561455_c1 3300050510 Unclassified 599
313 nmdc:mga06r32_172925_c1 3300050510 Bacteria 2144
314 nmdc:mga06r32_507151_c1 3300050510 Bacteria 1183
315 nmdc:mga08y16_19166_c1 3300050511 Bacteria 7210
316 nmdc:mga08y16_43412_c1 3300050511 Unclassified 4711
317 nmdc:mga0n895_141481_c1 3300050512 Bacteria 2435
318 nmdc:mga0n895_1423092_c1 3300050512 Unclassified 661
319 nmdc:mga0n895_697322_c1 3300050512 Unclassified 1011
320 nmdc:mga0rr50_301426_c1 3300050513 Bacteria 1341
321 nmdc:mga0rr50_646700_c1 3300050513 Unclassified 902
322 nmdc:mga0a205_221266_c1 3300050515 Unclassified 1778
323 nmdc:mga0a205_28144_c1 3300050515 Bacteria 5372
324 nmdc:mga0a205_389683_c1 3300050515 Unclassified 1258
325 nmdc:mga0a205_53625_c1 3300050515 Bacteria 3892
326 nmdc:mga0a205_68981_c1 3300050515 Bacteria 3415
327 Ga0500616_0000897 3300053153 Bacteria 32667
328 Ga0587083_0088154 3300059505 Unclassified 752
329 Ga0587091_021316 3300059511 Bacteria 1134
330 Ga0587091_053156 3300059511 Unclassified 838
331 Ga0587072_065763 3300059643 Unclassified 756
332 Ga0587107_013040 3300059652 Bacteria 1047
333 Ga0501082_0821735 3300060353 Unclassified 813

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100213926 Ga0070708_1002139263 91
2 3300005518 Ga0070699_100175368 Ga0070699_1001753682 91
3 3300006871 Ga0075434_100015382 Ga0075434_1000153829 91
4 3300005293 Ga0065715_10093259 Ga0065715_100932591 95
5 3300005615 Ga0070702_100732292 Ga0070702_1007322921 95
6 3300009147 Ga0114129_10822207 Ga0114129_108222073 95
7 3300009148 Ga0105243_10339654 Ga0105243_103396542 95
8 3300013306 Ga0163162_11492177 Ga0163162_114921772 95
9 3300025929 Ga0207664_10615773 Ga0207664_106157732 95
10 3300050507 nmdc:mga05p37_863461_c1 nmdc:mga05p37_863461_c1_295_585 96
11 3300005367 Ga0070667_100749196 Ga0070667_1007491962 98
12 3300005564 Ga0070664_100535776 Ga0070664_1005357763 98
13 3300005616 Ga0068852_102076529 Ga0068852_1020765291 98
14 3300005842 Ga0068858_101771821 Ga0068858_1017718212 98
15 3300026142 Ga0207698_11743120 Ga0207698_117431202 98
16 3300031548 Ga0307408_100204194 Ga0307408_1002041943 98
17 3300031731 Ga0307405_10269566 Ga0307405_102695662 98
18 3300032002 Ga0307416_100250053 Ga0307416_1002500533 98
19 3300032004 Ga0307414_10482138 Ga0307414_104821382 98
20 3300032126 Ga0307415_100883886 Ga0307415_1008838861 98
21 3300048914 Ga0496111_0320070 Ga0496111_0320070_810_1106 98
22 3300005334 Ga0068869_100540549 Ga0068869_1005405492 101
23 3300005345 Ga0070692_10878778 Ga0070692_108787781 101
24 3300005364 Ga0070673_100139960 Ga0070673_1001399602 101
25 3300005444 Ga0070694_100182087 Ga0070694_1001820871 101
26 3300005467 Ga0070706_100829882 Ga0070706_1008298822 101
27 3300005530 Ga0070679_101214720 Ga0070679_1012147201 101
28 3300005546 Ga0070696_100231247 Ga0070696_1002312471 101
29 3300005549 Ga0070704_100659729 Ga0070704_1006597291 101
30 3300005577 Ga0068857_100948383 Ga0068857_1009483832 101
31 3300005615 Ga0070702_100100149 Ga0070702_1001001494 101
32 3300005617 Ga0068859_100043013 Ga0068859_1000430136 101
33 3300005618 Ga0068864_100050616 Ga0068864_1000506163 101
34 3300005618 Ga0068864_100834192 Ga0068864_1008341921 101
35 3300005841 Ga0068863_101126255 Ga0068863_1011262552 101
36 3300005841 Ga0068863_101421557 Ga0068863_1014215571 101
37 3300005843 Ga0068860_100587621 Ga0068860_1005876213 101
38 3300006058 Ga0075432_10063638 Ga0075432_100636382 101
39 3300006173 Ga0070716_100050800 Ga0070716_1000508003 101
40 3300006852 Ga0075433_10631770 Ga0075433_106317702 101
41 3300006852 Ga0075433_11417562 Ga0075433_114175621 101
42 3300006871 Ga0075434_100443683 Ga0075434_1004436832 101
43 3300006880 Ga0075429_100524553 Ga0075429_1005245533 101
44 3300006931 Ga0097620_100043012 Ga0097620_1000430126 101
45 3300007076 Ga0075435_100491753 Ga0075435_1004917532 101
46 3300009101 Ga0105247_10312357 Ga0105247_103123572 101
47 3300009148 Ga0105243_10255439 Ga0105243_102554392 101
48 3300009174 Ga0105241_10266042 Ga0105241_102660422 101
49 3300009174 Ga0105241_10401103 Ga0105241_104011032 101
50 3300009174 Ga0105241_11658862 Ga0105241_116588622 101
51 3300009177 Ga0105248_10582565 Ga0105248_105825651 101
52 3300009553 Ga0105249_10037982 Ga0105249_100379825 101
53 3300009553 Ga0105249_10910688 Ga0105249_109106881 101
54 3300010375 Ga0105239_11856163 Ga0105239_118561631 101
55 3300011119 Ga0105246_11270748 Ga0105246_112707481 101
56 3300011119 Ga0105246_12238265 Ga0105246_122382652 101
57 3300013100 Ga0157373_10445131 Ga0157373_104451312 101
58 3300013306 Ga0163162_11572787 Ga0163162_115727872 101
59 3300014325 Ga0163163_10602739 Ga0163163_106027392 101
60 3300014326 Ga0157380_10064983 Ga0157380_100649835 101
61 3300025911 Ga0207654_10749008 Ga0207654_107490082 101
62 3300025914 Ga0207671_10654867 Ga0207671_106548671 101
63 3300025921 Ga0207652_11342949 Ga0207652_113429491 101
64 3300025935 Ga0207709_10487026 Ga0207709_104870262 101
65 3300025939 Ga0207665_10046742 Ga0207665_100467425 101
66 3300025942 Ga0207689_10260187 Ga0207689_102601872 101
67 3300025949 Ga0207667_11232588 Ga0207667_112325881 101
68 3300025960 Ga0207651_10072289 Ga0207651_100722893 101
69 3300025960 Ga0207651_11471694 Ga0207651_114716941 101
70 3300025961 Ga0207712_10013261 Ga0207712_100132616 101
71 3300025981 Ga0207640_10113826 Ga0207640_101138261 101
72 3300026088 Ga0207641_10296288 Ga0207641_102962881 101
73 3300026089 Ga0207648_11737232 Ga0207648_117372321 101
74 3300026095 Ga0207676_10697074 Ga0207676_106970741 101
75 3300026095 Ga0207676_12179170 Ga0207676_121791701 101
76 3300026116 Ga0207674_10049583 Ga0207674_100495836 101
77 3300026118 Ga0207675_100327312 Ga0207675_1003273123 101
78 3300027907 Ga0207428_10878703 Ga0207428_108787031 101
79 3300035088 Ga0373940_0007898 Ga0373940_0007898_805_1110 101
80 3300035091 Ga0373951_0037777 Ga0373951_0037777_708_1013 101
81 3300037418 Ga0395900_0155581 Ga0395900_0155581_1524_1829 101
82 3300048907 Ga0496104_0373822 Ga0496104_0373822_319_624 101
83 3300049661 Ga0501217_330292 Ga0501217_330292_65_370 101
84 3300050508 nmdc:mga09592_357764_c1 nmdc:mga09592_357764_c1_885_1190 101
85 3300050509 nmdc:mga0qj67_344187_c1 nmdc:mga0qj67_344187_c1_210_515 101
86 3300050510 nmdc:mga06r32_507151_c1 nmdc:mga06r32_507151_c1_165_470 101
87 3300050512 nmdc:mga0n895_697322_c1 nmdc:mga0n895_697322_c1_301_606 101
88 3300050513 nmdc:mga0rr50_646700_c1 nmdc:mga0rr50_646700_c1_422_727 101
89 3300005293 Ga0065715_10012430 Ga0065715_100124305 105
90 3300006846 Ga0075430_100036512 Ga0075430_1000365123 105
91 3300006847 Ga0075431_100248584 Ga0075431_1002485841 105
92 3300006847 Ga0075431_100962748 Ga0075431_1009627481 105
93 3300006880 Ga0075429_100067436 Ga0075429_1000674366 105
94 3300009148 Ga0105243_10233966 Ga0105243_102339663 105
95 3300025935 Ga0207709_11527524 Ga0207709_115275242 105
96 3300026035 Ga0207703_10313492 Ga0207703_103134922 105
97 3300049568 Ga0501031_0527582 Ga0501031_0527582_231_548 105
98 3300049575 Ga0501039_1252847 Ga0501039_1252847_71_388 105
99 3300049576 Ga0501040_0346335 Ga0501040_0346335_592_909 105
100 3300049578 Ga0501042_0787998 Ga0501042_0787998_279_596 105
101 3300049741 Ga0501079_0195245 Ga0501079_0195245_1051_1368 105
102 3300050508 nmdc:mga09592_1557664_c1 nmdc:mga09592_1557664_c1_84_401 105
103 3300050508 nmdc:mga09592_193092_c1 nmdc:mga09592_193092_c1_858_1175 105
104 3300050509 nmdc:mga0qj67_6751_c1 nmdc:mga0qj67_6751_c1_4275_4592 105
105 3300050510 nmdc:mga06r32_137712_c1 nmdc:mga06r32_137712_c1_1956_2273 105
106 3300060353 Ga0501082_0821735 Ga0501082_0821735_300_617 105
107 3300026075 Ga0207708_10600361 Ga0207708_106003612 107
108 2162886007 SwRhRL2b_contig_967573 SwRhRL2b_0004.00002640 108
109 3300005289 Ga0065704_10002238 Ga0065704_100022389 108
110 3300005293 Ga0065715_10004674 Ga0065715_100046747 108
111 3300005295 Ga0065707_10090524 Ga0065707_100905247 108
112 3300005331 Ga0070670_100333213 Ga0070670_1003332132 108
113 3300005331 Ga0070670_100890855 Ga0070670_1008908551 108
114 3300005334 Ga0068869_100098173 Ga0068869_1000981732 108
115 3300005337 Ga0070682_100003672 Ga0070682_1000036729 108
116 3300005340 Ga0070689_100000044 Ga0070689_10000004413 108
117 3300005345 Ga0070692_10015599 Ga0070692_100155994 108
118 3300005345 Ga0070692_10022395 Ga0070692_100223954 108
119 3300005345 Ga0070692_10024124 Ga0070692_100241243 108
120 3300005355 Ga0070671_100009571 Ga0070671_1000095713 108
121 3300005440 Ga0070705_100027544 Ga0070705_1000275444 108
122 3300005440 Ga0070705_100342432 Ga0070705_1003424322 108
123 3300005441 Ga0070700_100050152 Ga0070700_1000501522 108
124 3300005444 Ga0070694_100056781 Ga0070694_1000567814 108
125 3300005444 Ga0070694_100355373 Ga0070694_1003553732 108
126 3300005445 Ga0070708_100123090 Ga0070708_1001230902 108
127 3300005445 Ga0070708_100311683 Ga0070708_1003116831 108
128 3300005458 Ga0070681_10001188 Ga0070681_1000118821 108
129 3300005459 Ga0068867_100192410 Ga0068867_1001924103 108
130 3300005467 Ga0070706_100099568 Ga0070706_1000995683 108
131 3300005471 Ga0070698_100000157 Ga0070698_10000015734 108
132 3300005471 Ga0070698_100082132 Ga0070698_1000821326 108
133 3300005471 Ga0070698_100182228 Ga0070698_1001822282 108
134 3300005518 Ga0070699_100018829 Ga0070699_1000188295 108
135 3300005530 Ga0070679_100262202 Ga0070679_1002622022 108
136 3300005536 Ga0070697_100000715 Ga0070697_1000007155 108
137 3300005536 Ga0070697_100004826 Ga0070697_1000048262 108
138 3300005543 Ga0070672_100239334 Ga0070672_1002393342 108
139 3300005545 Ga0070695_100035208 Ga0070695_1000352084 108
140 3300005545 Ga0070695_100161167 Ga0070695_1001611673 108
141 3300005545 Ga0070695_100217588 Ga0070695_1002175881 108
142 3300005546 Ga0070696_100049558 Ga0070696_1000495582 108
143 3300005546 Ga0070696_100149888 Ga0070696_1001498882 108
144 3300005546 Ga0070696_100667189 Ga0070696_1006671892 108
145 3300005546 Ga0070696_100717892 Ga0070696_1007178922 108
146 3300005547 Ga0070693_101119016 Ga0070693_1011190162 108
147 3300005549 Ga0070704_100349197 Ga0070704_1003491971 108
148 3300005549 Ga0070704_101251411 Ga0070704_1012514111 108
149 3300005549 Ga0070704_101459066 Ga0070704_1014590662 108
150 3300005577 Ga0068857_100032538 Ga0068857_1000325381 108
151 3300005577 Ga0068857_100103535 Ga0068857_1001035352 108
152 3300005577 Ga0068857_101378123 Ga0068857_1013781231 108
153 3300005577 Ga0068857_101864329 Ga0068857_1018643291 108
154 3300005578 Ga0068854_101093292 Ga0068854_1010932922 108
155 3300005614 Ga0068856_100148785 Ga0068856_1001487852 108
156 3300005615 Ga0070702_100010214 Ga0070702_1000102141 108
157 3300005615 Ga0070702_101159142 Ga0070702_1011591421 108
158 3300005616 Ga0068852_100147652 Ga0068852_1001476524 108
159 3300005616 Ga0068852_102690587 Ga0068852_1026905871 108
160 3300005617 Ga0068859_100036887 Ga0068859_1000368875 108
161 3300005617 Ga0068859_100113264 Ga0068859_1001132642 108
162 3300005617 Ga0068859_100125570 Ga0068859_1001255702 108
163 3300005618 Ga0068864_100194808 Ga0068864_1001948082 108
164 3300005618 Ga0068864_100396682 Ga0068864_1003966823 108
165 3300005840 Ga0068870_10013706 Ga0068870_100137063 108
166 3300005840 Ga0068870_10155010 Ga0068870_101550101 108
167 3300005841 Ga0068863_100008575 Ga0068863_1000085755 108
168 3300005841 Ga0068863_100056908 Ga0068863_1000569083 108
169 3300005841 Ga0068863_101274770 Ga0068863_1012747702 108
170 3300005842 Ga0068858_100427862 Ga0068858_1004278623 108
171 3300005843 Ga0068860_100008952 Ga0068860_1000089522 108
172 3300005843 Ga0068860_100086297 Ga0068860_1000862972 108
173 3300005843 Ga0068860_100540543 Ga0068860_1005405431 108
174 3300005843 Ga0068860_101664978 Ga0068860_1016649782 108
175 3300005844 Ga0068862_100077990 Ga0068862_1000779902 108
176 3300005985 Ga0081539_10000631 Ga0081539_1000063156 108
177 3300006173 Ga0070716_100132002 Ga0070716_1001320023 108
178 3300006237 Ga0097621_100009441 Ga0097621_1000094414 108
179 3300006237 Ga0097621_100356055 Ga0097621_1003560553 108
180 3300006846 Ga0075430_100729334 Ga0075430_1007293342 108
181 3300006852 Ga0075433_10043768 Ga0075433_100437682 108
182 3300006852 Ga0075433_10324831 Ga0075433_103248313 108
183 3300006871 Ga0075434_100875822 Ga0075434_1008758222 108
184 3300006871 Ga0075434_100886106 Ga0075434_1008861061 108
185 3300006880 Ga0075429_100019970 Ga0075429_1000199708 108
186 3300006880 Ga0075429_100480257 Ga0075429_1004802572 108
187 3300006931 Ga0097620_100036888 Ga0097620_1000368885 108
188 3300006931 Ga0097620_100113267 Ga0097620_1001132672 108
189 3300006931 Ga0097620_100125565 Ga0097620_1001255654 108
190 3300007265 Ga0099794_10266716 Ga0099794_102667162 108
191 3300009011 Ga0105251_10144702 Ga0105251_101447022 108
192 3300009093 Ga0105240_10078772 Ga0105240_100787724 108
193 3300009094 Ga0111539_10021514 Ga0111539_100215143 108
194 3300009101 Ga0105247_10202701 Ga0105247_102027012 108
195 3300009101 Ga0105247_10685115 Ga0105247_106851152 108
196 3300009147 Ga0114129_10019631 Ga0114129_100196317 108
197 3300009147 Ga0114129_10157711 Ga0114129_101577113 108
198 3300009147 Ga0114129_10204705 Ga0114129_102047055 108
199 3300009147 Ga0114129_10212972 Ga0114129_102129722 108
200 3300009147 Ga0114129_12269658 Ga0114129_122696581 108
201 3300009147 Ga0114129_12470847 Ga0114129_124708471 108
202 3300009148 Ga0105243_10002037 Ga0105243_100020376 108
203 3300009148 Ga0105243_10177770 Ga0105243_101777704 108
204 3300009174 Ga0105241_10026486 Ga0105241_100264863 108
205 3300009174 Ga0105241_10232188 Ga0105241_102321883 108
206 3300009174 Ga0105241_10352030 Ga0105241_103520302 108
207 3300009174 Ga0105241_10584416 Ga0105241_105844162 108
208 3300009174 Ga0105241_10601804 Ga0105241_106018042 108
209 3300009174 Ga0105241_11112667 Ga0105241_111126672 108
210 3300009174 Ga0105241_11680820 Ga0105241_116808201 108
211 3300009176 Ga0105242_12713070 Ga0105242_127130701 108
212 3300009177 Ga0105248_10394872 Ga0105248_103948723 108
213 3300009177 Ga0105248_13357415 Ga0105248_133574151 108
214 3300009545 Ga0105237_10226644 Ga0105237_102266442 108
215 3300009551 Ga0105238_10046989 Ga0105238_100469894 108
216 3300010375 Ga0105239_10707470 Ga0105239_107074701 108
217 3300011119 Ga0105246_10073205 Ga0105246_100732051 108
218 3300011119 Ga0105246_10532140 Ga0105246_105321402 108
219 3300011119 Ga0105246_10641796 Ga0105246_106417962 108
220 3300013100 Ga0157373_10019089 Ga0157373_100190892 108
221 3300013100 Ga0157373_10041966 Ga0157373_100419666 108
222 3300013100 Ga0157373_10046354 Ga0157373_100463545 108
223 3300013100 Ga0157373_10150885 Ga0157373_101508853 108
224 3300013102 Ga0157371_10362182 Ga0157371_103621823 108
225 3300013307 Ga0157372_10603763 Ga0157372_106037632 108
226 3300013307 Ga0157372_11967760 Ga0157372_119677602 108
227 3300013307 Ga0157372_13474855 Ga0157372_134748552 108
228 3300013308 Ga0157375_11368242 Ga0157375_113682422 108
229 3300014325 Ga0163163_10549872 Ga0163163_105498721 108
230 3300014325 Ga0163163_10723146 Ga0163163_107231462 108
231 3300014326 Ga0157380_10946497 Ga0157380_109464972 108
232 3300014969 Ga0157376_10952984 Ga0157376_109529842 108
233 3300015262 Ga0182007_10068279 Ga0182007_100682792 108
234 3300025900 Ga0207710_10278948 Ga0207710_102789482 108
235 3300025900 Ga0207710_10538421 Ga0207710_105384211 108
236 3300025904 Ga0207647_10000659 Ga0207647_1000065918 108
237 3300025907 Ga0207645_10736522 Ga0207645_107365221 108
238 3300025908 Ga0207643_10023332 Ga0207643_100233327 108
239 3300025908 Ga0207643_10048386 Ga0207643_100483864 108
240 3300025908 Ga0207643_10609910 Ga0207643_106099102 108
241 3300025911 Ga0207654_10464234 Ga0207654_104642342 108
242 3300025912 Ga0207707_10007101 Ga0207707_100071016 108
243 3300025913 Ga0207695_10211870 Ga0207695_102118703 108
244 3300025921 Ga0207652_10211784 Ga0207652_102117843 108
245 3300025922 Ga0207646_11002734 Ga0207646_110027342 108
246 3300025924 Ga0207694_10042707 Ga0207694_100427074 108
247 3300025925 Ga0207650_10164730 Ga0207650_101647303 108
248 3300025925 Ga0207650_10214997 Ga0207650_102149973 108
249 3300025925 Ga0207650_10736294 Ga0207650_107362941 108
250 3300025931 Ga0207644_10009622 Ga0207644_100096223 108
251 3300025935 Ga0207709_10003731 Ga0207709_1000373110 108
252 3300025936 Ga0207670_10498612 Ga0207670_104986122 108
253 3300025939 Ga0207665_10527294 Ga0207665_105272942 108
254 3300025941 Ga0207711_10027100 Ga0207711_100271005 108
255 3300025942 Ga0207689_10113321 Ga0207689_101133212 108
256 3300025942 Ga0207689_10189213 Ga0207689_101892132 108
257 3300025942 Ga0207689_11498210 Ga0207689_114982102 108
258 3300025945 Ga0207679_10561288 Ga0207679_105612882 108
259 3300025960 Ga0207651_10278220 Ga0207651_102782202 108
260 3300026035 Ga0207703_10043940 Ga0207703_100439402 108
261 3300026035 Ga0207703_10513791 Ga0207703_105137911 108
262 3300026041 Ga0207639_10052289 Ga0207639_100522895 108
263 3300026075 Ga0207708_10023008 Ga0207708_100230085 108
264 3300026075 Ga0207708_10030760 Ga0207708_100307604 108
265 3300026075 Ga0207708_11514252 Ga0207708_115142521 108
266 3300026078 Ga0207702_10107400 Ga0207702_101074002 108
267 3300026088 Ga0207641_10029580 Ga0207641_100295808 108
268 3300026089 Ga0207648_10405149 Ga0207648_104051491 108
269 3300026095 Ga0207676_11494642 Ga0207676_114946422 108
270 3300026095 Ga0207676_11873996 Ga0207676_118739962 108
271 3300026095 Ga0207676_12144330 Ga0207676_121443301 108
272 3300026095 Ga0207676_12341257 Ga0207676_123412571 108
273 3300026116 Ga0207674_10021115 Ga0207674_100211158 108
274 3300026116 Ga0207674_10655511 Ga0207674_106555112 108
275 3300026116 Ga0207674_11690765 Ga0207674_116907651 108
276 3300026121 Ga0207683_11863608 Ga0207683_118636082 108
277 3300027907 Ga0207428_10031098 Ga0207428_100310982 108
278 3300027907 Ga0207428_10153633 Ga0207428_101536331 108
279 3300028380 Ga0268265_10074127 Ga0268265_100741272 108
280 3300028381 Ga0268264_10582702 Ga0268264_105827022 108
281 3300028381 Ga0268264_10671129 Ga0268264_106711291 108
282 3300031548 Ga0307408_100053612 Ga0307408_1000536123 108
283 3300031548 Ga0307408_100489393 Ga0307408_1004893932 108
284 3300031731 Ga0307405_10117080 Ga0307405_101170802 108
285 3300032002 Ga0307416_100048933 Ga0307416_1000489332 108
286 3300032005 Ga0307411_10273531 Ga0307411_102735313 108
287 3300034818 Ga0373950_0078014 Ga0373950_0078014_133_459 108
288 3300035115 Ga0373941_0324944 Ga0373941_0324944_210_536 108
289 3300037418 Ga0395900_0236250 Ga0395900_0236250_752_1078 108
290 3300042005 Ga0439448_0190983 Ga0439448_0190983_95_421 108
291 3300042157 Ga0439458_0004183 Ga0439458_0004183_533_859 108
292 3300044673 Ga0453683_0108856 Ga0453683_0108856_536_862 108
293 3300045051 Ga0451576_1200081 Ga0451576_1200081_108_434 108
294 3300048911 Ga0496108_0290623 Ga0496108_0290623_661_990 108
295 3300048913 Ga0496110_0087766 Ga0496110_0087766_20_346 108
296 3300048915 Ga0496112_0598314 Ga0496112_0598314_158_484 108
297 3300049514 Ga0501291_044844 Ga0501291_044844_363_689 108
298 3300049520 Ga0501297_026062 Ga0501297_026062_100_426 108
299 3300049574 Ga0501038_0023486 Ga0501038_0023486_4289_4615 108
300 3300049582 Ga0501048_0445493 Ga0501048_0445493_259_585 108
301 3300049652 Ga0501202_100263 Ga0501202_100263_195_521 108
302 3300049663 Ga0501223_031816 Ga0501223_031816_195_521 108
303 3300049669 Ga0501235_018347 Ga0501235_018347_781_1107 108
304 3300049686 Ga0501257_020345 Ga0501257_020345_506_832 108
305 3300049687 Ga0501258_056852 Ga0501258_056852_179_505 108
306 3300049688 Ga0501259_110896 Ga0501259_110896_173_499 108
307 3300049690 Ga0501261_075837 Ga0501261_075837_160_486 108
308 3300049704 Ga0501221_032473 Ga0501221_032473_67_393 108
309 3300049705 Ga0501225_0078271 Ga0501225_0078271_400_726 108
310 3300050507 nmdc:mga05p37_1383299_c1 nmdc:mga05p37_1383299_c1_362_688 108
311 3300050507 nmdc:mga05p37_253578_c1 nmdc:mga05p37_253578_c1_333_659 108
312 3300050507 nmdc:mga05p37_267027_c1 nmdc:mga05p37_267027_c1_271_597 108
313 3300050507 nmdc:mga05p37_990624_c1 nmdc:mga05p37_990624_c1_384_710 108
314 3300050508 nmdc:mga09592_1659673_c1 nmdc:mga09592_1659673_c1_61_387 108
315 3300050508 nmdc:mga09592_930527_c1 nmdc:mga09592_930527_c1_273_599 108
316 3300050510 nmdc:mga06r32_1561455_c1 nmdc:mga06r32_1561455_c1_39_365 108
317 3300050510 nmdc:mga06r32_172925_c1 nmdc:mga06r32_172925_c1_784_1110 108
318 3300050511 nmdc:mga08y16_19166_c1 nmdc:mga08y16_19166_c1_3114_3440 108
319 3300050511 nmdc:mga08y16_43412_c1 nmdc:mga08y16_43412_c1_3712_4038 108
320 3300050512 nmdc:mga0n895_141481_c1 nmdc:mga0n895_141481_c1_814_1140 108
321 3300050512 nmdc:mga0n895_1423092_c1 nmdc:mga0n895_1423092_c1_287_613 108
322 3300050513 nmdc:mga0rr50_301426_c1 nmdc:mga0rr50_301426_c1_205_531 108
323 3300050515 nmdc:mga0a205_221266_c1 nmdc:mga0a205_221266_c1_735_1061 108
324 3300050515 nmdc:mga0a205_28144_c1 nmdc:mga0a205_28144_c1_4922_5248 108
325 3300050515 nmdc:mga0a205_389683_c1 nmdc:mga0a205_389683_c1_921_1247 108
326 3300050515 nmdc:mga0a205_53625_c1 nmdc:mga0a205_53625_c1_2794_3120 108
327 3300050515 nmdc:mga0a205_68981_c1 nmdc:mga0a205_68981_c1_162_488 108
328 3300053153 Ga0500616_0000897 Ga0500616_0000897_12982_13311 108
329 3300059505 Ga0587083_0088154 Ga0587083_0088154_84_410 108
330 3300059511 Ga0587091_021316 Ga0587091_021316_646_975 108
331 3300059511 Ga0587091_053156 Ga0587091_053156_104_430 108
332 3300059643 Ga0587072_065763 Ga0587072_065763_49_378 108
333 3300059652 Ga0587107_013040 Ga0587107_013040_82_411 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

90

0.98

PF08534

Redoxin

Redoxin

1

108

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8785 4 107
2pwj-assembly2.cif.gz_B structure of a mitochondrial type ii peroxiredoxin from pisum sativum 0.8585 3 103
2wfc-assembly1.cif.gz_D crystal structure of peroxiredoxin 5 from arenicola marina 0.8451 3 103
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8417 4 107
5k2j-assembly4.cif.gz_H crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.8415 3 103
ID Description Score Start End Superfamily
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9087 9 56 3.40.30.10
af_Q9ZUU2_69_247_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9086 2 57 3.40.30.10
af_A0A0R4J5B9_27_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8615 3 102 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8543 3 103 3.40.30.10
af_A0A2R8QV36_125_297_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.854 2 106 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V9HH60-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.989 1 56 GO:0016209
GO:0016491
AF-A0A7C7C715-F1-model_v4 deleted 0.9489 5 55
AF-A0A537Z0U6-F1-model_v4 Redoxin domain-containing protein 0.9367 1 84 GO:0016209
GO:0016491
AF-A0A817N411-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.9364 4 55 GO:0016209
GO:0016491
AF-A0A2E1A0N9-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.9353 4 60 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
84 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map