F411149

General Info

Members Datasets Scaffolds Average Seq Length
332 198 664 99

Family's Representative Sequence

Representative Sequence 3300059426|Ga0590077_025011|Ga0590077_025011_904_1221
Length 105
Sequence MGSRSLMARKRKYSEESFGATIERLMGETGLTYRGLAAKTNLSAGYLNHLVHGNRPVPSKEVVERLAAALGVEPEHFREYRLRVIADRLEEMPDLVDRLYKRLAV

Samples

Sample ID Description Type Environment
1 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
107 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
108 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
178 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.02
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590077_025011 3300059426 Bacteria 1284
2 Ga0070658_10429040 3300005327 Bacteria 1137
3 Ga0070683_100569029 3300005329 Bacteria 1084
4 Ga0070677_10560991 3300005333 Bacteria 627
5 Ga0068868_100444914 3300005338 Bacteria 1126
6 Ga0070675_100035273 3300005354 Bacteria 4064
7 Ga0070674_100045419 3300005356 Bacteria 3002
8 Ga0070673_101041965 3300005364 Unclassified 763
9 Ga0070659_100940207 3300005366 Bacteria 757
10 Ga0070709_10006300 3300005434 Bacteria 6462
11 Ga0070714_100019562 3300005435 Bacteria 5519
12 Ga0070714_101492897 3300005435 Bacteria 660
13 Ga0070710_10788832 3300005437 Bacteria 678
14 Ga0070711_100898181 3300005439 Bacteria 756
15 Ga0070711_101208913 3300005439 Bacteria 654
16 Ga0070678_100323729 3300005456 Bacteria 1317
17 Ga0070678_100435845 3300005456 Bacteria 1145
18 Ga0070681_10265003 3300005458 Bacteria 1630
19 Ga0070681_10646272 3300005458 Bacteria 973
20 Ga0068867_100554587 3300005459 Bacteria 996
21 Ga0070707_100014204 3300005468 Bacteria 7464
22 Ga0070698_100028635 3300005471 Bacteria 5784
23 Ga0070698_101986828 3300005471 Bacteria 535
24 Ga0070699_100069215 3300005518 Bacteria 3067
25 Ga0070699_101770833 3300005518 Bacteria 565
26 Ga0070684_100311257 3300005535 Bacteria 1446
27 Ga0070672_100117177 3300005543 Bacteria 2177
28 Ga0070672_101038979 3300005543 Unclassified 727
29 Ga0070696_100699966 3300005546 Bacteria 826
30 Ga0070665_100997814 3300005548 Bacteria 849
31 Ga0068855_100328066 3300005563 Bacteria 1690
32 Ga0070664_100794474 3300005564 Bacteria 885
33 Ga0068856_100635720 3300005614 Bacteria 1088
34 Ga0068856_102668184 3300005614 Unclassified 505
35 Ga0068870_11063191 3300005840 Bacteria 580
36 Ga0081538_10169437 3300005981 Bacteria 955
37 Ga0070717_10344724 3300006028 Bacteria 1331
38 Ga0070716_100005679 3300006173 Bacteria 6054
39 Ga0070712_101612405 3300006175 Bacteria 568
40 Ga0075428_100831756 3300006844 Bacteria 981
41 Ga0075433_10021732 3300006852 Bacteria 5382
42 Ga0075434_100019205 3300006871 Bacteria 6612
43 Ga0075434_101833838 3300006871 Unclassified 613
44 Ga0075429_101693644 3300006880 Unclassified 549
45 Ga0068865_100186928 3300006881 Unclassified 1599
46 Ga0075435_100003535 3300007076 Bacteria 10608
47 Ga0075435_100571038 3300007076 Bacteria 980
48 Ga0111539_10136532 3300009094 Bacteria 2872
49 Ga0111539_10492701 3300009094 Bacteria 1427
50 Ga0105245_10878405 3300009098 Bacteria 937
51 Ga0114129_10510720 3300009147 Bacteria 1568
52 Ga0105243_10218666 3300009148 Bacteria 1682
53 Ga0105243_12761574 3300009148 Bacteria 531
54 Ga0105248_12799225 3300009177 Unclassified 556
55 Ga0105249_11513936 3300009553 Bacteria 743
56 Ga0157373_10204230 3300013100 Bacteria 1393
57 Ga0163163_10267561 3300014325 Bacteria 1760
58 Ga0163163_12742278 3300014325 Bacteria 549
59 Ga0157377_10049800 3300014745 Bacteria 2356
60 Ga0157377_10191012 3300014745 Bacteria 1294
61 Ga0206352_11146519 3300020078 Bacteria 719
62 Ga0207682_10360595 3300025893 Bacteria 685
63 Ga0207688_10387750 3300025901 Bacteria 865
64 Ga0207699_10035920 3300025906 Bacteria 2822
65 Ga0207705_10327033 3300025909 Bacteria 1179
66 Ga0207684_10569178 3300025910 Bacteria 969
67 Ga0207707_10271499 3300025912 Bacteria 1470
68 Ga0207707_10531659 3300025912 Bacteria 1000
69 Ga0207707_11028292 3300025912 Bacteria 675
70 Ga0207693_10116752 3300025915 Bacteria 2095
71 Ga0207693_10869868 3300025915 Bacteria 692
72 Ga0207663_11022780 3300025916 Bacteria 663
73 Ga0207660_11037820 3300025917 Bacteria 668
74 Ga0207657_10133674 3300025919 Bacteria 2031
75 Ga0207646_11032902 3300025922 Unclassified 725
76 Ga0207659_10432085 3300025926 Bacteria 1106
77 Ga0207700_10000006 3300025928 Bacteria 348187
78 Ga0207664_10085090 3300025929 Bacteria 2580
79 Ga0207644_10492322 3300025931 Bacteria 1011
80 Ga0207690_10700366 3300025932 Bacteria 833
81 Ga0207709_10399052 3300025935 Bacteria 1051
82 Ga0207669_10029525 3300025937 Bacteria 3034
83 Ga0207704_10822144 3300025938 Bacteria 777
84 Ga0207665_10024623 3300025939 Bacteria 3970
85 Ga0207661_11142114 3300025944 Bacteria 717
86 Ga0207661_11700197 3300025944 Bacteria 576
87 Ga0207679_10681575 3300025945 Bacteria 932
88 Ga0207667_10835854 3300025949 Unclassified 916
89 Ga0207677_10424031 3300026023 Bacteria 1134
90 Ga0207708_10101829 3300026075 Bacteria 2223
91 Ga0207648_10370895 3300026089 Bacteria 1293
92 Ga0207674_11185313 3300026116 Bacteria 733
93 Ga0207675_101027289 3300026118 Bacteria 843
94 Ga0207683_10146717 3300026121 Bacteria 2128
95 Ga0207683_10555390 3300026121 Bacteria 1062
96 Ga0268266_11028401 3300028379 Bacteria 797
97 Ga0265338_10332214 3300028800 Bacteria 1097
98 Ga0265339_10550117 3300031249 Bacteria 531
99 Ga0307408_100268795 3300031548 Bacteria 1415
100 Ga0307408_100673114 3300031548 Unclassified 927
101 Ga0307405_11200365 3300031731 Unclassified 656
102 Ga0307410_10389705 3300031852 Unclassified 1123
103 Ga0307407_10660723 3300031903 Unclassified 784
104 Ga0307407_11088954 3300031903 Unclassified 621
105 Ga0307412_11081228 3300031911 Unclassified 713
106 Ga0307409_100024452 3300031995 Bacteria 4213
107 Ga0307409_100434954 3300031995 Bacteria 1262
108 Ga0307409_100459325 3300031995 Bacteria 1231
109 Ga0307409_100514774 3300031995 Bacteria 1168
110 Ga0307409_100772724 3300031995 Bacteria 966
111 Ga0307409_100866782 3300031995 Bacteria 915
112 Ga0307416_100053186 3300032002 Bacteria 3247
113 Ga0307416_100247665 3300032002 Bacteria 1732
114 Ga0307416_100361472 3300032002 Bacteria 1474
115 Ga0307416_100670278 3300032002 Unclassified 1124
116 Ga0307416_100854879 3300032002 Bacteria 1008
117 Ga0307416_101842020 3300032002 Bacteria 709
118 Ga0307416_102073829 3300032002 Bacteria 671
119 Ga0307415_100458392 3300032126 Unclassified 1104
120 Ga0395899_0054097 3300037312 Bacteria 2971
121 Ga0395899_0105932 3300037312 Bacteria 2025
122 Ga0395900_0002418 3300037418 Bacteria 20595
123 Ga0395900_0164159 3300037418 Bacteria 2264
124 Ga0395900_0359513 3300037418 Bacteria 1428
125 Ga0395900_1707537 3300037418 Unclassified 540
126 Ga0395898_0083529 3300037466 Bacteria 3078
127 Ga0395898_1308620 3300037466 Bacteria 654
128 Ga0395905_0081786 3300037471 Bacteria 3027
129 Ga0395905_0099684 3300037471 Bacteria 2728
130 Ga0395901_0015258 3300038443 Bacteria 7816
131 Ga0395901_0261766 3300038443 Bacteria 1800
132 Ga0395901_1569760 3300038443 Bacteria 612
133 Ga0439439_0060083 3300041406 Bacteria 1008
134 Ga0439453_0175329 3300041408 Bacteria 521
135 Ga0439461_0002612 3300041410 Bacteria 2900
136 Ga0439461_0049918 3300041410 Unclassified 925
137 Ga0439466_0036795 3300041411 Bacteria 1651
138 Ga0439465_0283867 3300041413 Bacteria 617
139 Ga0439431_0007622 3300041997 Bacteria 2417
140 Ga0439431_0065501 3300041997 Bacteria 962
141 Ga0439433_0000148 3300041999 Bacteria 10791
142 Ga0439442_004457 3300042002 Bacteria 2780
143 Ga0439449_0036932 3300042007 Bacteria 1817
144 Ga0439452_098746 3300042010 Unclassified 628
145 Ga0439454_035575 3300042011 Bacteria 798
146 Ga0439457_037800 3300042014 Bacteria 1075
147 Ga0439462_0175898 3300042015 Archaea 606
148 Ga0450911_047260 3300042115 Bacteria 559
149 Ga0450920_075831 3300042122 Bacteria 686
150 Ga0450907_088989 3300042146 Bacteria 537
151 Ga0439446_0002507 3300042156 Bacteria 4415
152 Ga0439446_0003702 3300042156 Bacteria 3818
153 Ga0439446_0004318 3300042156 Bacteria 3599
154 Ga0439446_0048370 3300042156 Bacteria 1266
155 Ga0439434_0005572 3300042435 Bacteria 3678
156 Ga0439434_0007397 3300042435 Bacteria 3219
157 Ga0439434_0014021 3300042435 Bacteria 2383
158 Ga0439434_0289720 3300042435 Unclassified 565
159 Ga0450918_024847 3300042531 Bacteria 1048
160 Ga0466963_0469374 3300044694 Bacteria 888
161 Ga0466964_0252827 3300044706 Bacteria 870
162 Ga0466957_0579382 3300044842 Bacteria 784
163 Ga0466960_0986418 3300044901 Unclassified 517
164 Ga0466967_0423744 3300045976 Bacteria 1297
165 Ga0466967_1485601 3300045976 Bacteria 675
166 Ga0495585_0164255 3300046492 Bacteria 1151
167 Ga0495585_0533655 3300046492 Unclassified 555
168 Ga0495585_0630724 3300046492 Unclassified 503
169 Ga0495607_0277948 3300046501 Unclassified 796
170 Ga0495616_0455929 3300046513 Unclassified 517
171 Ga0495631_0070950 3300046518 Bacteria 1506
172 Ga0495644_0095202 3300046523 Bacteria 1125
173 Ga0495644_0178612 3300046523 Bacteria 816
174 Ga0495663_0146120 3300046525 Bacteria 805
175 Ga0495654_0259636 3300046530 Bacteria 721
176 Ga0495609_0269699 3300046538 Unclassified 698
177 Ga0495609_0368555 3300046538 Unclassified 578
178 Ga0495633_0184493 3300046558 Bacteria 960
179 Ga0495667_0158939 3300046559 Bacteria 1454
180 Ga0495656_0127085 3300046615 Bacteria 1210
181 Ga0495656_0692015 3300046615 Unclassified 548
182 Ga0495668_0167440 3300046616 Bacteria 1204
183 Ga0495611_0552108 3300046648 Bacteria 522
184 Ga0495661_0256643 3300046665 Bacteria 890
185 Ga0495661_0436339 3300046665 Unclassified 632
186 Ga0495661_0481715 3300046665 Unclassified 594
187 Ga0495599_0209483 3300046678 Bacteria 1196
188 Ga0495647_0148137 3300046681 Bacteria 1005
189 Ga0495670_0404926 3300046691 Bacteria 737
190 Ga0495589_0209723 3300046794 Unclassified 917
191 Ga0495581_0577243 3300047315 Unclassified 652
192 Ga0495674_0657410 3300047319 Bacteria 826
193 Ga0495676_0650771 3300047321 Bacteria 684
194 Ga0495680_0370382 3300047322 Bacteria 994
195 Ga0495683_0420412 3300047323 Unclassified 553
196 Ga0496101_0518227 3300048904 Bacteria 942
197 Ga0496101_0579288 3300048904 Bacteria 887
198 Ga0496101_1426712 3300048904 Unclassified 540
199 Ga0496102_1652476 3300048905 Bacteria 559
200 Ga0496104_0108714 3300048907 Bacteria 2658
201 Ga0496104_1241033 3300048907 Unclassified 649
202 Ga0496105_0478357 3300048908 Bacteria 980
203 Ga0496105_1396200 3300048908 Bacteria 507
204 Ga0496108_0092147 3300048911 Bacteria 2576
205 Ga0496109_0028581 3300048912 Bacteria 4988
206 Ga0496109_1798073 3300048912 Bacteria 546
207 Ga0496110_0019338 3300048913 Bacteria 5729
208 Ga0496110_0027606 3300048913 Bacteria 4867
209 Ga0496111_0024092 3300048914 Bacteria 4281
210 Ga0496111_0131994 3300048914 Bacteria 1848
211 Ga0496112_0055106 3300048915 Bacteria 3908
212 Ga0496112_0610985 3300048915 Viruses 1022
213 Ga0496113_0443955 3300048916 Viruses 1042
214 Ga0496114_0355893 3300048917 Bacteria 1295
215 Ga0496115_0288901 3300048918 Bacteria 1345
216 Ga0501298_024488 3300049521 Bacteria 1151
217 Ga0501031_0004826 3300049568 Bacteria 8760
218 Ga0501031_0017743 3300049568 Bacteria 4628
219 Ga0501031_0817778 3300049568 Bacteria 597
220 Ga0501032_0152112 3300049569 Bacteria 1521
221 Ga0501032_0183791 3300049569 Bacteria 1368
222 Ga0501033_0513616 3300049570 Unclassified 828
223 Ga0501034_1129180 3300049571 Viruses 664
224 Ga0501036_0003780 3300049572 Bacteria 12135
225 Ga0501036_0042456 3300049572 Bacteria 3850
226 Ga0501036_0370894 3300049572 Bacteria 1195
227 Ga0501036_0958295 3300049572 Unclassified 701
228 Ga0501036_1083122 3300049572 Bacteria 655
229 Ga0501037_0075142 3300049573 Bacteria 2455
230 Ga0501038_0010062 3300049574 Bacteria 8661
231 Ga0501038_0909019 3300049574 Bacteria 649
232 Ga0501039_0002342 3300049575 Bacteria 14088
233 Ga0501039_0018759 3300049575 Bacteria 5309
234 Ga0501039_0192831 3300049575 Bacteria 1602
235 Ga0501040_0001441 3300049576 Bacteria 15069
236 Ga0501040_0006022 3300049576 Bacteria 7848
237 Ga0501040_0057428 3300049576 Bacteria 2672
238 Ga0501040_1156285 3300049576 Bacteria 561
239 Ga0501041_0004054 3300049577 Bacteria 8460
240 Ga0501041_0020827 3300049577 Bacteria 3924
241 Ga0501041_0116531 3300049577 Bacteria 1659
242 Ga0501042_0005756 3300049578 Bacteria 8007
243 Ga0501042_0013685 3300049578 Bacteria 5525
244 Ga0501042_0565998 3300049578 Bacteria 826
245 Ga0501043_0055299 3300049579 Bacteria 3118
246 Ga0501043_1022713 3300049579 Bacteria 587
247 Ga0501046_0015792 3300049580 Bacteria 6335
248 Ga0501046_0087156 3300049580 Bacteria 2406
249 Ga0501048_0003112 3300049582 Bacteria 12666
250 Ga0501048_0004940 3300049582 Bacteria 10171
251 Ga0501048_0443630 3300049582 Bacteria 929
252 Ga0501048_0549116 3300049582 Bacteria 829
253 Ga0501068_0041154 3300049584 Bacteria 2776
254 Ga0501069_0020296 3300049585 Bacteria 3600
255 Ga0501069_0256329 3300049585 Bacteria 1021
256 Ga0501070_0168688 3300049586 Bacteria 1803
257 Ga0501070_0645291 3300049586 Bacteria 841
258 Ga0501071_0001749 3300049587 Bacteria 12795
259 Ga0501071_0079042 3300049587 Bacteria 2404
260 Ga0501071_0190937 3300049587 Bacteria 1536
261 Ga0501071_0768468 3300049587 Unclassified 742
262 Ga0501071_1327584 3300049587 Bacteria 556
263 Ga0501072_0000318 3300049588 Bacteria 34284
264 Ga0501072_0006359 3300049588 Bacteria 8993
265 Ga0501072_0509303 3300049588 Bacteria 952
266 Ga0501072_0537720 3300049588 Bacteria 923
267 Ga0501073_0032309 3300049589 Bacteria 3731
268 Ga0501074_0006115 3300049590 Bacteria 8694
269 Ga0501074_0135375 3300049590 Bacteria 1762
270 Ga0501074_0463301 3300049590 Unclassified 898
271 Ga0501074_0488685 3300049590 Bacteria 872
272 Ga0501075_0001664 3300049591 Bacteria 14581
273 Ga0501075_0006994 3300049591 Bacteria 7795
274 Ga0501075_0567607 3300049591 Bacteria 866
275 Ga0501076_0001058 3300049592 Bacteria 18074
276 Ga0501076_0020365 3300049592 Bacteria 5077
277 Ga0501076_0195854 3300049592 Bacteria 1649
278 Ga0501076_0617917 3300049592 Bacteria 894
279 Ga0501076_1031019 3300049592 Bacteria 678
280 Ga0501076_1235106 3300049592 Bacteria 615
281 Ga0501077_0003555 3300049593 Bacteria 9367
282 Ga0501077_0027180 3300049593 Bacteria 3633
283 Ga0501077_0306569 3300049593 Bacteria 1012
284 Ga0501209_079282 3300049656 Unclassified 945
285 Ga0501233_291279 3300049668 Bacteria 502
286 Ga0501079_0003063 3300049741 Bacteria 12236
287 Ga0501079_0010605 3300049741 Bacteria 7012
288 Ga0501080_0095569 3300049742 Bacteria 2759
289 Ga0501080_0294880 3300049742 Bacteria 1472
290 Ga0501080_1656127 3300049742 Unclassified 541
291 Ga0501080_1791095 3300049742 Bacteria 516
292 Ga0501081_0006503 3300049743 Bacteria 7588
293 Ga0501081_0078614 3300049743 Bacteria 2306
294 Ga0501081_0344502 3300049743 Bacteria 1098
295 Ga0501083_0036207 3300049744 Bacteria 3367
296 Ga0501083_0805934 3300049744 Unclassified 611
297 Ga0501035_0014109 3300049822 Bacteria 7369
298 Ga0501035_0078495 3300049822 Bacteria 2916
299 Ga0501035_0347888 3300049822 Bacteria 1241
300 Ga0501044_0332744 3300049823 Bacteria 1441
301 Ga0501045_0001678 3300049824 Bacteria 14899
302 Ga0501045_0003625 3300049824 Bacteria 10616
303 Ga0501045_0518131 3300049824 Bacteria 885
304 Ga0501045_1133491 3300049824 Archaea 572
305 nmdc:mga05p37_432709_c1 3300050507 Bacteria 1528
306 nmdc:mga09592_1637536_c1 3300050508 Bacteria 520
307 nmdc:mga08y16_204689_c1 3300050511 Bacteria 2045
308 nmdc:mga08y16_808359_c1 3300050511 Bacteria 930
309 nmdc:mga0n895_10904_c2 3300050512 Bacteria 6660
310 nmdc:mga0n895_417942_c1 3300050512 Unclassified 1355
311 nmdc:mga0rr50_35318_c1 3300050513 Bacteria 3589
312 nmdc:mga0a205_18333_c3 3300050515 Bacteria 5488
313 Ga0495619_0438539 3300053085 Bacteria 901
314 Ga0501084_0001046 3300054114 Bacteria 21522
315 Ga0501084_0263987 3300054114 Bacteria 1454
316 Ga0501084_0345775 3300054114 Bacteria 1256
317 Ga0501084_0379573 3300054114 Bacteria 1194
318 Ga0501084_0535673 3300054114 Bacteria 990
319 Ga0501084_0642754 3300054114 Bacteria 896
320 Ga0501084_1163756 3300054114 Unclassified 647
321 Ga0590071_054775 3300059421 Bacteria 969
322 Ga0590074_117294 3300059423 Bacteria 528
323 Ga0590075_018009 3300059424 Bacteria 1745
324 Ga0590075_029016 3300059424 Bacteria 1398
325 Ga0590077_035475 3300059426 Bacteria 1099
326 Ga0501082_0008629 3300060353 Bacteria 8787
327 Ga0501082_0021980 3300060353 Bacteria 5500
328 Ga0501082_0226927 3300060353 Bacteria 1625
329 Ga0501082_0283991 3300060353 Bacteria 1441
330 Ga0530510_0002346 3300061734 Bacteria 12990
331 Ga0530510_0334303 3300061734 Bacteria 1137
332 Ga0530510_0447843 3300061734 Bacteria 976
333 Ga0590077_025011
334 Ga0070658_10429040
335 Ga0070683_100569029
336 Ga0070677_10560991
337 Ga0068868_100444914
338 Ga0070675_100035273
339 Ga0070674_100045419
340 Ga0070673_101041965
341 Ga0070659_100940207
342 Ga0070709_10006300
343 Ga0070714_100019562
344 Ga0070714_101492897
345 Ga0070710_10788832
346 Ga0070711_100898181
347 Ga0070711_101208913
348 Ga0070678_100323729
349 Ga0070678_100435845
350 Ga0070681_10265003
351 Ga0070681_10646272
352 Ga0068867_100554587
353 Ga0070707_100014204
354 Ga0070698_100028635
355 Ga0070698_101986828
356 Ga0070699_100069215
357 Ga0070699_101770833
358 Ga0070684_100311257
359 Ga0070672_100117177
360 Ga0070672_101038979
361 Ga0070696_100699966
362 Ga0070665_100997814
363 Ga0068855_100328066
364 Ga0070664_100794474
365 Ga0068856_100635720
366 Ga0068856_102668184
367 Ga0068870_11063191
368 Ga0081538_10169437
369 Ga0070717_10344724
370 Ga0070716_100005679
371 Ga0070712_101612405
372 Ga0075428_100831756
373 Ga0075433_10021732
374 Ga0075434_100019205
375 Ga0075434_101833838
376 Ga0075429_101693644
377 Ga0068865_100186928
378 Ga0075435_100003535
379 Ga0075435_100571038
380 Ga0111539_10136532
381 Ga0111539_10492701
382 Ga0105245_10878405
383 Ga0114129_10510720
384 Ga0105243_10218666
385 Ga0105243_12761574
386 Ga0105248_12799225
387 Ga0105249_11513936
388 Ga0157373_10204230
389 Ga0163163_10267561
390 Ga0163163_12742278
391 Ga0157377_10049800
392 Ga0157377_10191012
393 Ga0206352_11146519
394 Ga0207682_10360595
395 Ga0207688_10387750
396 Ga0207699_10035920
397 Ga0207705_10327033
398 Ga0207684_10569178
399 Ga0207707_10271499
400 Ga0207707_10531659
401 Ga0207707_11028292
402 Ga0207693_10116752
403 Ga0207693_10869868
404 Ga0207663_11022780
405 Ga0207660_11037820
406 Ga0207657_10133674
407 Ga0207646_11032902
408 Ga0207659_10432085
409 Ga0207700_10000006
410 Ga0207664_10085090
411 Ga0207644_10492322
412 Ga0207690_10700366
413 Ga0207709_10399052
414 Ga0207669_10029525
415 Ga0207704_10822144
416 Ga0207665_10024623
417 Ga0207661_11142114
418 Ga0207661_11700197
419 Ga0207679_10681575
420 Ga0207667_10835854
421 Ga0207677_10424031
422 Ga0207708_10101829
423 Ga0207648_10370895
424 Ga0207674_11185313
425 Ga0207675_101027289
426 Ga0207683_10146717
427 Ga0207683_10555390
428 Ga0268266_11028401
429 Ga0265338_10332214
430 Ga0265339_10550117
431 Ga0307408_100268795
432 Ga0307408_100673114
433 Ga0307405_11200365
434 Ga0307410_10389705
435 Ga0307407_10660723
436 Ga0307407_11088954
437 Ga0307412_11081228
438 Ga0307409_100024452
439 Ga0307409_100434954
440 Ga0307409_100459325
441 Ga0307409_100514774
442 Ga0307409_100772724
443 Ga0307409_100866782
444 Ga0307416_100053186
445 Ga0307416_100247665
446 Ga0307416_100361472
447 Ga0307416_100670278
448 Ga0307416_100854879
449 Ga0307416_101842020
450 Ga0307416_102073829
451 Ga0307415_100458392
452 Ga0395899_0054097
453 Ga0395899_0105932
454 Ga0395900_0002418
455 Ga0395900_0164159
456 Ga0395900_0359513
457 Ga0395900_1707537
458 Ga0395898_0083529
459 Ga0395898_1308620
460 Ga0395905_0081786
461 Ga0395905_0099684
462 Ga0395901_0015258
463 Ga0395901_0261766
464 Ga0395901_1569760
465 Ga0439439_0060083
466 Ga0439453_0175329
467 Ga0439461_0002612
468 Ga0439461_0049918
469 Ga0439466_0036795
470 Ga0439465_0283867
471 Ga0439431_0007622
472 Ga0439431_0065501
473 Ga0439433_0000148
474 Ga0439442_004457
475 Ga0439449_0036932
476 Ga0439452_098746
477 Ga0439454_035575
478 Ga0439457_037800
479 Ga0439462_0175898
480 Ga0450911_047260
481 Ga0450920_075831
482 Ga0450907_088989
483 Ga0439446_0002507
484 Ga0439446_0003702
485 Ga0439446_0004318
486 Ga0439446_0048370
487 Ga0439434_0005572
488 Ga0439434_0007397
489 Ga0439434_0014021
490 Ga0439434_0289720
491 Ga0450918_024847
492 Ga0466963_0469374
493 Ga0466964_0252827
494 Ga0466957_0579382
495 Ga0466960_0986418
496 Ga0466967_0423744
497 Ga0466967_1485601
498 Ga0495585_0164255
499 Ga0495585_0533655
500 Ga0495585_0630724
501 Ga0495607_0277948
502 Ga0495616_0455929
503 Ga0495631_0070950
504 Ga0495644_0095202
505 Ga0495644_0178612
506 Ga0495663_0146120
507 Ga0495654_0259636
508 Ga0495609_0269699
509 Ga0495609_0368555
510 Ga0495633_0184493
511 Ga0495667_0158939
512 Ga0495656_0127085
513 Ga0495656_0692015
514 Ga0495668_0167440
515 Ga0495611_0552108
516 Ga0495661_0256643
517 Ga0495661_0436339
518 Ga0495661_0481715
519 Ga0495599_0209483
520 Ga0495647_0148137
521 Ga0495670_0404926
522 Ga0495589_0209723
523 Ga0495581_0577243
524 Ga0495674_0657410
525 Ga0495676_0650771
526 Ga0495680_0370382
527 Ga0495683_0420412
528 Ga0496101_0518227
529 Ga0496101_0579288
530 Ga0496101_1426712
531 Ga0496102_1652476
532 Ga0496104_0108714
533 Ga0496104_1241033
534 Ga0496105_0478357
535 Ga0496105_1396200
536 Ga0496108_0092147
537 Ga0496109_0028581
538 Ga0496109_1798073
539 Ga0496110_0019338
540 Ga0496110_0027606
541 Ga0496111_0024092
542 Ga0496111_0131994
543 Ga0496112_0055106
544 Ga0496112_0610985
545 Ga0496113_0443955
546 Ga0496114_0355893
547 Ga0496115_0288901
548 Ga0501298_024488
549 Ga0501031_0004826
550 Ga0501031_0017743
551 Ga0501031_0817778
552 Ga0501032_0152112
553 Ga0501032_0183791
554 Ga0501033_0513616
555 Ga0501034_1129180
556 Ga0501036_0003780
557 Ga0501036_0042456
558 Ga0501036_0370894
559 Ga0501036_0958295
560 Ga0501036_1083122
561 Ga0501037_0075142
562 Ga0501038_0010062
563 Ga0501038_0909019
564 Ga0501039_0002342
565 Ga0501039_0018759
566 Ga0501039_0192831
567 Ga0501040_0001441
568 Ga0501040_0006022
569 Ga0501040_0057428
570 Ga0501040_1156285
571 Ga0501041_0004054
572 Ga0501041_0020827
573 Ga0501041_0116531
574 Ga0501042_0005756
575 Ga0501042_0013685
576 Ga0501042_0565998
577 Ga0501043_0055299
578 Ga0501043_1022713
579 Ga0501046_0015792
580 Ga0501046_0087156
581 Ga0501048_0003112
582 Ga0501048_0004940
583 Ga0501048_0443630
584 Ga0501048_0549116
585 Ga0501068_0041154
586 Ga0501069_0020296
587 Ga0501069_0256329
588 Ga0501070_0168688
589 Ga0501070_0645291
590 Ga0501071_0001749
591 Ga0501071_0079042
592 Ga0501071_0190937
593 Ga0501071_0768468
594 Ga0501071_1327584
595 Ga0501072_0000318
596 Ga0501072_0006359
597 Ga0501072_0509303
598 Ga0501072_0537720
599 Ga0501073_0032309
600 Ga0501074_0006115
601 Ga0501074_0135375
602 Ga0501074_0463301
603 Ga0501074_0488685
604 Ga0501075_0001664
605 Ga0501075_0006994
606 Ga0501075_0567607
607 Ga0501076_0001058
608 Ga0501076_0020365
609 Ga0501076_0195854
610 Ga0501076_0617917
611 Ga0501076_1031019
612 Ga0501076_1235106
613 Ga0501077_0003555
614 Ga0501077_0027180
615 Ga0501077_0306569
616 Ga0501209_079282
617 Ga0501233_291279
618 Ga0501079_0003063
619 Ga0501079_0010605
620 Ga0501080_0095569
621 Ga0501080_0294880
622 Ga0501080_1656127
623 Ga0501080_1791095
624 Ga0501081_0006503
625 Ga0501081_0078614
626 Ga0501081_0344502
627 Ga0501083_0036207
628 Ga0501083_0805934
629 Ga0501035_0014109
630 Ga0501035_0078495
631 Ga0501035_0347888
632 Ga0501044_0332744
633 Ga0501045_0001678
634 Ga0501045_0003625
635 Ga0501045_0518131
636 Ga0501045_1133491
637 nmdc:mga05p37_432709_c1
638 nmdc:mga09592_1637536_c1
639 nmdc:mga08y16_204689_c1
640 nmdc:mga08y16_808359_c1
641 nmdc:mga0n895_10904_c2
642 nmdc:mga0n895_417942_c1
643 nmdc:mga0rr50_35318_c1
644 nmdc:mga0a205_18333_c3
645 Ga0495619_0438539
646 Ga0501084_0001046
647 Ga0501084_0263987
648 Ga0501084_0345775
649 Ga0501084_0379573
650 Ga0501084_0535673
651 Ga0501084_0642754
652 Ga0501084_1163756
653 Ga0590071_054775
654 Ga0590074_117294
655 Ga0590075_018009
656 Ga0590075_029016
657 Ga0590077_035475
658 Ga0501082_0008629
659 Ga0501082_0021980
660 Ga0501082_0226927
661 Ga0501082_0283991
662 Ga0530510_0002346
663 Ga0530510_0334303
664 Ga0530510_0447843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13560

HTH_31

Helix-turn-helix domain

17

80

0.95

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

21

81

0.94

PF01381

HTH_3

Helix-turn-helix

22

77

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9581 12 70
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9557 12 70
6rmq-assembly2.cif.gz_B-3 crystal structure of a selenomethionine-substituted a70m i84m mutant of the essential repressor ddro from radiation resistant-deinococcus bacteria (deinococcus deserti) 0.9526 13 68
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.9515 10 68
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9489 13 68
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9663 13 70 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9581 12 70 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9557 12 70 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9489 13 68 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9456 13 67 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7V9G080-F1-model_v4 Helix-turn-helix domain-containing protein 1.003 1 99 GO:0003677
AF-A0A538H4T0-F1-model_v4 Helix-turn-helix transcriptional regulator 1.001 3 96 GO:0003677
AF-A0A419GUD3-F1-model_v4 XRE family transcriptional regulator 0.9942 7 94 GO:0003677
AF-A0A7V9G080-F1-model_v4 Helix-turn-helix domain-containing protein 0.9927 1 99 GO:0003677
AF-A0A7R6PII0-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9804 11 64 GO:0003677

Map