F411143

General Info

Members Datasets Scaffolds Average Seq Length
332 234 664 364

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0016147|Ga0500616_0016147_1852_3081
Length 409
Sequence LGAGSSFNQEQNMAKVVVENVYKIYQGDKGREVTAVENANLVIEDQEFMVLVGPSGCGKSTTLRMIAGLEEISKGNIFIDGKRINDVPPKDRDIAMVFQNYALYPHMTVYKNMAFGLQLRKYPQEEIDKRVREAAQILGLTDEMLERKPKALSGGQRQRVAVGRAIVRKPKAFLFDEPLSNLDAKMRVQMRTEISKLHTRLSSTMIYVTHDQVEAMTMGDRITVMKDGRIQQVAEPLEIYHNPANVYVAGFIGSPPMNFFEGLIRKKDGHLWFIEQKDGRDSGQNLRLEDEQARKVADYTDKKVIFGIRPEDLEDKLYVAEPNPAHVFSATVEVVEPMGSETFLYLSTEATSFISRSQTGKREEVNQKIDMVANMKKAHFFERVEPSGFRKDNGEPDIEAWHSSCKRLT

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
228 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
229 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
230 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
231 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
232 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
233 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
234 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.87
Metatranscriptomes 5.72
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0.3
Rhizoplane 1.81
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0016147 3300053153 Bacteria 4257
2 JGI24743J22301_10000476 3300001991 Bacteria 4626
3 Ga0058863_11966575 3300004799 Bacteria 1512
4 Ga0058861_10126439 3300004800 Bacteria 1523
5 Ga0058862_10124760 3300004803 Bacteria 1410
6 Ga0065707_10101707 3300005295 Bacteria 2850
7 Ga0070676_10001106 3300005328 Bacteria 13467
8 Ga0070683_100013734 3300005329 Bacteria 7070
9 Ga0070690_100005515 3300005330 Bacteria 7116
10 Ga0070690_100053441 3300005330 Bacteria 2584
11 Ga0070677_10000545 3300005333 Bacteria 12869
12 Ga0070677_10001498 3300005333 Bacteria 7385
13 Ga0070666_10001877 3300005335 Bacteria 12791
14 Ga0070666_10007585 3300005335 Bacteria 6692
15 Ga0070680_100016823 3300005336 Bacteria 5754
16 Ga0070682_100029576 3300005337 Bacteria 3300
17 Ga0068868_100028509 3300005338 Bacteria 4269
18 Ga0070660_100008810 3300005339 Bacteria 7070
19 Ga0070689_100010244 3300005340 Bacteria 6679
20 Ga0070689_100013750 3300005340 Bacteria 5863
21 Ga0070689_100016506 3300005340 Bacteria 5404
22 Ga0070687_100002778 3300005343 Bacteria 6654
23 Ga0070661_100001388 3300005344 Bacteria 16921
24 Ga0070668_100009778 3300005347 Bacteria 7108
25 Ga0070668_100150029 3300005347 Bacteria 1884
26 Ga0070669_100010208 3300005353 Bacteria 6672
27 Ga0070669_100084040 3300005353 Bacteria 2374
28 Ga0070675_100013589 3300005354 Bacteria 6402
29 Ga0070675_100021849 3300005354 Bacteria 5111
30 Ga0070671_100032788 3300005355 Bacteria 4293
31 Ga0070673_100009534 3300005364 Bacteria 6519
32 Ga0070688_100005546 3300005365 Bacteria 6660
33 Ga0070688_100005960 3300005365 Bacteria 6458
34 Ga0070688_100032437 3300005365 Bacteria 3149
35 Ga0070659_100009708 3300005366 Bacteria 7070
36 Ga0070667_100097163 3300005367 Bacteria 2541
37 Ga0070701_10000887 3300005438 Bacteria 10771
38 Ga0070701_10072373 3300005438 Bacteria 1846
39 Ga0070711_100051496 3300005439 Bacteria 2828
40 Ga0070705_100005217 3300005440 Bacteria 6312
41 Ga0070700_100040842 3300005441 Bacteria 2842
42 Ga0070694_100088797 3300005444 Bacteria 2165
43 Ga0070708_100002783 3300005445 Bacteria 13588
44 Ga0070708_100005333 3300005445 Bacteria 10194
45 Ga0070708_100066242 3300005445 Bacteria 3242
46 Ga0070708_100155110 3300005445 Bacteria 2131
47 Ga0070663_100041434 3300005455 Bacteria 3229
48 Ga0070678_100007704 3300005456 Bacteria 6402
49 Ga0070678_100041140 3300005456 Bacteria 3274
50 Ga0070662_100001111 3300005457 Bacteria 16412
51 Ga0068867_100009148 3300005459 Bacteria 6990
52 Ga0068867_100037025 3300005459 Bacteria 3545
53 Ga0070685_10002618 3300005466 Bacteria 9220
54 Ga0070706_100000701 3300005467 Bacteria 37893
55 Ga0070706_100004224 3300005467 Bacteria 13941
56 Ga0070706_100009550 3300005467 Bacteria 9020
57 Ga0070706_100093061 3300005467 Bacteria 2797
58 Ga0070707_100030026 3300005468 Bacteria 5172
59 Ga0070707_100328551 3300005468 Bacteria 1486
60 Ga0070707_100388445 3300005468 Bacteria 1355
61 Ga0070698_100000183 3300005471 Bacteria 59252
62 Ga0070698_100031614 3300005471 Bacteria 5487
63 Ga0070698_100048847 3300005471 Bacteria 4323
64 Ga0070698_100072370 3300005471 Bacteria 3455
65 Ga0070699_100030577 3300005518 Bacteria 4649
66 Ga0070699_100155248 3300005518 Bacteria 2025
67 Ga0070679_100057853 3300005530 Bacteria 3864
68 Ga0070684_100024616 3300005535 Bacteria 5052
69 Ga0070697_100001370 3300005536 Bacteria 18463
70 Ga0070697_100023110 3300005536 Bacteria 4943
71 Ga0070697_100031062 3300005536 Bacteria 4294
72 Ga0070672_100001384 3300005543 Bacteria 14956
73 Ga0070672_100151386 3300005543 Bacteria 1919
74 Ga0070686_100005383 3300005544 Bacteria 7081
75 Ga0070686_100268810 3300005544 Bacteria 1253
76 Ga0070695_100018321 3300005545 Bacteria 4252
77 Ga0070695_100032537 3300005545 Bacteria 3261
78 Ga0070696_100029433 3300005546 Bacteria 3754
79 Ga0070693_100010603 3300005547 Bacteria 4620
80 Ga0070665_100007493 3300005548 Bacteria 11097
81 Ga0070704_100031361 3300005549 Bacteria 3574
82 Ga0068855_100023183 3300005563 Bacteria 7436
83 Ga0070664_100019253 3300005564 Bacteria 5615
84 Ga0068854_100007198 3300005578 Bacteria 7105
85 Ga0068856_100008197 3300005614 Bacteria 10187
86 Ga0070702_100057487 3300005615 Bacteria 2250
87 Ga0068852_100008863 3300005616 Bacteria 7442
88 Ga0068859_100021953 3300005617 Bacteria 6401
89 Ga0068859_100284421 3300005617 Bacteria 1746
90 Ga0068864_100011698 3300005618 Bacteria 7247
91 Ga0068864_100027214 3300005618 Bacteria 4827
92 Ga0068866_10003918 3300005718 Bacteria 6109
93 Ga0068861_100008029 3300005719 Bacteria 7261
94 Ga0068861_100234458 3300005719 Bacteria 1558
95 Ga0068851_10003276 3300005834 Bacteria 7184
96 Ga0068870_10003039 3300005840 Bacteria 7070
97 Ga0068863_100018567 3300005841 Bacteria 6655
98 Ga0068858_100194870 3300005842 Bacteria 1915
99 Ga0068860_100020501 3300005843 Bacteria 6402
100 Ga0068862_100014072 3300005844 Bacteria 6637
101 Ga0081540_1029572 3300005983 Bacteria 3049
102 Ga0097621_100010948 3300006237 Bacteria 6660
103 Ga0068871_100008258 3300006358 Bacteria 7485
104 Ga0075428_100055827 3300006844 Bacteria 4327
105 Ga0075433_10089122 3300006852 Bacteria 2727
106 Ga0068865_100008876 3300006881 Bacteria 6219
107 Ga0068865_100163168 3300006881 Bacteria 1702
108 Ga0075436_100025671 3300006914 Bacteria 4055
109 Ga0075436_100216434 3300006914 Bacteria 1359
110 Ga0097620_100021950 3300006931 Bacteria 6401
111 Ga0097620_100284450 3300006931 Bacteria 1746
112 Ga0075435_100116922 3300007076 Bacteria 2222
113 Ga0099794_10000381 3300007265 Bacteria 15122
114 Ga0105250_10007418 3300009092 Bacteria 4713
115 Ga0105240_10000089 3300009093 Bacteria 185437
116 Ga0105240_10025620 3300009093 Bacteria 7745
117 Ga0105240_10257034 3300009093 Bacteria 2017
118 Ga0105245_10030430 3300009098 Bacteria 4773
119 Ga0105247_10003601 3300009101 Bacteria 10058
120 Ga0114129_10009799 3300009147 Bacteria 13660
121 Ga0114129_10020612 3300009147 Bacteria 9372
122 Ga0114129_10056160 3300009147 Bacteria 5516
123 Ga0105243_10011546 3300009148 Bacteria 6683
124 Ga0105241_10003094 3300009174 Bacteria 12398
125 Ga0105242_10002587 3300009176 Bacteria 14176
126 Ga0105237_10000094 3300009545 Bacteria 121776
127 Ga0105237_10020269 3300009545 Bacteria 6858
128 Ga0105238_10015318 3300009551 Bacteria 7767
129 Ga0105238_10018300 3300009551 Bacteria 7129
130 Ga0105249_10013351 3300009553 Bacteria 7253
131 Ga0105249_10092897 3300009553 Bacteria 2826
132 Ga0105239_10001139 3300010375 Bacteria 36653
133 Ga0105239_10007670 3300010375 Bacteria 12361
134 Ga0105239_10041637 3300010375 Bacteria 5033
135 Ga0105246_10010051 3300011119 Bacteria 5839
136 Ga0157373_10001600 3300013100 Bacteria 17297
137 Ga0157371_10002062 3300013102 Bacteria 19702
138 Ga0157369_10002268 3300013105 Bacteria 23118
139 Ga0157374_10031012 3300013296 Bacteria 4854
140 Ga0157374_10315646 3300013296 Bacteria 1548
141 Ga0157378_10001744 3300013297 Bacteria 19502
142 Ga0163162_10029939 3300013306 Bacteria 5390
143 Ga0157375_10577659 3300013308 Bacteria 1284
144 Ga0163163_10027767 3300014325 Bacteria 5426
145 Ga0163163_10046119 3300014325 Bacteria 4280
146 Ga0157380_10084841 3300014326 Bacteria 2598
147 Ga0157380_10259260 3300014326 Bacteria 1578
148 Ga0157377_10032220 3300014745 Bacteria 2853
149 Ga0157379_10011887 3300014968 Bacteria 7606
150 Ga0157376_10019986 3300014969 Bacteria 5172
151 Ga0163161_10009592 3300017792 Bacteria 6693
152 Ga0197907_11243037 3300020069 Bacteria 1515
153 Ga0206356_11148011 3300020070 Bacteria 1505
154 Ga0206350_10681523 3300020080 Bacteria 1289
155 Ga0206354_11333927 3300020081 Bacteria 1504
156 Ga0209147_100068 3300025229 Bacteria 230150
157 Ga0207697_10000028 3300025315 Bacteria 51621
158 Ga0207697_10034564 3300025315 Bacteria 2069
159 Ga0207656_10000477 3300025321 Bacteria 13316
160 Ga0207682_10000822 3300025893 Bacteria 14340
161 Ga0207682_10002929 3300025893 Bacteria 7528
162 Ga0207688_10000040 3300025901 Bacteria 44587
163 Ga0207680_10012424 3300025903 Bacteria 4335
164 Ga0207699_10061419 3300025906 Bacteria 2261
165 Ga0207645_10000010 3300025907 Bacteria 133678
166 Ga0207645_10012546 3300025907 Bacteria 5747
167 Ga0207643_10000043 3300025908 Bacteria 84139
168 Ga0207684_10000022 3300025910 Bacteria 337007
169 Ga0207684_10001182 3300025910 Bacteria 29205
170 Ga0207684_10001548 3300025910 Bacteria 24586
171 Ga0207684_10010138 3300025910 Bacteria 8298
172 Ga0207695_10000178 3300025913 Bacteria 185676
173 Ga0207695_10031889 3300025913 Bacteria 5772
174 Ga0207695_10346461 3300025913 Bacteria 1373
175 Ga0207671_10000006 3300025914 Bacteria 836809
176 Ga0207662_10000070 3300025918 Bacteria 45609
177 Ga0207657_10000835 3300025919 Bacteria 32524
178 Ga0207649_10001667 3300025920 Bacteria 12845
179 Ga0207652_10224725 3300025921 Bacteria 1692
180 Ga0207646_10015297 3300025922 Bacteria 7251
181 Ga0207646_10124799 3300025922 Bacteria 2314
182 Ga0207646_10230218 3300025922 Bacteria 1674
183 Ga0207646_10307570 3300025922 Bacteria 1432
184 Ga0207646_10348778 3300025922 Bacteria 1338
185 Ga0207681_10000796 3300025923 Bacteria 20797
186 Ga0207681_10129884 3300025923 Bacteria 1861
187 Ga0207694_10001826 3300025924 Bacteria 17730
188 Ga0207694_10023918 3300025924 Bacteria 4640
189 Ga0207650_10000043 3300025925 Bacteria 184978
190 Ga0207659_10000341 3300025926 Bacteria 27924
191 Ga0207659_10081216 3300025926 Bacteria 2396
192 Ga0207659_10296048 3300025926 Bacteria 1327
193 Ga0207687_10006352 3300025927 Bacteria 7810
194 Ga0207644_10000126 3300025931 Bacteria 56316
195 Ga0207644_10156406 3300025931 Bacteria 1768
196 Ga0207706_10000305 3300025933 Bacteria 53384
197 Ga0207706_10023266 3300025933 Bacteria 5565
198 Ga0207686_10009379 3300025934 Bacteria 5309
199 Ga0207709_10131138 3300025935 Bacteria 1709
200 Ga0207670_10014380 3300025936 Bacteria 4697
201 Ga0207670_10072812 3300025936 Bacteria 2381
202 Ga0207670_10130394 3300025936 Bacteria 1841
203 Ga0207669_10000324 3300025937 Bacteria 21869
204 Ga0207704_10000725 3300025938 Bacteria 14473
205 Ga0207691_10000069 3300025940 Bacteria 84144
206 Ga0207691_10002434 3300025940 Bacteria 18212
207 Ga0207711_10001393 3300025941 Bacteria 22737
208 Ga0207689_10006032 3300025942 Bacteria 10712
209 Ga0207661_10014520 3300025944 Bacteria 5776
210 Ga0207679_10004008 3300025945 Bacteria 9145
211 Ga0207667_10002531 3300025949 Bacteria 22757
212 Ga0207712_10000104 3300025961 Bacteria 95386
213 Ga0207640_10008854 3300025981 Bacteria 5604
214 Ga0207658_10001254 3300025986 Bacteria 20076
215 Ga0207677_10000443 3300026023 Bacteria 28082
216 Ga0207703_10000098 3300026035 Bacteria 103911
217 Ga0207678_10003390 3300026067 Bacteria 14357
218 Ga0207708_10019468 3300026075 Bacteria 5117
219 Ga0207708_10039183 3300026075 Bacteria 3610
220 Ga0207708_10043155 3300026075 Bacteria 3437
221 Ga0207702_10006214 3300026078 Bacteria 10330
222 Ga0207641_10001460 3300026088 Bacteria 23170
223 Ga0207648_10000100 3300026089 Bacteria 82656
224 Ga0207648_10019169 3300026089 Bacteria 6174
225 Ga0207648_10078943 3300026089 Bacteria 2872
226 Ga0207676_10014102 3300026095 Bacteria 5741
227 Ga0207674_10008063 3300026116 Bacteria 12211
228 Ga0207675_100019109 3300026118 Bacteria 6397
229 Ga0207675_100047291 3300026118 Bacteria 4017
230 Ga0207683_10005663 3300026121 Bacteria 10711
231 Ga0207683_10029405 3300026121 Bacteria 4757
232 Ga0207698_10002837 3300026142 Bacteria 10367
233 Ga0209970_1003407 3300027614 Bacteria 2674
234 Ga0209974_10005839 3300027876 Bacteria 4316
235 Ga0268266_10000390 3300028379 Bacteria 66531
236 Ga0268264_10007188 3300028381 Bacteria 9327
237 Ga0265326_10005060 3300028558 Bacteria 4173
238 Ga0265326_10016545 3300028558 Bacteria 2131
239 Ga0265319_1003460 3300028563 Bacteria 8218
240 Ga0265319_1036800 3300028563 Bacteria 1671
241 Ga0265334_10009523 3300028573 Bacteria 4108
242 Ga0265318_10003044 3300028577 Bacteria 8632
243 Ga0265323_10041867 3300028653 Bacteria 1660
244 Ga0265322_10009064 3300028654 Bacteria 2892
245 Ga0265336_10010128 3300028666 Bacteria 3232
246 Ga0265336_10017695 3300028666 Bacteria 2319
247 Ga0307515_10000297 3300028794 Bacteria 122823
248 Ga0307515_10042892 3300028794 Bacteria 7055
249 Ga0265338_10013102 3300028800 Bacteria 9395
250 Ga0265338_10016698 3300028800 Bacteria 7957
251 Ga0265338_10033209 3300028800 Bacteria 5013
252 Ga0265338_10055874 3300028800 Bacteria 3507
253 Ga0265332_10008669 3300031238 Bacteria 4559
254 Ga0265332_10010294 3300031238 Bacteria 4163
255 Ga0265339_10035990 3300031249 Bacteria 2772
256 Ga0307508_10013323 3300031616 Bacteria 7520
257 Ga0316575_10102388 3300031665 Bacteria 1165
258 Ga0316579_10001956 3300031691 Bacteria 7686
259 Ga0265314_10000088 3300031711 Bacteria 138315
260 Ga0265314_10029947 3300031711 Bacteria 4036
261 Ga0265342_10000009 3300031712 Bacteria 220210
262 Ga0316576_10004057 3300031727 Bacteria 8718
263 Ga0373961_0000387 3300035241 Bacteria 18534
264 Ga0373931_0001257 3300035691 Bacteria 10821
265 Ga0373931_0002747 3300035691 Bacteria 7832
266 Ga0373937_0256944 3300036401 Bacteria 1647
267 Ga0316584_0009420 3300036712 Bacteria 6780
268 Ga0316584_0015324 3300036712 Bacteria 5481
269 Ga0395905_0010908 3300037471 Bacteria 8798
270 Ga0436364_1091749 3300037853 Bacteria 2344
271 Ga0436365_0626822 3300039437 Bacteria 10788
272 Ga0436365_1330537 3300039437 Bacteria 1734
273 Ga0451577_0017176 3300042876 Bacteria 6687
274 Ga0453683_0045898 3300044673 Bacteria 2739
275 Ga0453683_0048391 3300044673 Bacteria 2667
276 Ga0453683_0164995 3300044673 Bacteria 1402
277 Ga0466963_0121620 3300044694 Bacteria 1797
278 Ga0466963_0325821 3300044694 Bacteria 1081
279 Ga0453684_0000072 3300044712 Bacteria 442457
280 Ga0451576_0005276 3300045051 Bacteria 16259
281 Ga0451576_0179432 3300045051 Bacteria 2211
282 Ga0451576_0198374 3300045051 Bacteria 2096
283 Ga0451576_0214791 3300045051 Bacteria 2009
284 Ga0466958_0038562 3300045836 Bacteria 2867
285 Ga0495580_0229364 3300046472 Bacteria 1275
286 Ga0495658_0120303 3300046683 Bacteria 1587
287 Ga0495684_0109870 3300047471 Bacteria 2082
288 Ga0495602_0012068 3300048088 Bacteria 8905
289 Ga0496103_0034952 3300048906 Bacteria 3075
290 Ga0496106_0013700 3300048909 Bacteria 5988
291 Ga0496107_0162330 3300048910 Bacteria 1656
292 Ga0496108_0024940 3300048911 Bacteria 4926
293 Ga0496109_0022437 3300048912 Bacteria 5590
294 Ga0496112_0018349 3300048915 Bacteria 6587
295 Ga0501039_0132780 3300049575 Bacteria 1954
296 Ga0501067_0017937 3300049583 Bacteria 3919
297 Ga0501068_0008423 3300049584 Bacteria 5737
298 Ga0501075_0001415 3300049591 Bacteria 15632
299 Ga0501077_0000191 3300049593 Bacteria 35249
300 Ga0501079_0040547 3300049741 Bacteria 3592
301 Ga0501080_0008073 3300049742 Bacteria 9540
302 Ga0501081_0046146 3300049743 Bacteria 2994
303 nmdc:mga05p37_147099_c1 3300050507 Bacteria 2883
304 nmdc:mga05p37_17919_c1 3300050507 Bacteria 8549
305 nmdc:mga05p37_28604_c1 3300050507 Bacteria 6798
306 nmdc:mga0rr50_60858_c1 3300050513 Bacteria 2842
307 nmdc:mga08x19_39454_c1 3300050514 Bacteria 3002
308 nmdc:mga0a205_13146_c1 3300050515 Bacteria 7688
309 nmdc:mga0a205_57304_c1 3300050515 Bacteria 2884
310 Ga0500555_000158 3300053103 Bacteria 31987
311 Ga0500616_0000025 3300053153 Bacteria 454567
312 Ga0587070_007599 3300059491 Bacteria 1509
313 Ga0587073_0020199 3300059492 Bacteria 1267
314 Ga0587082_006983 3300059504 Bacteria 1526
315 Ga0587083_0021142 3300059505 Bacteria 1206
316 Ga0587085_011118 3300059506 Bacteria 1209
317 Ga0587091_008977 3300059511 Bacteria 1493
318 Ga0587092_006208 3300059512 Bacteria 1504
319 Ga0587094_005258 3300059513 Bacteria 1504
320 Ga0587101_004352 3300059623 Bacteria 1508
321 Ga0587128_005735 3300059630 Bacteria 1499
322 Ga0587111_0012437 3300060346 Bacteria 1503
323 Ga0587111_0025645 3300060346 Bacteria 1169
324 Ga0501082_0000209 3300060353 Bacteria 51173
325 2511179660 2510917027 Bacteria 5287437
326 2512638996 2512564013 Bacteria 6286191
327 2831906154 2831905167 Bacteria 3319172
328 2857470057 2857465823 Bacteria 6772595
329 2857591434 2857591370 Bacteria 6569758
330 2915600728 2915597211 Bacteria 6475886
331 2915606883 2915606848 Bacteria 6032732
332 2929185875 2929183550 Bacteria 6377511
333 Ga0500616_0016147
334 JGI24743J22301_10000476
335 Ga0058863_11966575
336 Ga0058861_10126439
337 Ga0058862_10124760
338 Ga0065707_10101707
339 Ga0070676_10001106
340 Ga0070683_100013734
341 Ga0070690_100005515
342 Ga0070690_100053441
343 Ga0070677_10000545
344 Ga0070677_10001498
345 Ga0070666_10001877
346 Ga0070666_10007585
347 Ga0070680_100016823
348 Ga0070682_100029576
349 Ga0068868_100028509
350 Ga0070660_100008810
351 Ga0070689_100010244
352 Ga0070689_100013750
353 Ga0070689_100016506
354 Ga0070687_100002778
355 Ga0070661_100001388
356 Ga0070668_100009778
357 Ga0070668_100150029
358 Ga0070669_100010208
359 Ga0070669_100084040
360 Ga0070675_100013589
361 Ga0070675_100021849
362 Ga0070671_100032788
363 Ga0070673_100009534
364 Ga0070688_100005546
365 Ga0070688_100005960
366 Ga0070688_100032437
367 Ga0070659_100009708
368 Ga0070667_100097163
369 Ga0070701_10000887
370 Ga0070701_10072373
371 Ga0070711_100051496
372 Ga0070705_100005217
373 Ga0070700_100040842
374 Ga0070694_100088797
375 Ga0070708_100002783
376 Ga0070708_100005333
377 Ga0070708_100066242
378 Ga0070708_100155110
379 Ga0070663_100041434
380 Ga0070678_100007704
381 Ga0070678_100041140
382 Ga0070662_100001111
383 Ga0068867_100009148
384 Ga0068867_100037025
385 Ga0070685_10002618
386 Ga0070706_100000701
387 Ga0070706_100004224
388 Ga0070706_100009550
389 Ga0070706_100093061
390 Ga0070707_100030026
391 Ga0070707_100328551
392 Ga0070707_100388445
393 Ga0070698_100000183
394 Ga0070698_100031614
395 Ga0070698_100048847
396 Ga0070698_100072370
397 Ga0070699_100030577
398 Ga0070699_100155248
399 Ga0070679_100057853
400 Ga0070684_100024616
401 Ga0070697_100001370
402 Ga0070697_100023110
403 Ga0070697_100031062
404 Ga0070672_100001384
405 Ga0070672_100151386
406 Ga0070686_100005383
407 Ga0070686_100268810
408 Ga0070695_100018321
409 Ga0070695_100032537
410 Ga0070696_100029433
411 Ga0070693_100010603
412 Ga0070665_100007493
413 Ga0070704_100031361
414 Ga0068855_100023183
415 Ga0070664_100019253
416 Ga0068854_100007198
417 Ga0068856_100008197
418 Ga0070702_100057487
419 Ga0068852_100008863
420 Ga0068859_100021953
421 Ga0068859_100284421
422 Ga0068864_100011698
423 Ga0068864_100027214
424 Ga0068866_10003918
425 Ga0068861_100008029
426 Ga0068861_100234458
427 Ga0068851_10003276
428 Ga0068870_10003039
429 Ga0068863_100018567
430 Ga0068858_100194870
431 Ga0068860_100020501
432 Ga0068862_100014072
433 Ga0081540_1029572
434 Ga0097621_100010948
435 Ga0068871_100008258
436 Ga0075428_100055827
437 Ga0075433_10089122
438 Ga0068865_100008876
439 Ga0068865_100163168
440 Ga0075436_100025671
441 Ga0075436_100216434
442 Ga0097620_100021950
443 Ga0097620_100284450
444 Ga0075435_100116922
445 Ga0099794_10000381
446 Ga0105250_10007418
447 Ga0105240_10000089
448 Ga0105240_10025620
449 Ga0105240_10257034
450 Ga0105245_10030430
451 Ga0105247_10003601
452 Ga0114129_10009799
453 Ga0114129_10020612
454 Ga0114129_10056160
455 Ga0105243_10011546
456 Ga0105241_10003094
457 Ga0105242_10002587
458 Ga0105237_10000094
459 Ga0105237_10020269
460 Ga0105238_10015318
461 Ga0105238_10018300
462 Ga0105249_10013351
463 Ga0105249_10092897
464 Ga0105239_10001139
465 Ga0105239_10007670
466 Ga0105239_10041637
467 Ga0105246_10010051
468 Ga0157373_10001600
469 Ga0157371_10002062
470 Ga0157369_10002268
471 Ga0157374_10031012
472 Ga0157374_10315646
473 Ga0157378_10001744
474 Ga0163162_10029939
475 Ga0157375_10577659
476 Ga0163163_10027767
477 Ga0163163_10046119
478 Ga0157380_10084841
479 Ga0157380_10259260
480 Ga0157377_10032220
481 Ga0157379_10011887
482 Ga0157376_10019986
483 Ga0163161_10009592
484 Ga0197907_11243037
485 Ga0206356_11148011
486 Ga0206350_10681523
487 Ga0206354_11333927
488 Ga0209147_100068
489 Ga0207697_10000028
490 Ga0207697_10034564
491 Ga0207656_10000477
492 Ga0207682_10000822
493 Ga0207682_10002929
494 Ga0207688_10000040
495 Ga0207680_10012424
496 Ga0207699_10061419
497 Ga0207645_10000010
498 Ga0207645_10012546
499 Ga0207643_10000043
500 Ga0207684_10000022
501 Ga0207684_10001182
502 Ga0207684_10001548
503 Ga0207684_10010138
504 Ga0207695_10000178
505 Ga0207695_10031889
506 Ga0207695_10346461
507 Ga0207671_10000006
508 Ga0207662_10000070
509 Ga0207657_10000835
510 Ga0207649_10001667
511 Ga0207652_10224725
512 Ga0207646_10015297
513 Ga0207646_10124799
514 Ga0207646_10230218
515 Ga0207646_10307570
516 Ga0207646_10348778
517 Ga0207681_10000796
518 Ga0207681_10129884
519 Ga0207694_10001826
520 Ga0207694_10023918
521 Ga0207650_10000043
522 Ga0207659_10000341
523 Ga0207659_10081216
524 Ga0207659_10296048
525 Ga0207687_10006352
526 Ga0207644_10000126
527 Ga0207644_10156406
528 Ga0207706_10000305
529 Ga0207706_10023266
530 Ga0207686_10009379
531 Ga0207709_10131138
532 Ga0207670_10014380
533 Ga0207670_10072812
534 Ga0207670_10130394
535 Ga0207669_10000324
536 Ga0207704_10000725
537 Ga0207691_10000069
538 Ga0207691_10002434
539 Ga0207711_10001393
540 Ga0207689_10006032
541 Ga0207661_10014520
542 Ga0207679_10004008
543 Ga0207667_10002531
544 Ga0207712_10000104
545 Ga0207640_10008854
546 Ga0207658_10001254
547 Ga0207677_10000443
548 Ga0207703_10000098
549 Ga0207678_10003390
550 Ga0207708_10019468
551 Ga0207708_10039183
552 Ga0207708_10043155
553 Ga0207702_10006214
554 Ga0207641_10001460
555 Ga0207648_10000100
556 Ga0207648_10019169
557 Ga0207648_10078943
558 Ga0207676_10014102
559 Ga0207674_10008063
560 Ga0207675_100019109
561 Ga0207675_100047291
562 Ga0207683_10005663
563 Ga0207683_10029405
564 Ga0207698_10002837
565 Ga0209970_1003407
566 Ga0209974_10005839
567 Ga0268266_10000390
568 Ga0268264_10007188
569 Ga0265326_10005060
570 Ga0265326_10016545
571 Ga0265319_1003460
572 Ga0265319_1036800
573 Ga0265334_10009523
574 Ga0265318_10003044
575 Ga0265323_10041867
576 Ga0265322_10009064
577 Ga0265336_10010128
578 Ga0265336_10017695
579 Ga0307515_10000297
580 Ga0307515_10042892
581 Ga0265338_10013102
582 Ga0265338_10016698
583 Ga0265338_10033209
584 Ga0265338_10055874
585 Ga0265332_10008669
586 Ga0265332_10010294
587 Ga0265339_10035990
588 Ga0307508_10013323
589 Ga0316575_10102388
590 Ga0316579_10001956
591 Ga0265314_10000088
592 Ga0265314_10029947
593 Ga0265342_10000009
594 Ga0316576_10004057
595 Ga0373961_0000387
596 Ga0373931_0001257
597 Ga0373931_0002747
598 Ga0373937_0256944
599 Ga0316584_0009420
600 Ga0316584_0015324
601 Ga0395905_0010908
602 Ga0436364_1091749
603 Ga0436365_0626822
604 Ga0436365_1330537
605 Ga0451577_0017176
606 Ga0453683_0045898
607 Ga0453683_0048391
608 Ga0453683_0164995
609 Ga0466963_0121620
610 Ga0466963_0325821
611 Ga0453684_0000072
612 Ga0451576_0005276
613 Ga0451576_0179432
614 Ga0451576_0198374
615 Ga0451576_0214791
616 Ga0466958_0038562
617 Ga0495580_0229364
618 Ga0495658_0120303
619 Ga0495684_0109870
620 Ga0495602_0012068
621 Ga0496103_0034952
622 Ga0496106_0013700
623 Ga0496107_0162330
624 Ga0496108_0024940
625 Ga0496109_0022437
626 Ga0496112_0018349
627 Ga0501039_0132780
628 Ga0501067_0017937
629 Ga0501068_0008423
630 Ga0501075_0001415
631 Ga0501077_0000191
632 Ga0501079_0040547
633 Ga0501080_0008073
634 Ga0501081_0046146
635 nmdc:mga05p37_147099_c1
636 nmdc:mga05p37_17919_c1
637 nmdc:mga05p37_28604_c1
638 nmdc:mga0rr50_60858_c1
639 nmdc:mga08x19_39454_c1
640 nmdc:mga0a205_13146_c1
641 nmdc:mga0a205_57304_c1
642 Ga0500555_000158
643 Ga0500616_0000025
644 Ga0587070_007599
645 Ga0587073_0020199
646 Ga0587082_006983
647 Ga0587083_0021142
648 Ga0587085_011118
649 Ga0587091_008977
650 Ga0587092_006208
651 Ga0587094_005258
652 Ga0587101_004352
653 Ga0587128_005735
654 Ga0587111_0012437
655 Ga0587111_0025645
656 Ga0501082_0000209
657 2511179660
658 2512638996
659 2831906154
660 2857470057
661 2857591434
662 2915600728
663 2915606883
664 2929185875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

36

180

0.93

PF17912

OB_MalK

MalK OB fold domain

253

313

0.87

PF08402

TOBE_2

TOBE domain

306

381

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v43-assembly1.cif.gz_A crystal structure of atpase subunit of abc sugar transporter 0.9446 1 361
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9389 4 233
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9375 4 361
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9373 4 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9363 1 217
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9887 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9776 1 217 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.975 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9688 1 217 3.40.50.300
2awnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9679 3 216 3.40.50.300
ID Description Score Start End GO Terms
AF-Q92ZS1-F1-model_v4 ABC transporter, ATP-binding protein, amino terminus 0.9712 1 166 GO:0005524
GO:0016887
GO:0055052
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9613 4 159 GO:0005524
GO:0016887
AF-A0A4Q3TF12-F1-model_v4 ABC transporter ATP-binding protein 0.9532 1 155 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A537X5T0-F1-model_v4 ABC transporter ATP-binding protein 0.9455 4 225 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A0D7KEI4-F1-model_v4 ABC transporter domain-containing protein 0.9438 93 217 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map