F411069
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 221 | 322 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300046520|Ga0495637_0004619|Ga0495637_0004619_3643_4542 |
| Length | 299 |
| Sequence | MIDVIDDNDEKSSFQYLIRCRYDEPIDTTGKPHVMKIGKETIPRSAISTSDEHSITVRGADLCRDLIGRLSFTDYFHLLVTGRRASAPAIAILDATLVAIAEHGLVPSVQASRMTLAAAPDALQGAVAAGILGCGSVILGASESAGRLFAEVDALAGAGGDLDAAALRVVRAYRAAKHAIPGYGHPLHKQRDPRVDALFAVARDQRIELRFIAIAEAVETAVAEVLGKPLKLNVSAAIPALLLGIGFPLAALKGVPILARAAGLIAHLTEEQERPIGFALSYQAARGLVYDGAAPDPQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 4 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 5 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 6 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 7 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 8 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 9 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 112 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 113 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 130 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 143 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 144 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 145 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 146 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 147 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 148 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 202 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 213 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 216 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 217 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 218 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 221 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.39 |
| Metatranscriptomes | 0.6 |
| Isolates | 3.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.04 |
| Nodule | 0.9 |
| Rhizoplane | 2.41 |
| Rhizosphere | 81.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000357 | 3300003187 | Bacteria | 48666 |
| 2 | rootH2_10078893 | 3300003320 | Bacteria | 1489 |
| 3 | Ga0006562J51391_1073707 | 3300003578 | Bacteria | 7900 |
| 4 | Ga0006562J51391_1073710 | 3300003578 | Bacteria | 4910 |
| 5 | Ga0055540_1000916 | 3300003792 | Bacteria | 19242 |
| 6 | Ga0070670_100201893 | 3300005331 | Bacteria | 1728 |
| 7 | Ga0068869_100307561 | 3300005334 | Bacteria | 1282 |
| 8 | Ga0068869_100538534 | 3300005334 | Bacteria | 979 |
| 9 | Ga0070680_100112033 | 3300005336 | Bacteria | 2272 |
| 10 | Ga0070682_100092181 | 3300005337 | Bacteria | 1984 |
| 11 | Ga0068868_100099220 | 3300005338 | Bacteria | 2356 |
| 12 | Ga0068868_100157441 | 3300005338 | Bacteria | 1874 |
| 13 | Ga0070689_100089541 | 3300005340 | Bacteria | 2424 |
| 14 | Ga0070661_100253436 | 3300005344 | Bacteria | 1359 |
| 15 | Ga0070669_100021314 | 3300005353 | Bacteria | 4632 |
| 16 | Ga0070669_100063292 | 3300005353 | Bacteria | 2723 |
| 17 | Ga0070675_100072215 | 3300005354 | Bacteria | 2865 |
| 18 | Ga0070675_100103738 | 3300005354 | Bacteria | 2398 |
| 19 | Ga0070674_100064659 | 3300005356 | Bacteria | 2564 |
| 20 | Ga0070674_100269895 | 3300005356 | Bacteria | 1344 |
| 21 | Ga0070688_100141490 | 3300005365 | Bacteria | 1635 |
| 22 | Ga0070659_100206197 | 3300005366 | Bacteria | 1619 |
| 23 | Ga0070667_100004212 | 3300005367 | Bacteria | 12144 |
| 24 | Ga0070667_100183054 | 3300005367 | Bacteria | 1853 |
| 25 | Ga0070667_100256171 | 3300005367 | Bacteria | 1565 |
| 26 | Ga0070667_100546635 | 3300005367 | Bacteria | 1064 |
| 27 | Ga0070714_100124674 | 3300005435 | Bacteria | 2295 |
| 28 | Ga0070713_100100429 | 3300005436 | Bacteria | 2505 |
| 29 | Ga0070713_100263731 | 3300005436 | Bacteria | 1575 |
| 30 | Ga0070701_10022995 | 3300005438 | Bacteria | 2996 |
| 31 | Ga0070701_10080301 | 3300005438 | Bacteria | 1764 |
| 32 | Ga0070701_10265030 | 3300005438 | Bacteria | 1043 |
| 33 | Ga0070711_100091708 | 3300005439 | Bacteria | 2191 |
| 34 | Ga0070711_100207604 | 3300005439 | Unclassified | 1515 |
| 35 | Ga0070678_100094008 | 3300005456 | Bacteria | 2307 |
| 36 | Ga0070662_100058506 | 3300005457 | Bacteria | 2805 |
| 37 | Ga0070662_100164818 | 3300005457 | Bacteria | 1736 |
| 38 | Ga0070681_10010823 | 3300005458 | Bacteria | 9016 |
| 39 | Ga0068867_100048172 | 3300005459 | Bacteria | 3135 |
| 40 | Ga0068867_100155594 | 3300005459 | Bacteria | 1799 |
| 41 | Ga0070685_10060970 | 3300005466 | Bacteria | 2208 |
| 42 | Ga0070685_10276924 | 3300005466 | Bacteria | 1122 |
| 43 | Ga0070685_10351567 | 3300005466 | Bacteria | 1008 |
| 44 | Ga0070684_100271017 | 3300005535 | Bacteria | 1554 |
| 45 | Ga0068853_100396182 | 3300005539 | Bacteria | 1292 |
| 46 | Ga0070672_100017856 | 3300005543 | Bacteria | 5115 |
| 47 | Ga0070672_100056228 | 3300005543 | Bacteria | 3085 |
| 48 | Ga0070695_100004700 | 3300005545 | Bacteria | 8034 |
| 49 | Ga0070665_100012754 | 3300005548 | Bacteria | 8465 |
| 50 | Ga0070665_100046891 | 3300005548 | Bacteria | 4338 |
| 51 | Ga0070664_100077187 | 3300005564 | Bacteria | 2864 |
| 52 | Ga0068857_100090709 | 3300005577 | Bacteria | 2735 |
| 53 | Ga0068852_100642086 | 3300005616 | Bacteria | 1068 |
| 54 | Ga0068859_100121470 | 3300005617 | Bacteria | 2679 |
| 55 | Ga0068859_100599280 | 3300005617 | Bacteria | 1195 |
| 56 | Ga0068864_100197009 | 3300005618 | Bacteria | 1849 |
| 57 | Ga0068861_100101387 | 3300005719 | Bacteria | 2290 |
| 58 | Ga0068861_100321438 | 3300005719 | Bacteria | 1348 |
| 59 | Ga0068851_10013540 | 3300005834 | Bacteria | 3859 |
| 60 | Ga0068863_100044210 | 3300005841 | Bacteria | 4228 |
| 61 | Ga0068858_100073119 | 3300005842 | Bacteria | 3182 |
| 62 | Ga0075363_100116778 | 3300006048 | Bacteria | 1487 |
| 63 | Ga0075364_10044509 | 3300006051 | Bacteria | 2887 |
| 64 | Ga0075362_10000661 | 3300006177 | Bacteria | 10159 |
| 65 | Ga0075362_10037973 | 3300006177 | Bacteria | 2114 |
| 66 | Ga0075367_10214765 | 3300006178 | Bacteria | 1203 |
| 67 | Ga0075369_10033499 | 3300006186 | Bacteria | 2178 |
| 68 | Ga0075366_10029548 | 3300006195 | Bacteria | 3220 |
| 69 | Ga0075366_10031251 | 3300006195 | Bacteria | 3133 |
| 70 | Ga0097621_100005591 | 3300006237 | Bacteria | 8862 |
| 71 | Ga0075370_10066063 | 3300006353 | Bacteria | 2063 |
| 72 | Ga0068871_100029884 | 3300006358 | Bacteria | 4285 |
| 73 | Ga0075428_100007405 | 3300006844 | Bacteria | 12167 |
| 74 | Ga0075428_100021183 | 3300006844 | Bacteria | 7198 |
| 75 | Ga0075430_100103756 | 3300006846 | Bacteria | 2374 |
| 76 | Ga0075430_100167025 | 3300006846 | Bacteria | 1831 |
| 77 | Ga0075431_100000011 | 3300006847 | Bacteria | 95501 |
| 78 | Ga0075431_100071016 | 3300006847 | Bacteria | 3592 |
| 79 | Ga0075429_100005334 | 3300006880 | Bacteria | 11062 |
| 80 | Ga0097620_100121468 | 3300006931 | Bacteria | 2679 |
| 81 | Ga0097620_100599306 | 3300006931 | Bacteria | 1195 |
| 82 | Ga0105240_10087784 | 3300009093 | Bacteria | 3807 |
| 83 | Ga0111539_10003199 | 3300009094 | Bacteria | 21666 |
| 84 | Ga0111539_11069777 | 3300009094 | Bacteria | 937 |
| 85 | Ga0105243_10049972 | 3300009148 | Bacteria | 3302 |
| 86 | Ga0105243_10172539 | 3300009148 | Bacteria | 1874 |
| 87 | Ga0105242_10777702 | 3300009176 | Bacteria | 945 |
| 88 | Ga0105237_10012264 | 3300009545 | Bacteria | 9034 |
| 89 | Ga0157370_10087775 | 3300013104 | Bacteria | 2921 |
| 90 | Ga0157370_10185772 | 3300013104 | Bacteria | 1930 |
| 91 | Ga0163162_10205042 | 3300013306 | Bacteria | 2101 |
| 92 | Ga0157372_10079362 | 3300013307 | Bacteria | 3712 |
| 93 | Ga0157375_10027539 | 3300013308 | Bacteria | 5313 |
| 94 | Ga0157375_10462760 | 3300013308 | Bacteria | 1434 |
| 95 | Ga0163163_10008641 | 3300014325 | Bacteria | 9060 |
| 96 | Ga0163163_10010812 | 3300014325 | Bacteria | 8239 |
| 97 | Ga0157380_10001615 | 3300014326 | Bacteria | 14859 |
| 98 | Ga0157380_10019159 | 3300014326 | Bacteria | 5097 |
| 99 | Ga0157380_10030838 | 3300014326 | Bacteria | 4110 |
| 100 | Ga0157380_10248455 | 3300014326 | Bacteria | 1609 |
| 101 | Ga0157379_10020265 | 3300014968 | Bacteria | 5879 |
| 102 | Ga0157379_10370862 | 3300014968 | Bacteria | 1312 |
| 103 | Ga0157376_11020016 | 3300014969 | Bacteria | 851 |
| 104 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 105 | Ga0209051_1000355 | 3300025303 | Bacteria | 67873 |
| 106 | Ga0207688_10010941 | 3300025901 | Bacteria | 4937 |
| 107 | Ga0207680_10284565 | 3300025903 | Bacteria | 1149 |
| 108 | Ga0207707_10049023 | 3300025912 | Bacteria | 3680 |
| 109 | Ga0207695_10221924 | 3300025913 | Bacteria | 1797 |
| 110 | Ga0207671_10024511 | 3300025914 | Bacteria | 4534 |
| 111 | Ga0207663_10091261 | 3300025916 | Bacteria | 2022 |
| 112 | Ga0207649_10303894 | 3300025920 | Bacteria | 1167 |
| 113 | Ga0207649_10455509 | 3300025920 | Bacteria | 966 |
| 114 | Ga0207650_10086490 | 3300025925 | Bacteria | 2386 |
| 115 | Ga0207650_10398913 | 3300025925 | Bacteria | 1138 |
| 116 | Ga0207700_10112096 | 3300025928 | Bacteria | 2197 |
| 117 | Ga0207690_10049559 | 3300025932 | Bacteria | 2801 |
| 118 | Ga0207706_10021921 | 3300025933 | Bacteria | 5734 |
| 119 | Ga0207706_10063806 | 3300025933 | Bacteria | 3243 |
| 120 | Ga0207706_10111765 | 3300025933 | Bacteria | 2403 |
| 121 | Ga0207709_10028524 | 3300025935 | Bacteria | 3227 |
| 122 | Ga0207669_10036203 | 3300025937 | Bacteria | 2818 |
| 123 | Ga0207669_10247069 | 3300025937 | Bacteria | 1326 |
| 124 | Ga0207691_10025164 | 3300025940 | Bacteria | 5590 |
| 125 | Ga0207691_10041143 | 3300025940 | Bacteria | 4268 |
| 126 | Ga0207689_10140094 | 3300025942 | Bacteria | 1992 |
| 127 | Ga0207689_10170093 | 3300025942 | Bacteria | 1796 |
| 128 | Ga0207689_10365322 | 3300025942 | Bacteria | 1200 |
| 129 | Ga0207679_10130970 | 3300025945 | Bacteria | 2012 |
| 130 | Ga0207651_10101092 | 3300025960 | Bacteria | 2139 |
| 131 | Ga0207658_10010187 | 3300025986 | Bacteria | 6388 |
| 132 | Ga0207658_10082664 | 3300025986 | Bacteria | 2467 |
| 133 | Ga0207658_10303303 | 3300025986 | Bacteria | 1377 |
| 134 | Ga0207677_10399460 | 3300026023 | Bacteria | 1165 |
| 135 | Ga0207639_10063553 | 3300026041 | Bacteria | 2859 |
| 136 | Ga0207639_10254828 | 3300026041 | Bacteria | 1532 |
| 137 | Ga0207678_10175440 | 3300026067 | Bacteria | 1830 |
| 138 | Ga0207641_10020142 | 3300026088 | Bacteria | 5476 |
| 139 | Ga0207641_10242709 | 3300026088 | Bacteria | 1679 |
| 140 | Ga0207648_10028033 | 3300026089 | Bacteria | 4996 |
| 141 | Ga0207648_10040725 | 3300026089 | Bacteria | 4081 |
| 142 | Ga0207648_10224167 | 3300026089 | Bacteria | 1671 |
| 143 | Ga0207648_10391798 | 3300026089 | Bacteria | 1257 |
| 144 | Ga0207648_10623495 | 3300026089 | Bacteria | 995 |
| 145 | Ga0207674_10067384 | 3300026116 | Bacteria | 3604 |
| 146 | Ga0207675_100065365 | 3300026118 | Bacteria | 3400 |
| 147 | Ga0207675_100074919 | 3300026118 | Bacteria | 3167 |
| 148 | Ga0207675_100178576 | 3300026118 | Bacteria | 2032 |
| 149 | Ga0207683_10111808 | 3300026121 | Bacteria | 2446 |
| 150 | Ga0207683_10273707 | 3300026121 | Bacteria | 1543 |
| 151 | Ga0207698_10029096 | 3300026142 | Bacteria | 3951 |
| 152 | Ga0209998_10010003 | 3300027717 | Bacteria | 1965 |
| 153 | Ga0207428_10001843 | 3300027907 | Bacteria | 21667 |
| 154 | Ga0268265_10128517 | 3300028380 | Bacteria | 2101 |
| 155 | Ga0268265_10134268 | 3300028380 | Bacteria | 2062 |
| 156 | Ga0307515_10015833 | 3300028794 | Bacteria | 13863 |
| 157 | Ga0307515_10021806 | 3300028794 | Bacteria | 11332 |
| 158 | Ga0265338_10066009 | 3300028800 | Bacteria | 3135 |
| 159 | Ga0307512_10148324 | 3300030522 | Bacteria | 1411 |
| 160 | Ga0316183_1087709 | 3300030742 | Bacteria | 6762 |
| 161 | Ga0265330_10025205 | 3300031235 | Bacteria | 2696 |
| 162 | Ga0265332_10003009 | 3300031238 | Bacteria | 8269 |
| 163 | Ga0307513_10031475 | 3300031456 | Bacteria | 6006 |
| 164 | Ga0307513_10055370 | 3300031456 | Bacteria | 4245 |
| 165 | Ga0307513_10282075 | 3300031456 | Bacteria | 1438 |
| 166 | Ga0307509_10003989 | 3300031507 | Bacteria | 21735 |
| 167 | Ga0307509_10510374 | 3300031507 | Bacteria | 885 |
| 168 | Ga0307408_100080596 | 3300031548 | Bacteria | 2432 |
| 169 | Ga0265314_10008127 | 3300031711 | Bacteria | 9029 |
| 170 | Ga0265314_10039466 | 3300031711 | Bacteria | 3400 |
| 171 | Ga0265342_10044894 | 3300031712 | Bacteria | 2662 |
| 172 | Ga0265342_10046263 | 3300031712 | Bacteria | 2616 |
| 173 | Ga0307516_10000610 | 3300031730 | Bacteria | 48458 |
| 174 | Ga0307405_10000546 | 3300031731 | Bacteria | 14301 |
| 175 | Ga0307405_10081589 | 3300031731 | Bacteria | 2114 |
| 176 | Ga0307405_10372222 | 3300031731 | Bacteria | 1109 |
| 177 | Ga0307413_10021474 | 3300031824 | Bacteria | 3459 |
| 178 | Ga0307410_10021858 | 3300031852 | Bacteria | 3942 |
| 179 | Ga0307410_10048098 | 3300031852 | Bacteria | 2854 |
| 180 | Ga0307410_10169438 | 3300031852 | Bacteria | 1644 |
| 181 | Ga0307407_10007455 | 3300031903 | Bacteria | 4957 |
| 182 | Ga0307412_10004957 | 3300031911 | Bacteria | 7439 |
| 183 | Ga0307409_100087059 | 3300031995 | Bacteria | 2544 |
| 184 | Ga0307409_100092124 | 3300031995 | Bacteria | 2486 |
| 185 | Ga0307409_100361126 | 3300031995 | Bacteria | 1374 |
| 186 | Ga0307416_100019723 | 3300032002 | Bacteria | 4789 |
| 187 | Ga0307414_10011513 | 3300032004 | Bacteria | 5192 |
| 188 | Ga0307510_10001144 | 3300033180 | Bacteria | 28515 |
| 189 | Ga0307510_10246557 | 3300033180 | Bacteria | 1277 |
| 190 | Ga0373923_0158662 | 3300035111 | Unclassified | 1031 |
| 191 | Ga0373936_0141282 | 3300035113 | Bacteria | 1040 |
| 192 | Ga0373945_0115942 | 3300035116 | Unclassified | 1061 |
| 193 | Ga0373956_0053162 | 3300035119 | Bacteria | 1823 |
| 194 | Ga0373955_0008292 | 3300035172 | Bacteria | 4820 |
| 195 | Ga0373955_0233291 | 3300035172 | Bacteria | 1101 |
| 196 | Ga0373927_0150819 | 3300035695 | Bacteria | 1522 |
| 197 | Ga0373933_0065556 | 3300035724 | Bacteria | 2199 |
| 198 | Ga0373937_0004955 | 3300036401 | Bacteria | 11321 |
| 199 | Ga0373937_0059129 | 3300036401 | Bacteria | 3522 |
| 200 | Ga0373937_0400700 | 3300036401 | Bacteria | 1302 |
| 201 | Ga0373925_0459602 | 3300037068 | Bacteria | 1043 |
| 202 | Ga0395900_0246212 | 3300037418 | Bacteria | 1791 |
| 203 | Ga0395898_0758983 | 3300037466 | Bacteria | 911 |
| 204 | Ga0395905_0183988 | 3300037471 | Bacteria | 1961 |
| 205 | Ga0439453_0018061 | 3300041408 | Bacteria | 1244 |
| 206 | Ga0439461_0008378 | 3300041410 | Bacteria | 1851 |
| 207 | Ga0450923_003369 | 3300042125 | Bacteria | 2405 |
| 208 | Ga0450908_007105 | 3300042184 | Bacteria | 2115 |
| 209 | Ga0439434_0012810 | 3300042435 | Bacteria | 2485 |
| 210 | Ga0439435_0060541 | 3300042436 | Bacteria | 1102 |
| 211 | Ga0439444_0003707 | 3300042437 | Bacteria | 2175 |
| 212 | Ga0495592_0006307 | 3300046454 | Bacteria | 8825 |
| 213 | Ga0495638_0007350 | 3300046460 | Bacteria | 7907 |
| 214 | Ga0495606_0166895 | 3300046507 | Bacteria | 1280 |
| 215 | Ga0495616_0000360 | 3300046513 | Bacteria | 35740 |
| 216 | Ga0495616_0077708 | 3300046513 | Bacteria | 1593 |
| 217 | Ga0495620_0093133 | 3300046515 | Bacteria | 1207 |
| 218 | Ga0495637_0004619 | 3300046520 | Bacteria | 7111 |
| 219 | Ga0495597_0000746 | 3300046542 | Bacteria | 25742 |
| 220 | Ga0495625_0053181 | 3300046660 | Bacteria | 2898 |
| 221 | Ga0495646_0237587 | 3300046680 | Bacteria | 980 |
| 222 | Ga0495671_0003435 | 3300046692 | Bacteria | 9731 |
| 223 | Ga0495589_0000641 | 3300046794 | Bacteria | 22902 |
| 224 | Ga0495680_0293569 | 3300047322 | Bacteria | 1143 |
| 225 | Ga0495687_000161 | 3300047443 | Bacteria | 100635 |
| 226 | Ga0495673_0000121 | 3300047469 | Bacteria | 144619 |
| 227 | Ga0496100_0096002 | 3300048903 | Bacteria | 2033 |
| 228 | Ga0496101_0200355 | 3300048904 | Bacteria | 1543 |
| 229 | Ga0496104_0030657 | 3300048907 | Bacteria | 4998 |
| 230 | Ga0496104_0053299 | 3300048907 | Bacteria | 3821 |
| 231 | Ga0496105_0015522 | 3300048908 | Bacteria | 6071 |
| 232 | Ga0496105_0407262 | 3300048908 | Bacteria | 1079 |
| 233 | Ga0496114_0004383 | 3300048917 | Bacteria | 10937 |
| 234 | Ga0496115_0001081 | 3300048918 | Bacteria | 19747 |
| 235 | Ga0496117_0120279 | 3300048920 | Bacteria | 1615 |
| 236 | Ga0496118_0089416 | 3300048921 | Bacteria | 2126 |
| 237 | Ga0496121_0007402 | 3300048924 | Bacteria | 13268 |
| 238 | Ga0501031_0089240 | 3300049568 | Bacteria | 2010 |
| 239 | Ga0501032_0003926 | 3300049569 | Bacteria | 11289 |
| 240 | Ga0501033_0004984 | 3300049570 | Bacteria | 10557 |
| 241 | Ga0501034_0000163 | 3300049571 | Bacteria | 125417 |
| 242 | Ga0501034_0418946 | 3300049571 | Bacteria | 1260 |
| 243 | Ga0501034_0460004 | 3300049571 | Bacteria | 1189 |
| 244 | Ga0501036_0012997 | 3300049572 | Bacteria | 6913 |
| 245 | Ga0501036_0598296 | 3300049572 | Unclassified | 915 |
| 246 | Ga0501037_0000124 | 3300049573 | Bacteria | 71522 |
| 247 | Ga0501039_0047476 | 3300049575 | Bacteria | 3319 |
| 248 | Ga0501039_0252044 | 3300049575 | Bacteria | 1388 |
| 249 | Ga0501040_0217314 | 3300049576 | Bacteria | 1360 |
| 250 | Ga0501041_0061681 | 3300049577 | Bacteria | 2295 |
| 251 | Ga0501041_0325113 | 3300049577 | Bacteria | 970 |
| 252 | Ga0501043_0000003 | 3300049579 | Bacteria | 318844 |
| 253 | Ga0501047_0009205 | 3300049581 | Bacteria | 9323 |
| 254 | Ga0501047_0059028 | 3300049581 | Bacteria | 3705 |
| 255 | Ga0501067_0006251 | 3300049583 | Bacteria | 6606 |
| 256 | Ga0501067_0023177 | 3300049583 | Bacteria | 3439 |
| 257 | Ga0501068_0000771 | 3300049584 | Bacteria | 16509 |
| 258 | Ga0501068_0027347 | 3300049584 | Bacteria | 3367 |
| 259 | Ga0501068_0054843 | 3300049584 | Bacteria | 2415 |
| 260 | Ga0501069_0000003 | 3300049585 | Bacteria | 210301 |
| 261 | Ga0501070_0001085 | 3300049586 | Bacteria | 24426 |
| 262 | Ga0501070_0080719 | 3300049586 | Bacteria | 2691 |
| 263 | Ga0501072_0107947 | 3300049588 | Bacteria | 2214 |
| 264 | Ga0501072_0154334 | 3300049588 | Bacteria | 1831 |
| 265 | Ga0501073_0002694 | 3300049589 | Bacteria | 13298 |
| 266 | Ga0501073_0013427 | 3300049589 | Bacteria | 5957 |
| 267 | Ga0501074_0000007 | 3300049590 | Bacteria | 111136 |
| 268 | Ga0501074_0011200 | 3300049590 | Bacteria | 6514 |
| 269 | Ga0501075_0034461 | 3300049591 | Bacteria | 3770 |
| 270 | Ga0501075_0116263 | 3300049591 | Bacteria | 2033 |
| 271 | Ga0501075_0380521 | 3300049591 | Bacteria | 1076 |
| 272 | Ga0501076_0148512 | 3300049592 | Bacteria | 1906 |
| 273 | Ga0501077_0038985 | 3300049593 | Bacteria | 3025 |
| 274 | Ga0501077_0052603 | 3300049593 | Bacteria | 2586 |
| 275 | Ga0501079_0000016 | 3300049741 | Bacteria | 65975 |
| 276 | Ga0501079_0047072 | 3300049741 | Bacteria | 3328 |
| 277 | Ga0501079_0061817 | 3300049741 | Bacteria | 2889 |
| 278 | Ga0501079_0087194 | 3300049741 | Bacteria | 2416 |
| 279 | Ga0501079_0124639 | 3300049741 | Bacteria | 2004 |
| 280 | Ga0501079_0400129 | 3300049741 | Bacteria | 1077 |
| 281 | Ga0501080_0000319 | 3300049742 | Bacteria | 36724 |
| 282 | Ga0501080_0000365 | 3300049742 | Bacteria | 34986 |
| 283 | Ga0501081_0099332 | 3300049743 | Bacteria | 2056 |
| 284 | Ga0501081_0143470 | 3300049743 | Bacteria | 1712 |
| 285 | Ga0501081_0299104 | 3300049743 | Bacteria | 1180 |
| 286 | Ga0501083_0000024 | 3300049744 | Bacteria | 123029 |
| 287 | Ga0501083_0015178 | 3300049744 | Bacteria | 5393 |
| 288 | Ga0501035_0000941 | 3300049822 | Bacteria | 30729 |
| 289 | Ga0501044_0000016 | 3300049823 | Bacteria | 231626 |
| 290 | Ga0501044_0142247 | 3300049823 | Bacteria | 2387 |
| 291 | Ga0501045_0032868 | 3300049824 | Bacteria | 3760 |
| 292 | Ga0501045_0144564 | 3300049824 | Bacteria | 1769 |
| 293 | nmdc:mga03683_13458_c1 | 3300050489 | Bacteria | 3012 |
| 294 | nmdc:mga03683_24447_c1 | 3300050489 | Bacteria | 2364 |
| 295 | nmdc:mga03n38_237260_c1 | 3300050490 | Bacteria | 958 |
| 296 | nmdc:mga00v17_68670_c1 | 3300050491 | Bacteria | 2191 |
| 297 | nmdc:mga0k408_156430_c1 | 3300050493 | Bacteria | 1358 |
| 298 | nmdc:mga0k408_300724_c1 | 3300050493 | Bacteria | 958 |
| 299 | nmdc:mga0k408_9214_c1 | 3300050493 | Bacteria | 5318 |
| 300 | nmdc:mga06z11_48173_c1 | 3300050494 | Bacteria | 1376 |
| 301 | nmdc:mga07m45_56601_c1 | 3300050496 | Bacteria | 2216 |
| 302 | nmdc:mga09592_860_c1 | 3300050508 | Bacteria | 23700 |
| 303 | nmdc:mga0qj67_140588_c1 | 3300050509 | Bacteria | 1957 |
| 304 | nmdc:mga0qj67_96721_c1 | 3300050509 | Bacteria | 2377 |
| 305 | nmdc:mga06r32_45463_c1 | 3300050510 | Bacteria | 4185 |
| 306 | nmdc:mga06r32_842_c1 | 3300050510 | Bacteria | 27157 |
| 307 | nmdc:mga08y16_1802_c1 | 3300050511 | Bacteria | 21723 |
| 308 | nmdc:mga08y16_262925_c1 | 3300050511 | Bacteria | 1782 |
| 309 | nmdc:mga08y16_78728_c1 | 3300050511 | Bacteria | 3436 |
| 310 | nmdc:mga0sz30_36473_c1 | 3300050516 | Bacteria | 2055 |
| 311 | Ga0495619_0209838 | 3300053085 | Bacteria | 1349 |
| 312 | Ga0500651_0014652 | 3300053093 | Bacteria | 4800 |
| 313 | Ga0500651_0080866 | 3300053093 | Bacteria | 2012 |
| 314 | Ga0500559_0000020 | 3300053136 | Bacteria | 134858 |
| 315 | Ga0500564_056022 | 3300053138 | Bacteria | 1796 |
| 316 | Ga0500619_005185 | 3300053154 | Bacteria | 2880 |
| 317 | Ga0500622_0003341 | 3300053156 | Bacteria | 10815 |
| 318 | Ga0500587_001869 | 3300053739 | Bacteria | 3002 |
| 319 | Ga0501084_0089264 | 3300054114 | Bacteria | 2587 |
| 320 | Ga0501082_0024508 | 3300060353 | Bacteria | 5201 |
| 321 | Ga0501082_0090412 | 3300060353 | Bacteria | 2643 |
| 322 | Ga0530510_0143495 | 3300061734 | Bacteria | 1760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0407262 | Ga0496105_0407262_67_873 | 242 |
| 2 | 3300005438 | Ga0070701_10080301 | Ga0070701_100803012 | 246 |
| 3 | 3300048920 | Ga0496117_0120279 | Ga0496117_0120279_260_1006 | 246 |
| 4 | 3300048921 | Ga0496118_0089416 | Ga0496118_0089416_380_1126 | 246 |
| 5 | 3300028800 | Ga0265338_10066009 | Ga0265338_100660092 | 249 |
| 6 | 3300013104 | Ga0157370_10185772 | Ga0157370_101857722 | 255 |
| 7 | 3300005336 | Ga0070680_100112033 | Ga0070680_1001120332 | 260 |
| 8 | 3300005439 | Ga0070711_100091708 | Ga0070711_1000917082 | 260 |
| 9 | 3300013104 | Ga0157370_10087775 | Ga0157370_100877752 | 260 |
| 10 | 3300046513 | Ga0495616_0077708 | Ga0495616_0077708_244_1032 | 261 |
| 11 | iso_pu_bacteria | 2513237150 | 2513953321 | 261 |
| 12 | iso_pu_bacteria | 644736347 | 644746992 | 261 |
| 13 | 3300003320 | rootH2_10078893 | rootH2_100788932 | 262 |
| 14 | 3300005436 | Ga0070713_100263731 | Ga0070713_1002637312 | 262 |
| 15 | 3300005535 | Ga0070684_100271017 | Ga0070684_1002710172 | 262 |
| 16 | 3300035119 | Ga0373956_0053162 | Ga0373956_0053162_818_1606 | 262 |
| 17 | 3300035172 | Ga0373955_0008292 | Ga0373955_0008292_3899_4687 | 262 |
| 18 | 3300035695 | Ga0373927_0150819 | Ga0373927_0150819_259_1047 | 262 |
| 19 | 3300036401 | Ga0373937_0004955 | Ga0373937_0004955_8168_8956 | 262 |
| 20 | 3300037418 | Ga0395900_0246212 | Ga0395900_0246212_429_1220 | 262 |
| 21 | 3300037466 | Ga0395898_0758983 | Ga0395898_0758983_29_820 | 262 |
| 22 | 3300037471 | Ga0395905_0183988 | Ga0395905_0183988_743_1534 | 262 |
| 23 | 3300049571 | Ga0501034_0000163 | Ga0501034_0000163_109084_109881 | 262 |
| 24 | 3300050496 | nmdc:mga07m45_56601_c1 | nmdc:mga07m45_56601_c1_488_1315 | 262 |
| 25 | iso_pu_bacteria | 2858688981 | 2858697682 | 262 |
| 26 | 3300031235 | Ga0265330_10025205 | Ga0265330_100252052 | 263 |
| 27 | 3300031238 | Ga0265332_10003009 | Ga0265332_100030099 | 263 |
| 28 | 3300031711 | Ga0265314_10008127 | Ga0265314_100081275 | 263 |
| 29 | 3300031712 | Ga0265342_10046263 | Ga0265342_100462632 | 263 |
| 30 | 3300006178 | Ga0075367_10214765 | Ga0075367_102147652 | 264 |
| 31 | 3300006195 | Ga0075366_10029548 | Ga0075366_100295483 | 264 |
| 32 | 3300050493 | nmdc:mga0k408_300724_c1 | nmdc:mga0k408_300724_c1_11_814 | 264 |
| 33 | iso_pu_bacteria | 2512047030 | 2512352740 | 264 |
| 34 | iso_pu_bacteria | 2738543013 | 2739252369 | 264 |
| 35 | iso_pu_bacteria | 2881412998 | 2881415665 | 264 |
| 36 | iso_pu_bacteria | 2904449895 | 2904453726 | 264 |
| 37 | iso_pu_bacteria | 2904456579 | 2904458970 | 264 |
| 38 | iso_pu_bacteria | 2919704043 | 2919707788 | 264 |
| 39 | iso_pu_bacteria | 2945972063 | 2945972633 | 264 |
| 40 | 3300028380 | Ga0268265_10128517 | Ga0268265_101285172 | 265 |
| 41 | 3300046520 | Ga0495637_0004619 | Ga0495637_0004619_3643_4542 | 265 |
| 42 | 3300047469 | Ga0495673_0000121 | Ga0495673_0000121_108326_109246 | 265 |
| 43 | 3300049581 | Ga0501047_0009205 | Ga0501047_0009205_7607_8500 | 265 |
| 44 | 3300005367 | Ga0070667_100546635 | Ga0070667_1005466352 | 266 |
| 45 | 3300009148 | Ga0105243_10049972 | Ga0105243_100499722 | 266 |
| 46 | 3300025935 | Ga0207709_10028524 | Ga0207709_100285242 | 266 |
| 47 | 3300025986 | Ga0207658_10082664 | Ga0207658_100826643 | 266 |
| 48 | 3300026089 | Ga0207648_10391798 | Ga0207648_103917982 | 266 |
| 49 | 3300036401 | Ga0373937_0400700 | Ga0373937_0400700_165_965 | 266 |
| 50 | 3300041408 | Ga0439453_0018061 | Ga0439453_0018061_294_1094 | 266 |
| 51 | 3300048924 | Ga0496121_0007402 | Ga0496121_0007402_3986_4786 | 266 |
| 52 | 3300005334 | Ga0068869_100307561 | Ga0068869_1003075611 | 267 |
| 53 | 3300005340 | Ga0070689_100089541 | Ga0070689_1000895413 | 267 |
| 54 | 3300005353 | Ga0070669_100063292 | Ga0070669_1000632922 | 267 |
| 55 | 3300005354 | Ga0070675_100072215 | Ga0070675_1000722152 | 267 |
| 56 | 3300005356 | Ga0070674_100269895 | Ga0070674_1002698951 | 267 |
| 57 | 3300005365 | Ga0070688_100141490 | Ga0070688_1001414902 | 267 |
| 58 | 3300005438 | Ga0070701_10022995 | Ga0070701_100229953 | 267 |
| 59 | 3300005457 | Ga0070662_100164818 | Ga0070662_1001648182 | 267 |
| 60 | 3300005466 | Ga0070685_10276924 | Ga0070685_102769241 | 267 |
| 61 | 3300005466 | Ga0070685_10351567 | Ga0070685_103515671 | 267 |
| 62 | 3300005543 | Ga0070672_100056228 | Ga0070672_1000562282 | 267 |
| 63 | 3300005548 | Ga0070665_100012754 | Ga0070665_1000127543 | 267 |
| 64 | 3300005564 | Ga0070664_100077187 | Ga0070664_1000771871 | 267 |
| 65 | 3300005617 | Ga0068859_100121470 | Ga0068859_1001214703 | 267 |
| 66 | 3300005618 | Ga0068864_100197009 | Ga0068864_1001970092 | 267 |
| 67 | 3300005719 | Ga0068861_100101387 | Ga0068861_1001013871 | 267 |
| 68 | 3300005841 | Ga0068863_100044210 | Ga0068863_1000442103 | 267 |
| 69 | 3300006237 | Ga0097621_100005591 | Ga0097621_1000055913 | 267 |
| 70 | 3300006358 | Ga0068871_100029884 | Ga0068871_1000298844 | 267 |
| 71 | 3300006844 | Ga0075428_100007405 | Ga0075428_1000074054 | 267 |
| 72 | 3300006844 | Ga0075428_100021183 | Ga0075428_1000211832 | 267 |
| 73 | 3300006846 | Ga0075430_100103756 | Ga0075430_1001037562 | 267 |
| 74 | 3300006846 | Ga0075430_100167025 | Ga0075430_1001670252 | 267 |
| 75 | 3300006847 | Ga0075431_100000011 | Ga0075431_10000001175 | 267 |
| 76 | 3300006847 | Ga0075431_100071016 | Ga0075431_1000710163 | 267 |
| 77 | 3300006880 | Ga0075429_100005334 | Ga0075429_1000053343 | 267 |
| 78 | 3300006931 | Ga0097620_100121468 | Ga0097620_1001214683 | 267 |
| 79 | 3300009094 | Ga0111539_10003199 | Ga0111539_100031992 | 267 |
| 80 | 3300009094 | Ga0111539_11069777 | Ga0111539_110697771 | 267 |
| 81 | 3300009148 | Ga0105243_10172539 | Ga0105243_101725392 | 267 |
| 82 | 3300013308 | Ga0157375_10462760 | Ga0157375_104627601 | 267 |
| 83 | 3300014325 | Ga0163163_10010812 | Ga0163163_100108125 | 267 |
| 84 | 3300014326 | Ga0157380_10001615 | Ga0157380_1000161510 | 267 |
| 85 | 3300014326 | Ga0157380_10019159 | Ga0157380_100191596 | 267 |
| 86 | 3300014326 | Ga0157380_10030838 | Ga0157380_100308385 | 267 |
| 87 | 3300014969 | Ga0157376_11020016 | Ga0157376_110200161 | 267 |
| 88 | 3300025920 | Ga0207649_10303894 | Ga0207649_103038941 | 267 |
| 89 | 3300025925 | Ga0207650_10086490 | Ga0207650_100864902 | 267 |
| 90 | 3300025933 | Ga0207706_10063806 | Ga0207706_100638063 | 267 |
| 91 | 3300025937 | Ga0207669_10247069 | Ga0207669_102470692 | 267 |
| 92 | 3300025940 | Ga0207691_10041143 | Ga0207691_100411433 | 267 |
| 93 | 3300025942 | Ga0207689_10170093 | Ga0207689_101700932 | 267 |
| 94 | 3300025942 | Ga0207689_10365322 | Ga0207689_103653222 | 267 |
| 95 | 3300025945 | Ga0207679_10130970 | Ga0207679_101309702 | 267 |
| 96 | 3300025960 | Ga0207651_10101092 | Ga0207651_101010923 | 267 |
| 97 | 3300026088 | Ga0207641_10020142 | Ga0207641_100201423 | 267 |
| 98 | 3300026089 | Ga0207648_10028033 | Ga0207648_100280334 | 267 |
| 99 | 3300026118 | Ga0207675_100065365 | Ga0207675_1000653653 | 267 |
| 100 | 3300026118 | Ga0207675_100178576 | Ga0207675_1001785762 | 267 |
| 101 | 3300027717 | Ga0209998_10010003 | Ga0209998_100100032 | 267 |
| 102 | 3300027907 | Ga0207428_10001843 | Ga0207428_100018432 | 267 |
| 103 | 3300031456 | Ga0307513_10031475 | Ga0307513_100314754 | 267 |
| 104 | 3300031548 | Ga0307408_100080596 | Ga0307408_1000805963 | 267 |
| 105 | 3300031711 | Ga0265314_10039466 | Ga0265314_100394662 | 267 |
| 106 | 3300031712 | Ga0265342_10044894 | Ga0265342_100448942 | 267 |
| 107 | 3300031731 | Ga0307405_10081589 | Ga0307405_100815892 | 267 |
| 108 | 3300031731 | Ga0307405_10372222 | Ga0307405_103722222 | 267 |
| 109 | 3300031852 | Ga0307410_10048098 | Ga0307410_100480983 | 267 |
| 110 | 3300031903 | Ga0307407_10007455 | Ga0307407_100074553 | 267 |
| 111 | 3300031995 | Ga0307409_100092124 | Ga0307409_1000921242 | 267 |
| 112 | 3300032002 | Ga0307416_100019723 | Ga0307416_1000197232 | 267 |
| 113 | 3300035724 | Ga0373933_0065556 | Ga0373933_0065556_608_1414 | 267 |
| 114 | 3300036401 | Ga0373937_0059129 | Ga0373937_0059129_859_1665 | 267 |
| 115 | 3300041410 | Ga0439461_0008378 | Ga0439461_0008378_514_1383 | 267 |
| 116 | 3300042125 | Ga0450923_003369 | Ga0450923_003369_1448_2251 | 267 |
| 117 | 3300042184 | Ga0450908_007105 | Ga0450908_007105_798_1601 | 267 |
| 118 | 3300042435 | Ga0439434_0012810 | Ga0439434_0012810_1524_2333 | 267 |
| 119 | 3300042436 | Ga0439435_0060541 | Ga0439435_0060541_22_828 | 267 |
| 120 | 3300042437 | Ga0439444_0003707 | Ga0439444_0003707_1098_1904 | 267 |
| 121 | 3300046460 | Ga0495638_0007350 | Ga0495638_0007350_6099_6980 | 267 |
| 122 | 3300046507 | Ga0495606_0166895 | Ga0495606_0166895_445_1248 | 267 |
| 123 | 3300046513 | Ga0495616_0000360 | Ga0495616_0000360_19864_20670 | 267 |
| 124 | 3300046542 | Ga0495597_0000746 | Ga0495597_0000746_10179_10982 | 267 |
| 125 | 3300046660 | Ga0495625_0053181 | Ga0495625_0053181_1581_2387 | 267 |
| 126 | 3300046692 | Ga0495671_0003435 | Ga0495671_0003435_6571_7416 | 267 |
| 127 | 3300046794 | Ga0495589_0000641 | Ga0495589_0000641_11431_12234 | 267 |
| 128 | 3300047322 | Ga0495680_0293569 | Ga0495680_0293569_314_1120 | 267 |
| 129 | 3300049568 | Ga0501031_0089240 | Ga0501031_0089240_1019_1891 | 267 |
| 130 | 3300049569 | Ga0501032_0003926 | Ga0501032_0003926_1560_2432 | 267 |
| 131 | 3300049570 | Ga0501033_0004984 | Ga0501033_0004984_7175_8047 | 267 |
| 132 | 3300049572 | Ga0501036_0012997 | Ga0501036_0012997_5571_6383 | 267 |
| 133 | 3300049572 | Ga0501036_0598296 | Ga0501036_0598296_51_857 | 267 |
| 134 | 3300049573 | Ga0501037_0000124 | Ga0501037_0000124_1276_2148 | 267 |
| 135 | 3300049575 | Ga0501039_0047476 | Ga0501039_0047476_1095_1907 | 267 |
| 136 | 3300049575 | Ga0501039_0252044 | Ga0501039_0252044_213_1016 | 267 |
| 137 | 3300049576 | Ga0501040_0217314 | Ga0501040_0217314_72_878 | 267 |
| 138 | 3300049577 | Ga0501041_0061681 | Ga0501041_0061681_1079_1891 | 267 |
| 139 | 3300049577 | Ga0501041_0325113 | Ga0501041_0325113_125_928 | 267 |
| 140 | 3300049579 | Ga0501043_0000003 | Ga0501043_0000003_53599_54471 | 267 |
| 141 | 3300049583 | Ga0501067_0006251 | Ga0501067_0006251_3452_4258 | 267 |
| 142 | 3300049583 | Ga0501067_0023177 | Ga0501067_0023177_2406_3212 | 267 |
| 143 | 3300049584 | Ga0501068_0000771 | Ga0501068_0000771_9592_10398 | 267 |
| 144 | 3300049584 | Ga0501068_0027347 | Ga0501068_0027347_2285_3091 | 267 |
| 145 | 3300049584 | Ga0501068_0054843 | Ga0501068_0054843_250_1062 | 267 |
| 146 | 3300049585 | Ga0501069_0000003 | Ga0501069_0000003_69174_70046 | 267 |
| 147 | 3300049586 | Ga0501070_0001085 | Ga0501070_0001085_10213_11085 | 267 |
| 148 | 3300049586 | Ga0501070_0080719 | Ga0501070_0080719_1342_2148 | 267 |
| 149 | 3300049588 | Ga0501072_0107947 | Ga0501072_0107947_585_1397 | 267 |
| 150 | 3300049588 | Ga0501072_0154334 | Ga0501072_0154334_321_1124 | 267 |
| 151 | 3300049589 | Ga0501073_0002694 | Ga0501073_0002694_1910_2716 | 267 |
| 152 | 3300049589 | Ga0501073_0013427 | Ga0501073_0013427_2162_3034 | 267 |
| 153 | 3300049590 | Ga0501074_0000007 | Ga0501074_0000007_52400_53272 | 267 |
| 154 | 3300049590 | Ga0501074_0011200 | Ga0501074_0011200_3263_4069 | 267 |
| 155 | 3300049591 | Ga0501075_0034461 | Ga0501075_0034461_420_1223 | 267 |
| 156 | 3300049591 | Ga0501075_0116263 | Ga0501075_0116263_1109_1921 | 267 |
| 157 | 3300049591 | Ga0501075_0380521 | Ga0501075_0380521_242_1048 | 267 |
| 158 | 3300049592 | Ga0501076_0148512 | Ga0501076_0148512_522_1325 | 267 |
| 159 | 3300049593 | Ga0501077_0038985 | Ga0501077_0038985_641_1453 | 267 |
| 160 | 3300049593 | Ga0501077_0052603 | Ga0501077_0052603_1086_1892 | 267 |
| 161 | 3300049741 | Ga0501079_0000016 | Ga0501079_0000016_50461_51267 | 267 |
| 162 | 3300049741 | Ga0501079_0047072 | Ga0501079_0047072_210_1013 | 267 |
| 163 | 3300049741 | Ga0501079_0061817 | Ga0501079_0061817_186_989 | 267 |
| 164 | 3300049741 | Ga0501079_0087194 | Ga0501079_0087194_756_1568 | 267 |
| 165 | 3300049741 | Ga0501079_0124639 | Ga0501079_0124639_282_1085 | 267 |
| 166 | 3300049741 | Ga0501079_0400129 | Ga0501079_0400129_240_1046 | 267 |
| 167 | 3300049742 | Ga0501080_0000319 | Ga0501080_0000319_1296_2102 | 267 |
| 168 | 3300049742 | Ga0501080_0000365 | Ga0501080_0000365_32164_33036 | 267 |
| 169 | 3300049743 | Ga0501081_0099332 | Ga0501081_0099332_987_1790 | 267 |
| 170 | 3300049743 | Ga0501081_0143470 | Ga0501081_0143470_97_900 | 267 |
| 171 | 3300049743 | Ga0501081_0299104 | Ga0501081_0299104_349_1155 | 267 |
| 172 | 3300049744 | Ga0501083_0000024 | Ga0501083_0000024_17130_18002 | 267 |
| 173 | 3300049744 | Ga0501083_0015178 | Ga0501083_0015178_2829_3635 | 267 |
| 174 | 3300049822 | Ga0501035_0000941 | Ga0501035_0000941_16703_17575 | 267 |
| 175 | 3300049823 | Ga0501044_0000016 | Ga0501044_0000016_69166_70038 | 267 |
| 176 | 3300049823 | Ga0501044_0142247 | Ga0501044_0142247_1548_2354 | 267 |
| 177 | 3300049824 | Ga0501045_0032868 | Ga0501045_0032868_761_1573 | 267 |
| 178 | 3300050508 | nmdc:mga09592_860_c1 | nmdc:mga09592_860_c1_14519_15325 | 267 |
| 179 | 3300050509 | nmdc:mga0qj67_140588_c1 | nmdc:mga0qj67_140588_c1_532_1338 | 267 |
| 180 | 3300050509 | nmdc:mga0qj67_96721_c1 | nmdc:mga0qj67_96721_c1_816_1622 | 267 |
| 181 | 3300050510 | nmdc:mga06r32_45463_c1 | nmdc:mga06r32_45463_c1_864_1670 | 267 |
| 182 | 3300050510 | nmdc:mga06r32_842_c1 | nmdc:mga06r32_842_c1_25725_26531 | 267 |
| 183 | 3300050511 | nmdc:mga08y16_1802_c1 | nmdc:mga08y16_1802_c1_19782_20588 | 267 |
| 184 | 3300050511 | nmdc:mga08y16_262925_c1 | nmdc:mga08y16_262925_c1_19_825 | 267 |
| 185 | 3300050511 | nmdc:mga08y16_78728_c1 | nmdc:mga08y16_78728_c1_2397_3203 | 267 |
| 186 | 3300060353 | Ga0501082_0024508 | Ga0501082_0024508_1459_2331 | 267 |
| 187 | 3300060353 | Ga0501082_0090412 | Ga0501082_0090412_1032_1844 | 267 |
| 188 | 3300061734 | Ga0530510_0143495 | Ga0530510_0143495_916_1719 | 267 |
| 189 | 3300003187 | JGI25151J46595_10000357 | JGI25151J46595_1000035735 | 268 |
| 190 | 3300003578 | Ga0006562J51391_1073707 | Ga0006562J51391_10737076 | 268 |
| 191 | 3300003578 | Ga0006562J51391_1073710 | Ga0006562J51391_10737103 | 268 |
| 192 | 3300003792 | Ga0055540_1000916 | Ga0055540_100091614 | 268 |
| 193 | 3300005331 | Ga0070670_100201893 | Ga0070670_1002018932 | 268 |
| 194 | 3300005334 | Ga0068869_100538534 | Ga0068869_1005385341 | 268 |
| 195 | 3300005337 | Ga0070682_100092181 | Ga0070682_1000921812 | 268 |
| 196 | 3300005338 | Ga0068868_100099220 | Ga0068868_1000992203 | 268 |
| 197 | 3300005338 | Ga0068868_100157441 | Ga0068868_1001574411 | 268 |
| 198 | 3300005344 | Ga0070661_100253436 | Ga0070661_1002534361 | 268 |
| 199 | 3300005353 | Ga0070669_100021314 | Ga0070669_1000213144 | 268 |
| 200 | 3300005354 | Ga0070675_100103738 | Ga0070675_1001037382 | 268 |
| 201 | 3300005356 | Ga0070674_100064659 | Ga0070674_1000646593 | 268 |
| 202 | 3300005366 | Ga0070659_100206197 | Ga0070659_1002061972 | 268 |
| 203 | 3300005367 | Ga0070667_100004212 | Ga0070667_10000421211 | 268 |
| 204 | 3300005367 | Ga0070667_100183054 | Ga0070667_1001830542 | 268 |
| 205 | 3300005367 | Ga0070667_100256171 | Ga0070667_1002561711 | 268 |
| 206 | 3300005435 | Ga0070714_100124674 | Ga0070714_1001246742 | 268 |
| 207 | 3300005436 | Ga0070713_100100429 | Ga0070713_1001004293 | 268 |
| 208 | 3300005438 | Ga0070701_10265030 | Ga0070701_102650301 | 268 |
| 209 | 3300005439 | Ga0070711_100207604 | Ga0070711_1002076041 | 268 |
| 210 | 3300005456 | Ga0070678_100094008 | Ga0070678_1000940082 | 268 |
| 211 | 3300005457 | Ga0070662_100058506 | Ga0070662_1000585062 | 268 |
| 212 | 3300005458 | Ga0070681_10010823 | Ga0070681_100108233 | 268 |
| 213 | 3300005459 | Ga0068867_100048172 | Ga0068867_1000481722 | 268 |
| 214 | 3300005459 | Ga0068867_100155594 | Ga0068867_1001555942 | 268 |
| 215 | 3300005466 | Ga0070685_10060970 | Ga0070685_100609702 | 268 |
| 216 | 3300005539 | Ga0068853_100396182 | Ga0068853_1003961821 | 268 |
| 217 | 3300005543 | Ga0070672_100017856 | Ga0070672_1000178562 | 268 |
| 218 | 3300005545 | Ga0070695_100004700 | Ga0070695_1000047005 | 268 |
| 219 | 3300005548 | Ga0070665_100046891 | Ga0070665_1000468914 | 268 |
| 220 | 3300005577 | Ga0068857_100090709 | Ga0068857_1000907092 | 268 |
| 221 | 3300005616 | Ga0068852_100642086 | Ga0068852_1006420861 | 268 |
| 222 | 3300005617 | Ga0068859_100599280 | Ga0068859_1005992802 | 268 |
| 223 | 3300005719 | Ga0068861_100321438 | Ga0068861_1003214382 | 268 |
| 224 | 3300005834 | Ga0068851_10013540 | Ga0068851_100135403 | 268 |
| 225 | 3300005842 | Ga0068858_100073119 | Ga0068858_1000731192 | 268 |
| 226 | 3300006048 | Ga0075363_100116778 | Ga0075363_1001167782 | 268 |
| 227 | 3300006051 | Ga0075364_10044509 | Ga0075364_100445092 | 268 |
| 228 | 3300006177 | Ga0075362_10000661 | Ga0075362_1000066111 | 268 |
| 229 | 3300006177 | Ga0075362_10037973 | Ga0075362_100379732 | 268 |
| 230 | 3300006186 | Ga0075369_10033499 | Ga0075369_100334993 | 268 |
| 231 | 3300006195 | Ga0075366_10031251 | Ga0075366_100312513 | 268 |
| 232 | 3300006353 | Ga0075370_10066063 | Ga0075370_100660633 | 268 |
| 233 | 3300006931 | Ga0097620_100599306 | Ga0097620_1005993061 | 268 |
| 234 | 3300009093 | Ga0105240_10087784 | Ga0105240_100877844 | 268 |
| 235 | 3300009176 | Ga0105242_10777702 | Ga0105242_107777021 | 268 |
| 236 | 3300009545 | Ga0105237_10012264 | Ga0105237_100122642 | 268 |
| 237 | 3300013306 | Ga0163162_10205042 | Ga0163162_102050422 | 268 |
| 238 | 3300013307 | Ga0157372_10079362 | Ga0157372_100793622 | 268 |
| 239 | 3300013308 | Ga0157375_10027539 | Ga0157375_100275392 | 268 |
| 240 | 3300014325 | Ga0163163_10008641 | Ga0163163_100086412 | 268 |
| 241 | 3300014326 | Ga0157380_10248455 | Ga0157380_102484552 | 268 |
| 242 | 3300014968 | Ga0157379_10020265 | Ga0157379_100202657 | 268 |
| 243 | 3300014968 | Ga0157379_10370862 | Ga0157379_103708621 | 268 |
| 244 | 3300025294 | Ga0209025_1000003 | Ga0209025_1000003998 | 268 |
| 245 | 3300025303 | Ga0209051_1000355 | Ga0209051_100035524 | 268 |
| 246 | 3300025901 | Ga0207688_10010941 | Ga0207688_100109413 | 268 |
| 247 | 3300025903 | Ga0207680_10284565 | Ga0207680_102845651 | 268 |
| 248 | 3300025912 | Ga0207707_10049023 | Ga0207707_100490233 | 268 |
| 249 | 3300025913 | Ga0207695_10221924 | Ga0207695_102219241 | 268 |
| 250 | 3300025914 | Ga0207671_10024511 | Ga0207671_100245114 | 268 |
| 251 | 3300025916 | Ga0207663_10091261 | Ga0207663_100912612 | 268 |
| 252 | 3300025920 | Ga0207649_10455509 | Ga0207649_104555091 | 268 |
| 253 | 3300025925 | Ga0207650_10398913 | Ga0207650_103989131 | 268 |
| 254 | 3300025928 | Ga0207700_10112096 | Ga0207700_101120963 | 268 |
| 255 | 3300025932 | Ga0207690_10049559 | Ga0207690_100495592 | 268 |
| 256 | 3300025933 | Ga0207706_10021921 | Ga0207706_100219213 | 268 |
| 257 | 3300025933 | Ga0207706_10111765 | Ga0207706_101117653 | 268 |
| 258 | 3300025937 | Ga0207669_10036203 | Ga0207669_100362032 | 268 |
| 259 | 3300025940 | Ga0207691_10025164 | Ga0207691_100251645 | 268 |
| 260 | 3300025942 | Ga0207689_10140094 | Ga0207689_101400942 | 268 |
| 261 | 3300025986 | Ga0207658_10010187 | Ga0207658_100101873 | 268 |
| 262 | 3300025986 | Ga0207658_10303303 | Ga0207658_103033032 | 268 |
| 263 | 3300026023 | Ga0207677_10399460 | Ga0207677_103994601 | 268 |
| 264 | 3300026041 | Ga0207639_10063553 | Ga0207639_100635532 | 268 |
| 265 | 3300026041 | Ga0207639_10254828 | Ga0207639_102548281 | 268 |
| 266 | 3300026067 | Ga0207678_10175440 | Ga0207678_101754402 | 268 |
| 267 | 3300026088 | Ga0207641_10242709 | Ga0207641_102427091 | 268 |
| 268 | 3300026089 | Ga0207648_10040725 | Ga0207648_100407253 | 268 |
| 269 | 3300026089 | Ga0207648_10224167 | Ga0207648_102241672 | 268 |
| 270 | 3300026089 | Ga0207648_10623495 | Ga0207648_106234952 | 268 |
| 271 | 3300026116 | Ga0207674_10067384 | Ga0207674_100673843 | 268 |
| 272 | 3300026118 | Ga0207675_100074919 | Ga0207675_1000749193 | 268 |
| 273 | 3300026121 | Ga0207683_10111808 | Ga0207683_101118082 | 268 |
| 274 | 3300026121 | Ga0207683_10273707 | Ga0207683_102737072 | 268 |
| 275 | 3300026142 | Ga0207698_10029096 | Ga0207698_100290963 | 268 |
| 276 | 3300028380 | Ga0268265_10134268 | Ga0268265_101342681 | 268 |
| 277 | 3300028794 | Ga0307515_10015833 | Ga0307515_1001583314 | 268 |
| 278 | 3300028794 | Ga0307515_10021806 | Ga0307515_100218068 | 268 |
| 279 | 3300030522 | Ga0307512_10148324 | Ga0307512_101483242 | 268 |
| 280 | 3300030742 | Ga0316183_1087709 | Ga0316183_10877092 | 268 |
| 281 | 3300031456 | Ga0307513_10055370 | Ga0307513_100553702 | 268 |
| 282 | 3300031456 | Ga0307513_10282075 | Ga0307513_102820752 | 268 |
| 283 | 3300031507 | Ga0307509_10003989 | Ga0307509_100039897 | 268 |
| 284 | 3300031507 | Ga0307509_10510374 | Ga0307509_105103741 | 268 |
| 285 | 3300031730 | Ga0307516_10000610 | Ga0307516_100006109 | 268 |
| 286 | 3300031731 | Ga0307405_10000546 | Ga0307405_1000054610 | 268 |
| 287 | 3300031824 | Ga0307413_10021474 | Ga0307413_100214742 | 268 |
| 288 | 3300031852 | Ga0307410_10021858 | Ga0307410_100218584 | 268 |
| 289 | 3300031852 | Ga0307410_10169438 | Ga0307410_101694382 | 268 |
| 290 | 3300031911 | Ga0307412_10004957 | Ga0307412_100049572 | 268 |
| 291 | 3300031995 | Ga0307409_100087059 | Ga0307409_1000870592 | 268 |
| 292 | 3300031995 | Ga0307409_100361126 | Ga0307409_1003611262 | 268 |
| 293 | 3300032004 | Ga0307414_10011513 | Ga0307414_100115135 | 268 |
| 294 | 3300033180 | Ga0307510_10001144 | Ga0307510_1000114429 | 268 |
| 295 | 3300033180 | Ga0307510_10246557 | Ga0307510_102465572 | 268 |
| 296 | 3300035111 | Ga0373923_0158662 | Ga0373923_0158662_168_977 | 268 |
| 297 | 3300035113 | Ga0373936_0141282 | Ga0373936_0141282_46_855 | 268 |
| 298 | 3300035116 | Ga0373945_0115942 | Ga0373945_0115942_64_873 | 268 |
| 299 | 3300035172 | Ga0373955_0233291 | Ga0373955_0233291_25_834 | 268 |
| 300 | 3300037068 | Ga0373925_0459602 | Ga0373925_0459602_153_962 | 268 |
| 301 | 3300046454 | Ga0495592_0006307 | Ga0495592_0006307_6871_7677 | 268 |
| 302 | 3300046515 | Ga0495620_0093133 | Ga0495620_0093133_21_827 | 268 |
| 303 | 3300046680 | Ga0495646_0237587 | Ga0495646_0237587_62_868 | 268 |
| 304 | 3300047443 | Ga0495687_000161 | Ga0495687_000161_31441_32247 | 268 |
| 305 | 3300048903 | Ga0496100_0096002 | Ga0496100_0096002_695_1504 | 268 |
| 306 | 3300048904 | Ga0496101_0200355 | Ga0496101_0200355_395_1204 | 268 |
| 307 | 3300048907 | Ga0496104_0030657 | Ga0496104_0030657_3716_4525 | 268 |
| 308 | 3300048907 | Ga0496104_0053299 | Ga0496104_0053299_17_826 | 268 |
| 309 | 3300048908 | Ga0496105_0015522 | Ga0496105_0015522_2939_3748 | 268 |
| 310 | 3300048917 | Ga0496114_0004383 | Ga0496114_0004383_8332_9141 | 268 |
| 311 | 3300048918 | Ga0496115_0001081 | Ga0496115_0001081_15499_16308 | 268 |
| 312 | 3300049571 | Ga0501034_0418946 | Ga0501034_0418946_113_925 | 268 |
| 313 | 3300049571 | Ga0501034_0460004 | Ga0501034_0460004_224_1033 | 268 |
| 314 | 3300049581 | Ga0501047_0059028 | Ga0501047_0059028_1704_2516 | 268 |
| 315 | 3300049824 | Ga0501045_0144564 | Ga0501045_0144564_858_1670 | 268 |
| 316 | 3300050489 | nmdc:mga03683_13458_c1 | nmdc:mga03683_13458_c1_2104_2910 | 268 |
| 317 | 3300050489 | nmdc:mga03683_24447_c1 | nmdc:mga03683_24447_c1_1087_1893 | 268 |
| 318 | 3300050490 | nmdc:mga03n38_237260_c1 | nmdc:mga03n38_237260_c1_78_884 | 268 |
| 319 | 3300050491 | nmdc:mga00v17_68670_c1 | nmdc:mga00v17_68670_c1_1102_1908 | 268 |
| 320 | 3300050493 | nmdc:mga0k408_156430_c1 | nmdc:mga0k408_156430_c1_439_1245 | 268 |
| 321 | 3300050493 | nmdc:mga0k408_9214_c1 | nmdc:mga0k408_9214_c1_676_1482 | 268 |
| 322 | 3300050494 | nmdc:mga06z11_48173_c1 | nmdc:mga06z11_48173_c1_343_1149 | 268 |
| 323 | 3300050516 | nmdc:mga0sz30_36473_c1 | nmdc:mga0sz30_36473_c1_716_1522 | 268 |
| 324 | 3300053085 | Ga0495619_0209838 | Ga0495619_0209838_160_969 | 268 |
| 325 | 3300053093 | Ga0500651_0014652 | Ga0500651_0014652_3133_3939 | 268 |
| 326 | 3300053093 | Ga0500651_0080866 | Ga0500651_0080866_895_1701 | 268 |
| 327 | 3300053136 | Ga0500559_0000020 | Ga0500559_0000020_103547_104353 | 268 |
| 328 | 3300053138 | Ga0500564_056022 | Ga0500564_056022_563_1369 | 268 |
| 329 | 3300053154 | Ga0500619_005185 | Ga0500619_005185_1813_2619 | 268 |
| 330 | 3300053156 | Ga0500622_0003341 | Ga0500622_0003341_5235_6041 | 268 |
| 331 | 3300053739 | Ga0500587_001869 | Ga0500587_001869_567_1373 | 268 |
| 332 | 3300054114 | Ga0501084_0089264 | Ga0501084_0089264_983_1792 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bol-assembly1.cif.gz_A | crystal structure of mutant 2-methylcitrate synthase mcsag419a from aspergillus fumigatus. | 0.8275 | 37 | 244 |
| 6hxp-assembly1.cif.gz_A | structure of citryl-coa lyase from hydrogenobacter thermophilus | 0.8191 | 8 | 265 |
| 2cts-assembly1.cif.gz_A-2 | crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution | 0.8167 | 35 | 244 |
| 8gr9-assembly1.cif.gz_A | crystal structure of peroxisomal citrate synthase (cit2) from saccharomyces cerevisiae in complex with oxaloacetate and coenzyme-a | 0.8152 | 36 | 244 |
| 6hxm-assembly1.cif.gz_B | structure of the citryl-coa lyase core module of human atp citrate lyase in complex with citrate and coash in space group c2221 | 0.8063 | 5 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I6U7_394_509_1.10.580.10 | Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 | 0.8339 | 108 | 212 | 1.10.580.10 |
| 1aj8B02 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 | 0.7692 | 107 | 210 | 1.10.230.10 |
| 2p2wA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 | 0.7614 | 107 | 209 | 1.10.230.10 |
| af_Q8I6U7_394_509_1.10.580.10 | Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 | 0.7583 | 108 | 212 | 1.10.580.10 |
| 1ixeD02 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 | 0.7534 | 107 | 209 | 1.10.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7FC13-F1-model_v4 | citrate synthase (unknown stereospecificity) (EC 2.3.3.16) | 0.9365 | 31 | 242 |
GO:0004108
GO:0005829 GO:0005975 GO:0006099 GO:0016829 |
| AF-A0A3S4RPE3-F1-model_v4 | citrate synthase (unknown stereospecificity) (EC 2.3.3.16) | 0.934 | 9 | 242 |
GO:0004108
GO:0005829 GO:0005975 GO:0006099 |
| AF-A0A4R7W3Z7-F1-model_v4 | Citrate synthase | 0.9336 | 5 | 96 |
GO:0046912
|
| AF-A0A494WFX7-F1-model_v4 | citrate synthase (unknown stereospecificity) (EC 2.3.3.16) | 0.9309 | 4 | 242 |
GO:0004108
GO:0005829 GO:0005975 GO:0006099 GO:0016829 |
| AF-A0A848Q153-F1-model_v4 | deleted | 0.9277 | 7 | 239 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar