F411069

General Info

Members Datasets Scaffolds Average Seq Length
332 221 322 269

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0004619|Ga0495637_0004619_3643_4542
Length 299
Sequence MIDVIDDNDEKSSFQYLIRCRYDEPIDTTGKPHVMKIGKETIPRSAISTSDEHSITVRGADLCRDLIGRLSFTDYFHLLVTGRRASAPAIAILDATLVAIAEHGLVPSVQASRMTLAAAPDALQGAVAAGILGCGSVILGASESAGRLFAEVDALAGAGGDLDAAALRVVRAYRAAKHAIPGYGHPLHKQRDPRVDALFAVARDQRIELRFIAIAEAVETAVAEVLGKPLKLNVSAAIPALLLGIGFPLAALKGVPILARAAGLIAHLTEEQERPIGFALSYQAARGLVYDGAAPDPQP

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2738543013 Variovorax sp. BT01 Isolate Unclassified
4 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
5 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
6 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
7 2904456579 Variovorax sp. 2002 Isolate Unclassified
8 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
9 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
215 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0.6
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.04
Nodule 0.9
Rhizoplane 2.41
Rhizosphere 81.02
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000357 3300003187 Bacteria 48666
2 rootH2_10078893 3300003320 Bacteria 1489
3 Ga0006562J51391_1073707 3300003578 Bacteria 7900
4 Ga0006562J51391_1073710 3300003578 Bacteria 4910
5 Ga0055540_1000916 3300003792 Bacteria 19242
6 Ga0070670_100201893 3300005331 Bacteria 1728
7 Ga0068869_100307561 3300005334 Bacteria 1282
8 Ga0068869_100538534 3300005334 Bacteria 979
9 Ga0070680_100112033 3300005336 Bacteria 2272
10 Ga0070682_100092181 3300005337 Bacteria 1984
11 Ga0068868_100099220 3300005338 Bacteria 2356
12 Ga0068868_100157441 3300005338 Bacteria 1874
13 Ga0070689_100089541 3300005340 Bacteria 2424
14 Ga0070661_100253436 3300005344 Bacteria 1359
15 Ga0070669_100021314 3300005353 Bacteria 4632
16 Ga0070669_100063292 3300005353 Bacteria 2723
17 Ga0070675_100072215 3300005354 Bacteria 2865
18 Ga0070675_100103738 3300005354 Bacteria 2398
19 Ga0070674_100064659 3300005356 Bacteria 2564
20 Ga0070674_100269895 3300005356 Bacteria 1344
21 Ga0070688_100141490 3300005365 Bacteria 1635
22 Ga0070659_100206197 3300005366 Bacteria 1619
23 Ga0070667_100004212 3300005367 Bacteria 12144
24 Ga0070667_100183054 3300005367 Bacteria 1853
25 Ga0070667_100256171 3300005367 Bacteria 1565
26 Ga0070667_100546635 3300005367 Bacteria 1064
27 Ga0070714_100124674 3300005435 Bacteria 2295
28 Ga0070713_100100429 3300005436 Bacteria 2505
29 Ga0070713_100263731 3300005436 Bacteria 1575
30 Ga0070701_10022995 3300005438 Bacteria 2996
31 Ga0070701_10080301 3300005438 Bacteria 1764
32 Ga0070701_10265030 3300005438 Bacteria 1043
33 Ga0070711_100091708 3300005439 Bacteria 2191
34 Ga0070711_100207604 3300005439 Unclassified 1515
35 Ga0070678_100094008 3300005456 Bacteria 2307
36 Ga0070662_100058506 3300005457 Bacteria 2805
37 Ga0070662_100164818 3300005457 Bacteria 1736
38 Ga0070681_10010823 3300005458 Bacteria 9016
39 Ga0068867_100048172 3300005459 Bacteria 3135
40 Ga0068867_100155594 3300005459 Bacteria 1799
41 Ga0070685_10060970 3300005466 Bacteria 2208
42 Ga0070685_10276924 3300005466 Bacteria 1122
43 Ga0070685_10351567 3300005466 Bacteria 1008
44 Ga0070684_100271017 3300005535 Bacteria 1554
45 Ga0068853_100396182 3300005539 Bacteria 1292
46 Ga0070672_100017856 3300005543 Bacteria 5115
47 Ga0070672_100056228 3300005543 Bacteria 3085
48 Ga0070695_100004700 3300005545 Bacteria 8034
49 Ga0070665_100012754 3300005548 Bacteria 8465
50 Ga0070665_100046891 3300005548 Bacteria 4338
51 Ga0070664_100077187 3300005564 Bacteria 2864
52 Ga0068857_100090709 3300005577 Bacteria 2735
53 Ga0068852_100642086 3300005616 Bacteria 1068
54 Ga0068859_100121470 3300005617 Bacteria 2679
55 Ga0068859_100599280 3300005617 Bacteria 1195
56 Ga0068864_100197009 3300005618 Bacteria 1849
57 Ga0068861_100101387 3300005719 Bacteria 2290
58 Ga0068861_100321438 3300005719 Bacteria 1348
59 Ga0068851_10013540 3300005834 Bacteria 3859
60 Ga0068863_100044210 3300005841 Bacteria 4228
61 Ga0068858_100073119 3300005842 Bacteria 3182
62 Ga0075363_100116778 3300006048 Bacteria 1487
63 Ga0075364_10044509 3300006051 Bacteria 2887
64 Ga0075362_10000661 3300006177 Bacteria 10159
65 Ga0075362_10037973 3300006177 Bacteria 2114
66 Ga0075367_10214765 3300006178 Bacteria 1203
67 Ga0075369_10033499 3300006186 Bacteria 2178
68 Ga0075366_10029548 3300006195 Bacteria 3220
69 Ga0075366_10031251 3300006195 Bacteria 3133
70 Ga0097621_100005591 3300006237 Bacteria 8862
71 Ga0075370_10066063 3300006353 Bacteria 2063
72 Ga0068871_100029884 3300006358 Bacteria 4285
73 Ga0075428_100007405 3300006844 Bacteria 12167
74 Ga0075428_100021183 3300006844 Bacteria 7198
75 Ga0075430_100103756 3300006846 Bacteria 2374
76 Ga0075430_100167025 3300006846 Bacteria 1831
77 Ga0075431_100000011 3300006847 Bacteria 95501
78 Ga0075431_100071016 3300006847 Bacteria 3592
79 Ga0075429_100005334 3300006880 Bacteria 11062
80 Ga0097620_100121468 3300006931 Bacteria 2679
81 Ga0097620_100599306 3300006931 Bacteria 1195
82 Ga0105240_10087784 3300009093 Bacteria 3807
83 Ga0111539_10003199 3300009094 Bacteria 21666
84 Ga0111539_11069777 3300009094 Bacteria 937
85 Ga0105243_10049972 3300009148 Bacteria 3302
86 Ga0105243_10172539 3300009148 Bacteria 1874
87 Ga0105242_10777702 3300009176 Bacteria 945
88 Ga0105237_10012264 3300009545 Bacteria 9034
89 Ga0157370_10087775 3300013104 Bacteria 2921
90 Ga0157370_10185772 3300013104 Bacteria 1930
91 Ga0163162_10205042 3300013306 Bacteria 2101
92 Ga0157372_10079362 3300013307 Bacteria 3712
93 Ga0157375_10027539 3300013308 Bacteria 5313
94 Ga0157375_10462760 3300013308 Bacteria 1434
95 Ga0163163_10008641 3300014325 Bacteria 9060
96 Ga0163163_10010812 3300014325 Bacteria 8239
97 Ga0157380_10001615 3300014326 Bacteria 14859
98 Ga0157380_10019159 3300014326 Bacteria 5097
99 Ga0157380_10030838 3300014326 Bacteria 4110
100 Ga0157380_10248455 3300014326 Bacteria 1609
101 Ga0157379_10020265 3300014968 Bacteria 5879
102 Ga0157379_10370862 3300014968 Bacteria 1312
103 Ga0157376_11020016 3300014969 Bacteria 851
104 Ga0209025_1000003 3300025294 Bacteria 1366495
105 Ga0209051_1000355 3300025303 Bacteria 67873
106 Ga0207688_10010941 3300025901 Bacteria 4937
107 Ga0207680_10284565 3300025903 Bacteria 1149
108 Ga0207707_10049023 3300025912 Bacteria 3680
109 Ga0207695_10221924 3300025913 Bacteria 1797
110 Ga0207671_10024511 3300025914 Bacteria 4534
111 Ga0207663_10091261 3300025916 Bacteria 2022
112 Ga0207649_10303894 3300025920 Bacteria 1167
113 Ga0207649_10455509 3300025920 Bacteria 966
114 Ga0207650_10086490 3300025925 Bacteria 2386
115 Ga0207650_10398913 3300025925 Bacteria 1138
116 Ga0207700_10112096 3300025928 Bacteria 2197
117 Ga0207690_10049559 3300025932 Bacteria 2801
118 Ga0207706_10021921 3300025933 Bacteria 5734
119 Ga0207706_10063806 3300025933 Bacteria 3243
120 Ga0207706_10111765 3300025933 Bacteria 2403
121 Ga0207709_10028524 3300025935 Bacteria 3227
122 Ga0207669_10036203 3300025937 Bacteria 2818
123 Ga0207669_10247069 3300025937 Bacteria 1326
124 Ga0207691_10025164 3300025940 Bacteria 5590
125 Ga0207691_10041143 3300025940 Bacteria 4268
126 Ga0207689_10140094 3300025942 Bacteria 1992
127 Ga0207689_10170093 3300025942 Bacteria 1796
128 Ga0207689_10365322 3300025942 Bacteria 1200
129 Ga0207679_10130970 3300025945 Bacteria 2012
130 Ga0207651_10101092 3300025960 Bacteria 2139
131 Ga0207658_10010187 3300025986 Bacteria 6388
132 Ga0207658_10082664 3300025986 Bacteria 2467
133 Ga0207658_10303303 3300025986 Bacteria 1377
134 Ga0207677_10399460 3300026023 Bacteria 1165
135 Ga0207639_10063553 3300026041 Bacteria 2859
136 Ga0207639_10254828 3300026041 Bacteria 1532
137 Ga0207678_10175440 3300026067 Bacteria 1830
138 Ga0207641_10020142 3300026088 Bacteria 5476
139 Ga0207641_10242709 3300026088 Bacteria 1679
140 Ga0207648_10028033 3300026089 Bacteria 4996
141 Ga0207648_10040725 3300026089 Bacteria 4081
142 Ga0207648_10224167 3300026089 Bacteria 1671
143 Ga0207648_10391798 3300026089 Bacteria 1257
144 Ga0207648_10623495 3300026089 Bacteria 995
145 Ga0207674_10067384 3300026116 Bacteria 3604
146 Ga0207675_100065365 3300026118 Bacteria 3400
147 Ga0207675_100074919 3300026118 Bacteria 3167
148 Ga0207675_100178576 3300026118 Bacteria 2032
149 Ga0207683_10111808 3300026121 Bacteria 2446
150 Ga0207683_10273707 3300026121 Bacteria 1543
151 Ga0207698_10029096 3300026142 Bacteria 3951
152 Ga0209998_10010003 3300027717 Bacteria 1965
153 Ga0207428_10001843 3300027907 Bacteria 21667
154 Ga0268265_10128517 3300028380 Bacteria 2101
155 Ga0268265_10134268 3300028380 Bacteria 2062
156 Ga0307515_10015833 3300028794 Bacteria 13863
157 Ga0307515_10021806 3300028794 Bacteria 11332
158 Ga0265338_10066009 3300028800 Bacteria 3135
159 Ga0307512_10148324 3300030522 Bacteria 1411
160 Ga0316183_1087709 3300030742 Bacteria 6762
161 Ga0265330_10025205 3300031235 Bacteria 2696
162 Ga0265332_10003009 3300031238 Bacteria 8269
163 Ga0307513_10031475 3300031456 Bacteria 6006
164 Ga0307513_10055370 3300031456 Bacteria 4245
165 Ga0307513_10282075 3300031456 Bacteria 1438
166 Ga0307509_10003989 3300031507 Bacteria 21735
167 Ga0307509_10510374 3300031507 Bacteria 885
168 Ga0307408_100080596 3300031548 Bacteria 2432
169 Ga0265314_10008127 3300031711 Bacteria 9029
170 Ga0265314_10039466 3300031711 Bacteria 3400
171 Ga0265342_10044894 3300031712 Bacteria 2662
172 Ga0265342_10046263 3300031712 Bacteria 2616
173 Ga0307516_10000610 3300031730 Bacteria 48458
174 Ga0307405_10000546 3300031731 Bacteria 14301
175 Ga0307405_10081589 3300031731 Bacteria 2114
176 Ga0307405_10372222 3300031731 Bacteria 1109
177 Ga0307413_10021474 3300031824 Bacteria 3459
178 Ga0307410_10021858 3300031852 Bacteria 3942
179 Ga0307410_10048098 3300031852 Bacteria 2854
180 Ga0307410_10169438 3300031852 Bacteria 1644
181 Ga0307407_10007455 3300031903 Bacteria 4957
182 Ga0307412_10004957 3300031911 Bacteria 7439
183 Ga0307409_100087059 3300031995 Bacteria 2544
184 Ga0307409_100092124 3300031995 Bacteria 2486
185 Ga0307409_100361126 3300031995 Bacteria 1374
186 Ga0307416_100019723 3300032002 Bacteria 4789
187 Ga0307414_10011513 3300032004 Bacteria 5192
188 Ga0307510_10001144 3300033180 Bacteria 28515
189 Ga0307510_10246557 3300033180 Bacteria 1277
190 Ga0373923_0158662 3300035111 Unclassified 1031
191 Ga0373936_0141282 3300035113 Bacteria 1040
192 Ga0373945_0115942 3300035116 Unclassified 1061
193 Ga0373956_0053162 3300035119 Bacteria 1823
194 Ga0373955_0008292 3300035172 Bacteria 4820
195 Ga0373955_0233291 3300035172 Bacteria 1101
196 Ga0373927_0150819 3300035695 Bacteria 1522
197 Ga0373933_0065556 3300035724 Bacteria 2199
198 Ga0373937_0004955 3300036401 Bacteria 11321
199 Ga0373937_0059129 3300036401 Bacteria 3522
200 Ga0373937_0400700 3300036401 Bacteria 1302
201 Ga0373925_0459602 3300037068 Bacteria 1043
202 Ga0395900_0246212 3300037418 Bacteria 1791
203 Ga0395898_0758983 3300037466 Bacteria 911
204 Ga0395905_0183988 3300037471 Bacteria 1961
205 Ga0439453_0018061 3300041408 Bacteria 1244
206 Ga0439461_0008378 3300041410 Bacteria 1851
207 Ga0450923_003369 3300042125 Bacteria 2405
208 Ga0450908_007105 3300042184 Bacteria 2115
209 Ga0439434_0012810 3300042435 Bacteria 2485
210 Ga0439435_0060541 3300042436 Bacteria 1102
211 Ga0439444_0003707 3300042437 Bacteria 2175
212 Ga0495592_0006307 3300046454 Bacteria 8825
213 Ga0495638_0007350 3300046460 Bacteria 7907
214 Ga0495606_0166895 3300046507 Bacteria 1280
215 Ga0495616_0000360 3300046513 Bacteria 35740
216 Ga0495616_0077708 3300046513 Bacteria 1593
217 Ga0495620_0093133 3300046515 Bacteria 1207
218 Ga0495637_0004619 3300046520 Bacteria 7111
219 Ga0495597_0000746 3300046542 Bacteria 25742
220 Ga0495625_0053181 3300046660 Bacteria 2898
221 Ga0495646_0237587 3300046680 Bacteria 980
222 Ga0495671_0003435 3300046692 Bacteria 9731
223 Ga0495589_0000641 3300046794 Bacteria 22902
224 Ga0495680_0293569 3300047322 Bacteria 1143
225 Ga0495687_000161 3300047443 Bacteria 100635
226 Ga0495673_0000121 3300047469 Bacteria 144619
227 Ga0496100_0096002 3300048903 Bacteria 2033
228 Ga0496101_0200355 3300048904 Bacteria 1543
229 Ga0496104_0030657 3300048907 Bacteria 4998
230 Ga0496104_0053299 3300048907 Bacteria 3821
231 Ga0496105_0015522 3300048908 Bacteria 6071
232 Ga0496105_0407262 3300048908 Bacteria 1079
233 Ga0496114_0004383 3300048917 Bacteria 10937
234 Ga0496115_0001081 3300048918 Bacteria 19747
235 Ga0496117_0120279 3300048920 Bacteria 1615
236 Ga0496118_0089416 3300048921 Bacteria 2126
237 Ga0496121_0007402 3300048924 Bacteria 13268
238 Ga0501031_0089240 3300049568 Bacteria 2010
239 Ga0501032_0003926 3300049569 Bacteria 11289
240 Ga0501033_0004984 3300049570 Bacteria 10557
241 Ga0501034_0000163 3300049571 Bacteria 125417
242 Ga0501034_0418946 3300049571 Bacteria 1260
243 Ga0501034_0460004 3300049571 Bacteria 1189
244 Ga0501036_0012997 3300049572 Bacteria 6913
245 Ga0501036_0598296 3300049572 Unclassified 915
246 Ga0501037_0000124 3300049573 Bacteria 71522
247 Ga0501039_0047476 3300049575 Bacteria 3319
248 Ga0501039_0252044 3300049575 Bacteria 1388
249 Ga0501040_0217314 3300049576 Bacteria 1360
250 Ga0501041_0061681 3300049577 Bacteria 2295
251 Ga0501041_0325113 3300049577 Bacteria 970
252 Ga0501043_0000003 3300049579 Bacteria 318844
253 Ga0501047_0009205 3300049581 Bacteria 9323
254 Ga0501047_0059028 3300049581 Bacteria 3705
255 Ga0501067_0006251 3300049583 Bacteria 6606
256 Ga0501067_0023177 3300049583 Bacteria 3439
257 Ga0501068_0000771 3300049584 Bacteria 16509
258 Ga0501068_0027347 3300049584 Bacteria 3367
259 Ga0501068_0054843 3300049584 Bacteria 2415
260 Ga0501069_0000003 3300049585 Bacteria 210301
261 Ga0501070_0001085 3300049586 Bacteria 24426
262 Ga0501070_0080719 3300049586 Bacteria 2691
263 Ga0501072_0107947 3300049588 Bacteria 2214
264 Ga0501072_0154334 3300049588 Bacteria 1831
265 Ga0501073_0002694 3300049589 Bacteria 13298
266 Ga0501073_0013427 3300049589 Bacteria 5957
267 Ga0501074_0000007 3300049590 Bacteria 111136
268 Ga0501074_0011200 3300049590 Bacteria 6514
269 Ga0501075_0034461 3300049591 Bacteria 3770
270 Ga0501075_0116263 3300049591 Bacteria 2033
271 Ga0501075_0380521 3300049591 Bacteria 1076
272 Ga0501076_0148512 3300049592 Bacteria 1906
273 Ga0501077_0038985 3300049593 Bacteria 3025
274 Ga0501077_0052603 3300049593 Bacteria 2586
275 Ga0501079_0000016 3300049741 Bacteria 65975
276 Ga0501079_0047072 3300049741 Bacteria 3328
277 Ga0501079_0061817 3300049741 Bacteria 2889
278 Ga0501079_0087194 3300049741 Bacteria 2416
279 Ga0501079_0124639 3300049741 Bacteria 2004
280 Ga0501079_0400129 3300049741 Bacteria 1077
281 Ga0501080_0000319 3300049742 Bacteria 36724
282 Ga0501080_0000365 3300049742 Bacteria 34986
283 Ga0501081_0099332 3300049743 Bacteria 2056
284 Ga0501081_0143470 3300049743 Bacteria 1712
285 Ga0501081_0299104 3300049743 Bacteria 1180
286 Ga0501083_0000024 3300049744 Bacteria 123029
287 Ga0501083_0015178 3300049744 Bacteria 5393
288 Ga0501035_0000941 3300049822 Bacteria 30729
289 Ga0501044_0000016 3300049823 Bacteria 231626
290 Ga0501044_0142247 3300049823 Bacteria 2387
291 Ga0501045_0032868 3300049824 Bacteria 3760
292 Ga0501045_0144564 3300049824 Bacteria 1769
293 nmdc:mga03683_13458_c1 3300050489 Bacteria 3012
294 nmdc:mga03683_24447_c1 3300050489 Bacteria 2364
295 nmdc:mga03n38_237260_c1 3300050490 Bacteria 958
296 nmdc:mga00v17_68670_c1 3300050491 Bacteria 2191
297 nmdc:mga0k408_156430_c1 3300050493 Bacteria 1358
298 nmdc:mga0k408_300724_c1 3300050493 Bacteria 958
299 nmdc:mga0k408_9214_c1 3300050493 Bacteria 5318
300 nmdc:mga06z11_48173_c1 3300050494 Bacteria 1376
301 nmdc:mga07m45_56601_c1 3300050496 Bacteria 2216
302 nmdc:mga09592_860_c1 3300050508 Bacteria 23700
303 nmdc:mga0qj67_140588_c1 3300050509 Bacteria 1957
304 nmdc:mga0qj67_96721_c1 3300050509 Bacteria 2377
305 nmdc:mga06r32_45463_c1 3300050510 Bacteria 4185
306 nmdc:mga06r32_842_c1 3300050510 Bacteria 27157
307 nmdc:mga08y16_1802_c1 3300050511 Bacteria 21723
308 nmdc:mga08y16_262925_c1 3300050511 Bacteria 1782
309 nmdc:mga08y16_78728_c1 3300050511 Bacteria 3436
310 nmdc:mga0sz30_36473_c1 3300050516 Bacteria 2055
311 Ga0495619_0209838 3300053085 Bacteria 1349
312 Ga0500651_0014652 3300053093 Bacteria 4800
313 Ga0500651_0080866 3300053093 Bacteria 2012
314 Ga0500559_0000020 3300053136 Bacteria 134858
315 Ga0500564_056022 3300053138 Bacteria 1796
316 Ga0500619_005185 3300053154 Bacteria 2880
317 Ga0500622_0003341 3300053156 Bacteria 10815
318 Ga0500587_001869 3300053739 Bacteria 3002
319 Ga0501084_0089264 3300054114 Bacteria 2587
320 Ga0501082_0024508 3300060353 Bacteria 5201
321 Ga0501082_0090412 3300060353 Bacteria 2643
322 Ga0530510_0143495 3300061734 Bacteria 1760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0407262 Ga0496105_0407262_67_873 242
2 3300005438 Ga0070701_10080301 Ga0070701_100803012 246
3 3300048920 Ga0496117_0120279 Ga0496117_0120279_260_1006 246
4 3300048921 Ga0496118_0089416 Ga0496118_0089416_380_1126 246
5 3300028800 Ga0265338_10066009 Ga0265338_100660092 249
6 3300013104 Ga0157370_10185772 Ga0157370_101857722 255
7 3300005336 Ga0070680_100112033 Ga0070680_1001120332 260
8 3300005439 Ga0070711_100091708 Ga0070711_1000917082 260
9 3300013104 Ga0157370_10087775 Ga0157370_100877752 260
10 3300046513 Ga0495616_0077708 Ga0495616_0077708_244_1032 261
11 iso_pu_bacteria 2513237150 2513953321 261
12 iso_pu_bacteria 644736347 644746992 261
13 3300003320 rootH2_10078893 rootH2_100788932 262
14 3300005436 Ga0070713_100263731 Ga0070713_1002637312 262
15 3300005535 Ga0070684_100271017 Ga0070684_1002710172 262
16 3300035119 Ga0373956_0053162 Ga0373956_0053162_818_1606 262
17 3300035172 Ga0373955_0008292 Ga0373955_0008292_3899_4687 262
18 3300035695 Ga0373927_0150819 Ga0373927_0150819_259_1047 262
19 3300036401 Ga0373937_0004955 Ga0373937_0004955_8168_8956 262
20 3300037418 Ga0395900_0246212 Ga0395900_0246212_429_1220 262
21 3300037466 Ga0395898_0758983 Ga0395898_0758983_29_820 262
22 3300037471 Ga0395905_0183988 Ga0395905_0183988_743_1534 262
23 3300049571 Ga0501034_0000163 Ga0501034_0000163_109084_109881 262
24 3300050496 nmdc:mga07m45_56601_c1 nmdc:mga07m45_56601_c1_488_1315 262
25 iso_pu_bacteria 2858688981 2858697682 262
26 3300031235 Ga0265330_10025205 Ga0265330_100252052 263
27 3300031238 Ga0265332_10003009 Ga0265332_100030099 263
28 3300031711 Ga0265314_10008127 Ga0265314_100081275 263
29 3300031712 Ga0265342_10046263 Ga0265342_100462632 263
30 3300006178 Ga0075367_10214765 Ga0075367_102147652 264
31 3300006195 Ga0075366_10029548 Ga0075366_100295483 264
32 3300050493 nmdc:mga0k408_300724_c1 nmdc:mga0k408_300724_c1_11_814 264
33 iso_pu_bacteria 2512047030 2512352740 264
34 iso_pu_bacteria 2738543013 2739252369 264
35 iso_pu_bacteria 2881412998 2881415665 264
36 iso_pu_bacteria 2904449895 2904453726 264
37 iso_pu_bacteria 2904456579 2904458970 264
38 iso_pu_bacteria 2919704043 2919707788 264
39 iso_pu_bacteria 2945972063 2945972633 264
40 3300028380 Ga0268265_10128517 Ga0268265_101285172 265
41 3300046520 Ga0495637_0004619 Ga0495637_0004619_3643_4542 265
42 3300047469 Ga0495673_0000121 Ga0495673_0000121_108326_109246 265
43 3300049581 Ga0501047_0009205 Ga0501047_0009205_7607_8500 265
44 3300005367 Ga0070667_100546635 Ga0070667_1005466352 266
45 3300009148 Ga0105243_10049972 Ga0105243_100499722 266
46 3300025935 Ga0207709_10028524 Ga0207709_100285242 266
47 3300025986 Ga0207658_10082664 Ga0207658_100826643 266
48 3300026089 Ga0207648_10391798 Ga0207648_103917982 266
49 3300036401 Ga0373937_0400700 Ga0373937_0400700_165_965 266
50 3300041408 Ga0439453_0018061 Ga0439453_0018061_294_1094 266
51 3300048924 Ga0496121_0007402 Ga0496121_0007402_3986_4786 266
52 3300005334 Ga0068869_100307561 Ga0068869_1003075611 267
53 3300005340 Ga0070689_100089541 Ga0070689_1000895413 267
54 3300005353 Ga0070669_100063292 Ga0070669_1000632922 267
55 3300005354 Ga0070675_100072215 Ga0070675_1000722152 267
56 3300005356 Ga0070674_100269895 Ga0070674_1002698951 267
57 3300005365 Ga0070688_100141490 Ga0070688_1001414902 267
58 3300005438 Ga0070701_10022995 Ga0070701_100229953 267
59 3300005457 Ga0070662_100164818 Ga0070662_1001648182 267
60 3300005466 Ga0070685_10276924 Ga0070685_102769241 267
61 3300005466 Ga0070685_10351567 Ga0070685_103515671 267
62 3300005543 Ga0070672_100056228 Ga0070672_1000562282 267
63 3300005548 Ga0070665_100012754 Ga0070665_1000127543 267
64 3300005564 Ga0070664_100077187 Ga0070664_1000771871 267
65 3300005617 Ga0068859_100121470 Ga0068859_1001214703 267
66 3300005618 Ga0068864_100197009 Ga0068864_1001970092 267
67 3300005719 Ga0068861_100101387 Ga0068861_1001013871 267
68 3300005841 Ga0068863_100044210 Ga0068863_1000442103 267
69 3300006237 Ga0097621_100005591 Ga0097621_1000055913 267
70 3300006358 Ga0068871_100029884 Ga0068871_1000298844 267
71 3300006844 Ga0075428_100007405 Ga0075428_1000074054 267
72 3300006844 Ga0075428_100021183 Ga0075428_1000211832 267
73 3300006846 Ga0075430_100103756 Ga0075430_1001037562 267
74 3300006846 Ga0075430_100167025 Ga0075430_1001670252 267
75 3300006847 Ga0075431_100000011 Ga0075431_10000001175 267
76 3300006847 Ga0075431_100071016 Ga0075431_1000710163 267
77 3300006880 Ga0075429_100005334 Ga0075429_1000053343 267
78 3300006931 Ga0097620_100121468 Ga0097620_1001214683 267
79 3300009094 Ga0111539_10003199 Ga0111539_100031992 267
80 3300009094 Ga0111539_11069777 Ga0111539_110697771 267
81 3300009148 Ga0105243_10172539 Ga0105243_101725392 267
82 3300013308 Ga0157375_10462760 Ga0157375_104627601 267
83 3300014325 Ga0163163_10010812 Ga0163163_100108125 267
84 3300014326 Ga0157380_10001615 Ga0157380_1000161510 267
85 3300014326 Ga0157380_10019159 Ga0157380_100191596 267
86 3300014326 Ga0157380_10030838 Ga0157380_100308385 267
87 3300014969 Ga0157376_11020016 Ga0157376_110200161 267
88 3300025920 Ga0207649_10303894 Ga0207649_103038941 267
89 3300025925 Ga0207650_10086490 Ga0207650_100864902 267
90 3300025933 Ga0207706_10063806 Ga0207706_100638063 267
91 3300025937 Ga0207669_10247069 Ga0207669_102470692 267
92 3300025940 Ga0207691_10041143 Ga0207691_100411433 267
93 3300025942 Ga0207689_10170093 Ga0207689_101700932 267
94 3300025942 Ga0207689_10365322 Ga0207689_103653222 267
95 3300025945 Ga0207679_10130970 Ga0207679_101309702 267
96 3300025960 Ga0207651_10101092 Ga0207651_101010923 267
97 3300026088 Ga0207641_10020142 Ga0207641_100201423 267
98 3300026089 Ga0207648_10028033 Ga0207648_100280334 267
99 3300026118 Ga0207675_100065365 Ga0207675_1000653653 267
100 3300026118 Ga0207675_100178576 Ga0207675_1001785762 267
101 3300027717 Ga0209998_10010003 Ga0209998_100100032 267
102 3300027907 Ga0207428_10001843 Ga0207428_100018432 267
103 3300031456 Ga0307513_10031475 Ga0307513_100314754 267
104 3300031548 Ga0307408_100080596 Ga0307408_1000805963 267
105 3300031711 Ga0265314_10039466 Ga0265314_100394662 267
106 3300031712 Ga0265342_10044894 Ga0265342_100448942 267
107 3300031731 Ga0307405_10081589 Ga0307405_100815892 267
108 3300031731 Ga0307405_10372222 Ga0307405_103722222 267
109 3300031852 Ga0307410_10048098 Ga0307410_100480983 267
110 3300031903 Ga0307407_10007455 Ga0307407_100074553 267
111 3300031995 Ga0307409_100092124 Ga0307409_1000921242 267
112 3300032002 Ga0307416_100019723 Ga0307416_1000197232 267
113 3300035724 Ga0373933_0065556 Ga0373933_0065556_608_1414 267
114 3300036401 Ga0373937_0059129 Ga0373937_0059129_859_1665 267
115 3300041410 Ga0439461_0008378 Ga0439461_0008378_514_1383 267
116 3300042125 Ga0450923_003369 Ga0450923_003369_1448_2251 267
117 3300042184 Ga0450908_007105 Ga0450908_007105_798_1601 267
118 3300042435 Ga0439434_0012810 Ga0439434_0012810_1524_2333 267
119 3300042436 Ga0439435_0060541 Ga0439435_0060541_22_828 267
120 3300042437 Ga0439444_0003707 Ga0439444_0003707_1098_1904 267
121 3300046460 Ga0495638_0007350 Ga0495638_0007350_6099_6980 267
122 3300046507 Ga0495606_0166895 Ga0495606_0166895_445_1248 267
123 3300046513 Ga0495616_0000360 Ga0495616_0000360_19864_20670 267
124 3300046542 Ga0495597_0000746 Ga0495597_0000746_10179_10982 267
125 3300046660 Ga0495625_0053181 Ga0495625_0053181_1581_2387 267
126 3300046692 Ga0495671_0003435 Ga0495671_0003435_6571_7416 267
127 3300046794 Ga0495589_0000641 Ga0495589_0000641_11431_12234 267
128 3300047322 Ga0495680_0293569 Ga0495680_0293569_314_1120 267
129 3300049568 Ga0501031_0089240 Ga0501031_0089240_1019_1891 267
130 3300049569 Ga0501032_0003926 Ga0501032_0003926_1560_2432 267
131 3300049570 Ga0501033_0004984 Ga0501033_0004984_7175_8047 267
132 3300049572 Ga0501036_0012997 Ga0501036_0012997_5571_6383 267
133 3300049572 Ga0501036_0598296 Ga0501036_0598296_51_857 267
134 3300049573 Ga0501037_0000124 Ga0501037_0000124_1276_2148 267
135 3300049575 Ga0501039_0047476 Ga0501039_0047476_1095_1907 267
136 3300049575 Ga0501039_0252044 Ga0501039_0252044_213_1016 267
137 3300049576 Ga0501040_0217314 Ga0501040_0217314_72_878 267
138 3300049577 Ga0501041_0061681 Ga0501041_0061681_1079_1891 267
139 3300049577 Ga0501041_0325113 Ga0501041_0325113_125_928 267
140 3300049579 Ga0501043_0000003 Ga0501043_0000003_53599_54471 267
141 3300049583 Ga0501067_0006251 Ga0501067_0006251_3452_4258 267
142 3300049583 Ga0501067_0023177 Ga0501067_0023177_2406_3212 267
143 3300049584 Ga0501068_0000771 Ga0501068_0000771_9592_10398 267
144 3300049584 Ga0501068_0027347 Ga0501068_0027347_2285_3091 267
145 3300049584 Ga0501068_0054843 Ga0501068_0054843_250_1062 267
146 3300049585 Ga0501069_0000003 Ga0501069_0000003_69174_70046 267
147 3300049586 Ga0501070_0001085 Ga0501070_0001085_10213_11085 267
148 3300049586 Ga0501070_0080719 Ga0501070_0080719_1342_2148 267
149 3300049588 Ga0501072_0107947 Ga0501072_0107947_585_1397 267
150 3300049588 Ga0501072_0154334 Ga0501072_0154334_321_1124 267
151 3300049589 Ga0501073_0002694 Ga0501073_0002694_1910_2716 267
152 3300049589 Ga0501073_0013427 Ga0501073_0013427_2162_3034 267
153 3300049590 Ga0501074_0000007 Ga0501074_0000007_52400_53272 267
154 3300049590 Ga0501074_0011200 Ga0501074_0011200_3263_4069 267
155 3300049591 Ga0501075_0034461 Ga0501075_0034461_420_1223 267
156 3300049591 Ga0501075_0116263 Ga0501075_0116263_1109_1921 267
157 3300049591 Ga0501075_0380521 Ga0501075_0380521_242_1048 267
158 3300049592 Ga0501076_0148512 Ga0501076_0148512_522_1325 267
159 3300049593 Ga0501077_0038985 Ga0501077_0038985_641_1453 267
160 3300049593 Ga0501077_0052603 Ga0501077_0052603_1086_1892 267
161 3300049741 Ga0501079_0000016 Ga0501079_0000016_50461_51267 267
162 3300049741 Ga0501079_0047072 Ga0501079_0047072_210_1013 267
163 3300049741 Ga0501079_0061817 Ga0501079_0061817_186_989 267
164 3300049741 Ga0501079_0087194 Ga0501079_0087194_756_1568 267
165 3300049741 Ga0501079_0124639 Ga0501079_0124639_282_1085 267
166 3300049741 Ga0501079_0400129 Ga0501079_0400129_240_1046 267
167 3300049742 Ga0501080_0000319 Ga0501080_0000319_1296_2102 267
168 3300049742 Ga0501080_0000365 Ga0501080_0000365_32164_33036 267
169 3300049743 Ga0501081_0099332 Ga0501081_0099332_987_1790 267
170 3300049743 Ga0501081_0143470 Ga0501081_0143470_97_900 267
171 3300049743 Ga0501081_0299104 Ga0501081_0299104_349_1155 267
172 3300049744 Ga0501083_0000024 Ga0501083_0000024_17130_18002 267
173 3300049744 Ga0501083_0015178 Ga0501083_0015178_2829_3635 267
174 3300049822 Ga0501035_0000941 Ga0501035_0000941_16703_17575 267
175 3300049823 Ga0501044_0000016 Ga0501044_0000016_69166_70038 267
176 3300049823 Ga0501044_0142247 Ga0501044_0142247_1548_2354 267
177 3300049824 Ga0501045_0032868 Ga0501045_0032868_761_1573 267
178 3300050508 nmdc:mga09592_860_c1 nmdc:mga09592_860_c1_14519_15325 267
179 3300050509 nmdc:mga0qj67_140588_c1 nmdc:mga0qj67_140588_c1_532_1338 267
180 3300050509 nmdc:mga0qj67_96721_c1 nmdc:mga0qj67_96721_c1_816_1622 267
181 3300050510 nmdc:mga06r32_45463_c1 nmdc:mga06r32_45463_c1_864_1670 267
182 3300050510 nmdc:mga06r32_842_c1 nmdc:mga06r32_842_c1_25725_26531 267
183 3300050511 nmdc:mga08y16_1802_c1 nmdc:mga08y16_1802_c1_19782_20588 267
184 3300050511 nmdc:mga08y16_262925_c1 nmdc:mga08y16_262925_c1_19_825 267
185 3300050511 nmdc:mga08y16_78728_c1 nmdc:mga08y16_78728_c1_2397_3203 267
186 3300060353 Ga0501082_0024508 Ga0501082_0024508_1459_2331 267
187 3300060353 Ga0501082_0090412 Ga0501082_0090412_1032_1844 267
188 3300061734 Ga0530510_0143495 Ga0530510_0143495_916_1719 267
189 3300003187 JGI25151J46595_10000357 JGI25151J46595_1000035735 268
190 3300003578 Ga0006562J51391_1073707 Ga0006562J51391_10737076 268
191 3300003578 Ga0006562J51391_1073710 Ga0006562J51391_10737103 268
192 3300003792 Ga0055540_1000916 Ga0055540_100091614 268
193 3300005331 Ga0070670_100201893 Ga0070670_1002018932 268
194 3300005334 Ga0068869_100538534 Ga0068869_1005385341 268
195 3300005337 Ga0070682_100092181 Ga0070682_1000921812 268
196 3300005338 Ga0068868_100099220 Ga0068868_1000992203 268
197 3300005338 Ga0068868_100157441 Ga0068868_1001574411 268
198 3300005344 Ga0070661_100253436 Ga0070661_1002534361 268
199 3300005353 Ga0070669_100021314 Ga0070669_1000213144 268
200 3300005354 Ga0070675_100103738 Ga0070675_1001037382 268
201 3300005356 Ga0070674_100064659 Ga0070674_1000646593 268
202 3300005366 Ga0070659_100206197 Ga0070659_1002061972 268
203 3300005367 Ga0070667_100004212 Ga0070667_10000421211 268
204 3300005367 Ga0070667_100183054 Ga0070667_1001830542 268
205 3300005367 Ga0070667_100256171 Ga0070667_1002561711 268
206 3300005435 Ga0070714_100124674 Ga0070714_1001246742 268
207 3300005436 Ga0070713_100100429 Ga0070713_1001004293 268
208 3300005438 Ga0070701_10265030 Ga0070701_102650301 268
209 3300005439 Ga0070711_100207604 Ga0070711_1002076041 268
210 3300005456 Ga0070678_100094008 Ga0070678_1000940082 268
211 3300005457 Ga0070662_100058506 Ga0070662_1000585062 268
212 3300005458 Ga0070681_10010823 Ga0070681_100108233 268
213 3300005459 Ga0068867_100048172 Ga0068867_1000481722 268
214 3300005459 Ga0068867_100155594 Ga0068867_1001555942 268
215 3300005466 Ga0070685_10060970 Ga0070685_100609702 268
216 3300005539 Ga0068853_100396182 Ga0068853_1003961821 268
217 3300005543 Ga0070672_100017856 Ga0070672_1000178562 268
218 3300005545 Ga0070695_100004700 Ga0070695_1000047005 268
219 3300005548 Ga0070665_100046891 Ga0070665_1000468914 268
220 3300005577 Ga0068857_100090709 Ga0068857_1000907092 268
221 3300005616 Ga0068852_100642086 Ga0068852_1006420861 268
222 3300005617 Ga0068859_100599280 Ga0068859_1005992802 268
223 3300005719 Ga0068861_100321438 Ga0068861_1003214382 268
224 3300005834 Ga0068851_10013540 Ga0068851_100135403 268
225 3300005842 Ga0068858_100073119 Ga0068858_1000731192 268
226 3300006048 Ga0075363_100116778 Ga0075363_1001167782 268
227 3300006051 Ga0075364_10044509 Ga0075364_100445092 268
228 3300006177 Ga0075362_10000661 Ga0075362_1000066111 268
229 3300006177 Ga0075362_10037973 Ga0075362_100379732 268
230 3300006186 Ga0075369_10033499 Ga0075369_100334993 268
231 3300006195 Ga0075366_10031251 Ga0075366_100312513 268
232 3300006353 Ga0075370_10066063 Ga0075370_100660633 268
233 3300006931 Ga0097620_100599306 Ga0097620_1005993061 268
234 3300009093 Ga0105240_10087784 Ga0105240_100877844 268
235 3300009176 Ga0105242_10777702 Ga0105242_107777021 268
236 3300009545 Ga0105237_10012264 Ga0105237_100122642 268
237 3300013306 Ga0163162_10205042 Ga0163162_102050422 268
238 3300013307 Ga0157372_10079362 Ga0157372_100793622 268
239 3300013308 Ga0157375_10027539 Ga0157375_100275392 268
240 3300014325 Ga0163163_10008641 Ga0163163_100086412 268
241 3300014326 Ga0157380_10248455 Ga0157380_102484552 268
242 3300014968 Ga0157379_10020265 Ga0157379_100202657 268
243 3300014968 Ga0157379_10370862 Ga0157379_103708621 268
244 3300025294 Ga0209025_1000003 Ga0209025_1000003998 268
245 3300025303 Ga0209051_1000355 Ga0209051_100035524 268
246 3300025901 Ga0207688_10010941 Ga0207688_100109413 268
247 3300025903 Ga0207680_10284565 Ga0207680_102845651 268
248 3300025912 Ga0207707_10049023 Ga0207707_100490233 268
249 3300025913 Ga0207695_10221924 Ga0207695_102219241 268
250 3300025914 Ga0207671_10024511 Ga0207671_100245114 268
251 3300025916 Ga0207663_10091261 Ga0207663_100912612 268
252 3300025920 Ga0207649_10455509 Ga0207649_104555091 268
253 3300025925 Ga0207650_10398913 Ga0207650_103989131 268
254 3300025928 Ga0207700_10112096 Ga0207700_101120963 268
255 3300025932 Ga0207690_10049559 Ga0207690_100495592 268
256 3300025933 Ga0207706_10021921 Ga0207706_100219213 268
257 3300025933 Ga0207706_10111765 Ga0207706_101117653 268
258 3300025937 Ga0207669_10036203 Ga0207669_100362032 268
259 3300025940 Ga0207691_10025164 Ga0207691_100251645 268
260 3300025942 Ga0207689_10140094 Ga0207689_101400942 268
261 3300025986 Ga0207658_10010187 Ga0207658_100101873 268
262 3300025986 Ga0207658_10303303 Ga0207658_103033032 268
263 3300026023 Ga0207677_10399460 Ga0207677_103994601 268
264 3300026041 Ga0207639_10063553 Ga0207639_100635532 268
265 3300026041 Ga0207639_10254828 Ga0207639_102548281 268
266 3300026067 Ga0207678_10175440 Ga0207678_101754402 268
267 3300026088 Ga0207641_10242709 Ga0207641_102427091 268
268 3300026089 Ga0207648_10040725 Ga0207648_100407253 268
269 3300026089 Ga0207648_10224167 Ga0207648_102241672 268
270 3300026089 Ga0207648_10623495 Ga0207648_106234952 268
271 3300026116 Ga0207674_10067384 Ga0207674_100673843 268
272 3300026118 Ga0207675_100074919 Ga0207675_1000749193 268
273 3300026121 Ga0207683_10111808 Ga0207683_101118082 268
274 3300026121 Ga0207683_10273707 Ga0207683_102737072 268
275 3300026142 Ga0207698_10029096 Ga0207698_100290963 268
276 3300028380 Ga0268265_10134268 Ga0268265_101342681 268
277 3300028794 Ga0307515_10015833 Ga0307515_1001583314 268
278 3300028794 Ga0307515_10021806 Ga0307515_100218068 268
279 3300030522 Ga0307512_10148324 Ga0307512_101483242 268
280 3300030742 Ga0316183_1087709 Ga0316183_10877092 268
281 3300031456 Ga0307513_10055370 Ga0307513_100553702 268
282 3300031456 Ga0307513_10282075 Ga0307513_102820752 268
283 3300031507 Ga0307509_10003989 Ga0307509_100039897 268
284 3300031507 Ga0307509_10510374 Ga0307509_105103741 268
285 3300031730 Ga0307516_10000610 Ga0307516_100006109 268
286 3300031731 Ga0307405_10000546 Ga0307405_1000054610 268
287 3300031824 Ga0307413_10021474 Ga0307413_100214742 268
288 3300031852 Ga0307410_10021858 Ga0307410_100218584 268
289 3300031852 Ga0307410_10169438 Ga0307410_101694382 268
290 3300031911 Ga0307412_10004957 Ga0307412_100049572 268
291 3300031995 Ga0307409_100087059 Ga0307409_1000870592 268
292 3300031995 Ga0307409_100361126 Ga0307409_1003611262 268
293 3300032004 Ga0307414_10011513 Ga0307414_100115135 268
294 3300033180 Ga0307510_10001144 Ga0307510_1000114429 268
295 3300033180 Ga0307510_10246557 Ga0307510_102465572 268
296 3300035111 Ga0373923_0158662 Ga0373923_0158662_168_977 268
297 3300035113 Ga0373936_0141282 Ga0373936_0141282_46_855 268
298 3300035116 Ga0373945_0115942 Ga0373945_0115942_64_873 268
299 3300035172 Ga0373955_0233291 Ga0373955_0233291_25_834 268
300 3300037068 Ga0373925_0459602 Ga0373925_0459602_153_962 268
301 3300046454 Ga0495592_0006307 Ga0495592_0006307_6871_7677 268
302 3300046515 Ga0495620_0093133 Ga0495620_0093133_21_827 268
303 3300046680 Ga0495646_0237587 Ga0495646_0237587_62_868 268
304 3300047443 Ga0495687_000161 Ga0495687_000161_31441_32247 268
305 3300048903 Ga0496100_0096002 Ga0496100_0096002_695_1504 268
306 3300048904 Ga0496101_0200355 Ga0496101_0200355_395_1204 268
307 3300048907 Ga0496104_0030657 Ga0496104_0030657_3716_4525 268
308 3300048907 Ga0496104_0053299 Ga0496104_0053299_17_826 268
309 3300048908 Ga0496105_0015522 Ga0496105_0015522_2939_3748 268
310 3300048917 Ga0496114_0004383 Ga0496114_0004383_8332_9141 268
311 3300048918 Ga0496115_0001081 Ga0496115_0001081_15499_16308 268
312 3300049571 Ga0501034_0418946 Ga0501034_0418946_113_925 268
313 3300049571 Ga0501034_0460004 Ga0501034_0460004_224_1033 268
314 3300049581 Ga0501047_0059028 Ga0501047_0059028_1704_2516 268
315 3300049824 Ga0501045_0144564 Ga0501045_0144564_858_1670 268
316 3300050489 nmdc:mga03683_13458_c1 nmdc:mga03683_13458_c1_2104_2910 268
317 3300050489 nmdc:mga03683_24447_c1 nmdc:mga03683_24447_c1_1087_1893 268
318 3300050490 nmdc:mga03n38_237260_c1 nmdc:mga03n38_237260_c1_78_884 268
319 3300050491 nmdc:mga00v17_68670_c1 nmdc:mga00v17_68670_c1_1102_1908 268
320 3300050493 nmdc:mga0k408_156430_c1 nmdc:mga0k408_156430_c1_439_1245 268
321 3300050493 nmdc:mga0k408_9214_c1 nmdc:mga0k408_9214_c1_676_1482 268
322 3300050494 nmdc:mga06z11_48173_c1 nmdc:mga06z11_48173_c1_343_1149 268
323 3300050516 nmdc:mga0sz30_36473_c1 nmdc:mga0sz30_36473_c1_716_1522 268
324 3300053085 Ga0495619_0209838 Ga0495619_0209838_160_969 268
325 3300053093 Ga0500651_0014652 Ga0500651_0014652_3133_3939 268
326 3300053093 Ga0500651_0080866 Ga0500651_0080866_895_1701 268
327 3300053136 Ga0500559_0000020 Ga0500559_0000020_103547_104353 268
328 3300053138 Ga0500564_056022 Ga0500564_056022_563_1369 268
329 3300053154 Ga0500619_005185 Ga0500619_005185_1813_2619 268
330 3300053156 Ga0500622_0003341 Ga0500622_0003341_5235_6041 268
331 3300053739 Ga0500587_001869 Ga0500587_001869_567_1373 268
332 3300054114 Ga0501084_0089264 Ga0501084_0089264_983_1792 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

60

277

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bol-assembly1.cif.gz_A crystal structure of mutant 2-methylcitrate synthase mcsag419a from aspergillus fumigatus. 0.8275 37 244
6hxp-assembly1.cif.gz_A structure of citryl-coa lyase from hydrogenobacter thermophilus 0.8191 8 265
2cts-assembly1.cif.gz_A-2 crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution 0.8167 35 244
8gr9-assembly1.cif.gz_A crystal structure of peroxisomal citrate synthase (cit2) from saccharomyces cerevisiae in complex with oxaloacetate and coenzyme-a 0.8152 36 244
6hxm-assembly1.cif.gz_B structure of the citryl-coa lyase core module of human atp citrate lyase in complex with citrate and coash in space group c2221 0.8063 5 244
ID Description Score Start End Superfamily
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.8339 108 212 1.10.580.10
1aj8B02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7692 107 210 1.10.230.10
2p2wA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7614 107 209 1.10.230.10
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.7583 108 212 1.10.580.10
1ixeD02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7534 107 209 1.10.230.10
ID Description Score Start End GO Terms
AF-A0A1Q7FC13-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9365 31 242 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829
AF-A0A3S4RPE3-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.934 9 242 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A4R7W3Z7-F1-model_v4 Citrate synthase 0.9336 5 96 GO:0046912
AF-A0A494WFX7-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9309 4 242 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829
AF-A0A848Q153-F1-model_v4 deleted 0.9277 7 239

Feature Viewer

pLDDT pTM Quality
88.9 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map