F411066

General Info

Members Datasets Scaffolds Average Seq Length
332 148 664 130

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0304609|Ga0495618_0304609_396_770
Length 124
Sequence MQSRSYRITRADLVAYAAASGDHNPIHQDDEIARSVGLPGVIAHGMYTLALAARYVDESVGQSGQIAELTAKFTKPVVVPAGDEGAEVVVTGELSEADGRQVVSLTVTCNGEKVLGNPRAVLRG

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
49 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
62 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
63 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
72 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
73 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
74 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
81 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
139 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
140 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
141 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2643221615 Nocardioides sp. Root224 Isolate Unclassified
147 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
148 2739367898 Nocardioides sp. CF479 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.3
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.81
Nodule 0
Rhizoplane 3.31
Rhizosphere 66.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0304609 3300046514 Bacteria 990
2 Ga0068868_100627075 3300005338 Bacteria 955
3 Ga0070660_100316083 3300005339 Bacteria 1282
4 Ga0070689_100571909 3300005340 Bacteria 976
5 Ga0070661_100474767 3300005344 Bacteria 998
6 Ga0070668_101821702 3300005347 Bacteria 560
7 Ga0070675_100646623 3300005354 Bacteria 961
8 Ga0070667_100036687 3300005367 Bacteria 4110
9 Ga0070667_100123312 3300005367 Bacteria 2256
10 Ga0070700_101130898 3300005441 Bacteria 651
11 Ga0070686_100373826 3300005544 Bacteria 1077
12 Ga0070664_100048874 3300005564 Bacteria 3576
13 Ga0070664_100842801 3300005564 Bacteria 858
14 Ga0068857_100225510 3300005577 Bacteria 1713
15 Ga0070702_100204518 3300005615 Bacteria 1309
16 Ga0068861_100033179 3300005719 Bacteria 3806
17 Ga0068861_100514917 3300005719 Bacteria 1084
18 Ga0068870_11321711 3300005840 Bacteria 526
19 Ga0068860_100003554 3300005843 Bacteria 16028
20 Ga0068860_102494810 3300005843 Bacteria 537
21 Ga0068862_101137250 3300005844 Bacteria 777
22 Ga0081539_10115817 3300005985 Bacteria 1340
23 Ga0075365_10009835 3300006038 Bacteria 5531
24 Ga0075365_10028168 3300006038 Bacteria 3581
25 Ga0075365_10064611 3300006038 Bacteria 2452
26 Ga0075365_10067064 3300006038 Bacteria 2408
27 Ga0075365_10144522 3300006038 Bacteria 1652
28 Ga0075365_10154922 3300006038 Bacteria 1595
29 Ga0075365_10170599 3300006038 Bacteria 1518
30 Ga0075365_10180572 3300006038 Bacteria 1475
31 Ga0075365_10252082 3300006038 Bacteria 1240
32 Ga0075365_10253540 3300006038 Bacteria 1237
33 Ga0075365_10276011 3300006038 Bacteria 1182
34 Ga0075365_10362619 3300006038 Bacteria 1022
35 Ga0075365_10481813 3300006038 Bacteria 876
36 Ga0075365_10517343 3300006038 Bacteria 844
37 Ga0075365_10561062 3300006038 Bacteria 808
38 Ga0075365_10714787 3300006038 Bacteria 708
39 Ga0075365_10793285 3300006038 Bacteria 668
40 Ga0075368_10130147 3300006042 Bacteria 1046
41 Ga0075363_100037096 3300006048 Bacteria 2559
42 Ga0075363_100049885 3300006048 Bacteria 2229
43 Ga0075363_100066977 3300006048 Bacteria 1945
44 Ga0075363_100148262 3300006048 Bacteria 1323
45 Ga0075363_100209875 3300006048 Bacteria 1114
46 Ga0075363_100236126 3300006048 Bacteria 1050
47 Ga0075363_100252447 3300006048 Bacteria 1016
48 Ga0075363_100294081 3300006048 Bacteria 941
49 Ga0075364_10104511 3300006051 Bacteria 1887
50 Ga0075364_10105621 3300006051 Bacteria 1876
51 Ga0075364_10142898 3300006051 Bacteria 1610
52 Ga0075364_10143762 3300006051 Bacteria 1605
53 Ga0075364_10522174 3300006051 Bacteria 812
54 Ga0075364_10540660 3300006051 Bacteria 796
55 Ga0075364_10720842 3300006051 Bacteria 680
56 Ga0075364_10832667 3300006051 Bacteria 629
57 Ga0075367_10120524 3300006178 Bacteria 1616
58 Ga0075367_10173743 3300006178 Bacteria 1342
59 Ga0075367_10481623 3300006178 Bacteria 787
60 Ga0075367_10570420 3300006178 Bacteria 719
61 Ga0075367_10675003 3300006178 Bacteria 657
62 Ga0075367_10697460 3300006178 Bacteria 646
63 Ga0075370_10012675 3300006353 Bacteria 4463
64 Ga0075370_10013133 3300006353 Bacteria 4395
65 Ga0075370_10061413 3300006353 Bacteria 2141
66 Ga0075370_10518815 3300006353 Bacteria 720
67 Ga0075370_10567599 3300006353 Bacteria 687
68 Ga0075370_10681099 3300006353 Bacteria 625
69 Ga0075370_10828113 3300006353 Bacteria 565
70 Ga0111539_10725994 3300009094 Bacteria 1156
71 Ga0105243_11349896 3300009148 Bacteria 732
72 Ga0157378_12596165 3300013297 Bacteria 559
73 Ga0157375_10537717 3300013308 Bacteria 1331
74 Ga0157375_10592656 3300013308 Bacteria 1268
75 Ga0163163_10208589 3300014325 Bacteria 2002
76 Ga0157380_10066547 3300014326 Bacteria 2898
77 Ga0157377_11254405 3300014745 Bacteria 577
78 Ga0163161_10425482 3300017792 Bacteria 1069
79 Ga0163161_11356400 3300017792 Bacteria 620
80 Ga0207643_10359873 3300025908 Bacteria 915
81 Ga0207662_10118235 3300025918 Bacteria 1659
82 Ga0207649_10156984 3300025920 Bacteria 1573
83 Ga0207669_10351724 3300025937 Bacteria 1139
84 Ga0207691_10556877 3300025940 Bacteria 972
85 Ga0207679_10021120 3300025945 Bacteria 4406
86 Ga0207679_10717612 3300025945 Bacteria 908
87 Ga0207712_10638359 3300025961 Bacteria 924
88 Ga0207658_10042678 3300025986 Bacteria 3292
89 Ga0207674_10221774 3300026116 Bacteria 1839
90 Ga0207675_100695912 3300026118 Bacteria 1025
91 Ga0207683_10733061 3300026121 Bacteria 917
92 Ga0209813_10021805 3300027866 Bacteria 1805
93 Ga0209813_10209038 3300027866 Bacteria 726
94 Ga0268264_10000437 3300028381 Bacteria 57431
95 Ga0268264_11852997 3300028381 Bacteria 613
96 Ga0316178_1042484 3300030735 Bacteria 963
97 Ga0307408_102246447 3300031548 Bacteria 528
98 Ga0316575_10020640 3300031665 Bacteria 2528
99 Ga0316579_10012727 3300031691 Bacteria 3605
100 Ga0316576_10082816 3300031727 Bacteria 2382
101 Ga0316576_10313964 3300031727 Bacteria 1170
102 Ga0316576_10467210 3300031727 Bacteria 930
103 Ga0316578_10015471 3300031728 Bacteria 4102
104 Ga0316578_10201195 3300031728 Bacteria 1199
105 Ga0316577_10067137 3300031733 Bacteria 2002
106 Ga0316577_10227239 3300031733 Bacteria 1055
107 Ga0307410_10328740 3300031852 Bacteria 1215
108 Ga0307407_10075793 3300031903 Bacteria 2018
109 Ga0307407_10788569 3300031903 Bacteria 722
110 Ga0307412_10831586 3300031911 Bacteria 804
111 Ga0307412_10923654 3300031911 Bacteria 766
112 Ga0307409_100288067 3300031995 Bacteria 1521
113 Ga0307409_100462986 3300031995 Bacteria 1226
114 Ga0307409_100564448 3300031995 Bacteria 1119
115 Ga0307409_100682722 3300031995 Bacteria 1024
116 Ga0307409_101276522 3300031995 Bacteria 759
117 Ga0307414_10308931 3300032004 Bacteria 1341
118 Ga0307414_10408378 3300032004 Bacteria 1181
119 Ga0307411_10344626 3300032005 Bacteria 1212
120 Ga0307411_11157191 3300032005 Bacteria 700
121 Ga0307411_11850353 3300032005 Bacteria 561
122 Ga0307415_100089906 3300032126 Bacteria 2220
123 Ga0307415_100218606 3300032126 Bacteria 1526
124 Ga0307415_100867624 3300032126 Bacteria 829
125 Ga0316583_10014260 3300032133 Bacteria 2866
126 Ga0316585_10091355 3300032137 Bacteria 995
127 Ga0316580_10028748 3300032139 Bacteria 1719
128 Ga0316596_1119221 3300033541 Bacteria 718
129 Ga0373928_0073947 3300035084 Bacteria 848
130 Ga0316574_0032546 3300035398 Bacteria 3169
131 Ga0316574_0035588 3300035398 Bacteria 3044
132 Ga0316574_0080748 3300035398 Bacteria 2064
133 Ga0316582_0003686 3300036647 Bacteria 7572
134 Ga0316584_0001112 3300036712 Bacteria 15745
135 Ga0316584_0101041 3300036712 Bacteria 2159
136 Ga0395899_0487097 3300037312 Bacteria 802
137 Ga0395898_0861239 3300037466 Bacteria 845
138 Ga0395901_0039310 3300038443 Bacteria 4896
139 Ga0395901_0376418 3300038443 Bacteria 1462
140 Ga0451791_0725243 3300041451 Bacteria 2258
141 Ga0451797_0605972 3300041453 Bacteria 511
142 Ga0451804_0421689 3300041463 Bacteria 614
143 Ga0451833_1345330 3300041491 Bacteria 799
144 Ga0451837_1841227 3300041494 Bacteria 1353
145 Ga0451839_0310386 3300041496 Bacteria 652
146 Ga0451839_1008823 3300041496 Bacteria 595
147 Ga0451849_0467778 3300041505 Bacteria 581
148 Ga0451843_0070532 3300041509 Bacteria 1222
149 Ga0451843_0568051 3300041509 Bacteria 576
150 Ga0451853_2164010 3300041512 Bacteria 1318
151 Ga0439463_155410 3300042016 Bacteria 593
152 Ga0450907_007290 3300042146 Bacteria 1848
153 Ga0439464_0152870 3300042439 Bacteria 722
154 Ga0466972_0467071 3300044658 Bacteria 593
155 Ga0466965_0085472 3300044683 Bacteria 1599
156 Ga0466965_0342275 3300044683 Bacteria 818
157 Ga0466966_0128721 3300044684 Bacteria 1551
158 Ga0466961_0122180 3300044693 Bacteria 1634
159 Ga0466961_0323304 3300044693 Bacteria 941
160 Ga0466963_0096750 3300044694 Bacteria 2016
161 Ga0466963_0204707 3300044694 Bacteria 1380
162 Ga0466970_0082604 3300044765 Bacteria 1738
163 Ga0466970_0769812 3300044765 Bacteria 563
164 Ga0466957_0064333 3300044842 Bacteria 2256
165 Ga0466957_0264744 3300044842 Bacteria 1146
166 Ga0466960_0001833 3300044901 Bacteria 7807
167 Ga0466960_0058209 3300044901 Bacteria 1887
168 Ga0466967_0052197 3300045976 Bacteria 3587
169 Ga0495620_0079234 3300046515 Bacteria 1331
170 Ga0496100_0363395 3300048903 Bacteria 1096
171 Ga0496102_0069567 3300048905 Bacteria 3231
172 Ga0496107_0217893 3300048910 Bacteria 1420
173 Ga0496110_0707438 3300048913 Bacteria 909
174 Ga0496111_0429093 3300048914 Bacteria 976
175 Ga0496111_0984677 3300048914 Bacteria 605
176 Ga0496114_0737212 3300048917 Bacteria 862
177 Ga0496114_1621020 3300048917 Bacteria 535
178 Ga0496124_0123970 3300048927 Bacteria 2061
179 Ga0501031_0001081 3300049568 Bacteria 16565
180 Ga0501031_0010677 3300049568 Bacteria 5982
181 Ga0501031_0134985 3300049568 Bacteria 1612
182 Ga0501031_0230096 3300049568 Bacteria 1206
183 Ga0501032_0022276 3300049569 Bacteria 4393
184 Ga0501032_0044863 3300049569 Bacteria 2991
185 Ga0501033_0017657 3300049570 Bacteria 5389
186 Ga0501034_0641055 3300049571 Bacteria 965
187 Ga0501036_0001655 3300049572 Bacteria 17262
188 Ga0501036_0015450 3300049572 Bacteria 6377
189 Ga0501036_0044326 3300049572 Bacteria 3768
190 Ga0501036_0274506 3300049572 Bacteria 1411
191 Ga0501037_0078746 3300049573 Bacteria 2392
192 Ga0501037_0147594 3300049573 Bacteria 1682
193 Ga0501037_0198822 3300049573 Bacteria 1417
194 Ga0501038_0053405 3300049574 Bacteria 3479
195 Ga0501038_0117486 3300049574 Bacteria 2197
196 Ga0501038_0446057 3300049574 Bacteria 996
197 Ga0501038_0970584 3300049574 Bacteria 625
198 Ga0501039_0004118 3300049575 Bacteria 10938
199 Ga0501039_0013602 3300049575 Bacteria 6224
200 Ga0501039_0057592 3300049575 Bacteria 3009
201 Ga0501039_0589496 3300049575 Bacteria 871
202 Ga0501039_1102093 3300049575 Bacteria 615
203 Ga0501040_0007216 3300049576 Bacteria 7198
204 Ga0501040_0013889 3300049576 Bacteria 5301
205 Ga0501040_0098115 3300049576 Bacteria 2042
206 Ga0501040_0524004 3300049576 Bacteria 855
207 Ga0501041_0006558 3300049577 Bacteria 6814
208 Ga0501041_0023838 3300049577 Bacteria 3671
209 Ga0501041_0232648 3300049577 Bacteria 1157
210 Ga0501041_0301107 3300049577 Bacteria 1010
211 Ga0501042_0001683 3300049578 Bacteria 13182
212 Ga0501042_0017020 3300049578 Bacteria 5005
213 Ga0501042_0172158 3300049578 Bacteria 1562
214 Ga0501042_0714200 3300049578 Bacteria 729
215 Ga0501043_0057587 3300049579 Bacteria 3051
216 Ga0501043_0747230 3300049579 Bacteria 711
217 Ga0501046_0011182 3300049580 Bacteria 7690
218 Ga0501046_0118325 3300049580 Bacteria 2018
219 Ga0501048_0009264 3300049582 Bacteria 7396
220 Ga0501048_0223585 3300049582 Bacteria 1336
221 Ga0501067_0074521 3300049583 Bacteria 1881
222 Ga0501067_0864807 3300049583 Bacteria 510
223 Ga0501069_0126933 3300049585 Bacteria 1459
224 Ga0501069_0348373 3300049585 Bacteria 873
225 Ga0501070_1320902 3300049586 Bacteria 550
226 Ga0501071_0008321 3300049587 Bacteria 6852
227 Ga0501071_0032874 3300049587 Bacteria 3685
228 Ga0501071_0125174 3300049587 Bacteria 1907
229 Ga0501071_0301068 3300049587 Bacteria 1216
230 Ga0501071_0858595 3300049587 Bacteria 700
231 Ga0501072_0012516 3300049588 Bacteria 6487
232 Ga0501072_0019580 3300049588 Bacteria 5234
233 Ga0501073_0130657 3300049589 Bacteria 1741
234 Ga0501073_0178729 3300049589 Bacteria 1468
235 Ga0501073_0348755 3300049589 Bacteria 1022
236 Ga0501074_0018439 3300049590 Bacteria 5070
237 Ga0501074_0063712 3300049590 Bacteria 2655
238 Ga0501074_0384477 3300049590 Bacteria 996
239 Ga0501074_1175159 3300049590 Bacteria 538
240 Ga0501075_0005045 3300049591 Bacteria 9017
241 Ga0501075_0409389 3300049591 Bacteria 1034
242 Ga0501075_0473533 3300049591 Bacteria 955
243 Ga0501075_1546838 3300049591 Bacteria 502
244 Ga0501076_0003589 3300049592 Bacteria 10899
245 Ga0501076_0021523 3300049592 Bacteria 4947
246 Ga0501076_0201477 3300049592 Bacteria 1625
247 Ga0501076_1392251 3300049592 Bacteria 576
248 Ga0501077_0030856 3300049593 Bacteria 3411
249 Ga0501077_0058266 3300049593 Bacteria 2452
250 Ga0501077_0386149 3300049593 Bacteria 895
251 Ga0501079_0004162 3300049741 Bacteria 10719
252 Ga0501079_0043814 3300049741 Bacteria 3454
253 Ga0501079_0477244 3300049741 Bacteria 980
254 Ga0501079_0792619 3300049741 Bacteria 746
255 Ga0501079_1616694 3300049741 Bacteria 510
256 Ga0501080_0008691 3300049742 Bacteria 9222
257 Ga0501080_0236319 3300049742 Bacteria 1669
258 Ga0501080_0697058 3300049742 Bacteria 896
259 Ga0501081_0001410 3300049743 Bacteria 14691
260 Ga0501081_0066292 3300049743 Bacteria 2511
261 Ga0501081_0408277 3300049743 Bacteria 1006
262 Ga0501081_0454939 3300049743 Bacteria 951
263 Ga0501081_0604513 3300049743 Bacteria 821
264 Ga0501081_1328754 3300049743 Bacteria 545
265 Ga0501083_0161083 3300049744 Bacteria 1468
266 Ga0501083_0343706 3300049744 Bacteria 970
267 Ga0501035_0013412 3300049822 Bacteria 7564
268 Ga0501035_0026789 3300049822 Bacteria 5273
269 Ga0501035_0323265 3300049822 Bacteria 1296
270 Ga0501035_0968863 3300049822 Bacteria 670
271 Ga0501044_0182605 3300049823 Bacteria 2064
272 Ga0501044_1120889 3300049823 Bacteria 656
273 Ga0501045_0002699 3300049824 Bacteria 12117
274 Ga0501045_0008942 3300049824 Bacteria 6996
275 Ga0501045_0468242 3300049824 Bacteria 936
276 Ga0501045_0504150 3300049824 Bacteria 899
277 Ga0501045_0702072 3300049824 Bacteria 746
278 nmdc:mga03n38_2205_c1 3300050490 Bacteria 5948
279 nmdc:mga03n38_349915_c1 3300050490 Bacteria 804
280 nmdc:mga03n38_429626_c1 3300050490 Bacteria 732
281 nmdc:mga03n38_56459_c1 3300050490 Bacteria 1772
282 nmdc:mga03n38_67909_c1 3300050490 Bacteria 1642
283 nmdc:mga00v17_109773_c1 3300050491 Bacteria 1749
284 nmdc:mga00v17_125921_c1 3300050491 Bacteria 1634
285 nmdc:mga00v17_205533_c1 3300050491 Bacteria 1274
286 nmdc:mga00v17_331960_c1 3300050491 Bacteria 988
287 nmdc:mga00v17_493950_c1 3300050491 Bacteria 794
288 nmdc:mga00v17_573327_c1 3300050491 Bacteria 729
289 nmdc:mga00v17_809639_c1 3300050491 Bacteria 596
290 nmdc:mga0yw44_133866_c1 3300050492 Bacteria 1607
291 nmdc:mga0yw44_163149_c1 3300050492 Bacteria 1460
292 nmdc:mga0yw44_270735_c1 3300050492 Bacteria 1134
293 nmdc:mga0yw44_333090_c1 3300050492 Bacteria 1020
294 nmdc:mga0yw44_343838_c1 3300050492 Bacteria 1004
295 nmdc:mga0yw44_435929_c1 3300050492 Bacteria 888
296 nmdc:mga0yw44_457717_c1 3300050492 Bacteria 865
297 nmdc:mga0yw44_55341_c1 3300050492 Bacteria 2414
298 nmdc:mga0yw44_61043_c1 3300050492 Bacteria 2311
299 nmdc:mga0yw44_658776_c1 3300050492 Bacteria 711
300 nmdc:mga0yw44_668766_c1 3300050492 Bacteria 706
301 nmdc:mga0yw44_801137_c1 3300050492 Bacteria 640
302 nmdc:mga0yw44_891391_c1 3300050492 Bacteria 603
303 nmdc:mga0yw44_9249_c1 3300050492 Bacteria 4963
304 nmdc:mga06z11_112055_c1 3300050494 Bacteria 1512
305 nmdc:mga06z11_374917_c1 3300050494 Bacteria 854
306 nmdc:mga06z11_630525_c1 3300050494 Bacteria 652
307 nmdc:mga04h51_207773_c1 3300050495 Bacteria 772
308 nmdc:mga04h51_267745_c1 3300050495 Bacteria 689
309 nmdc:mga04h51_53339_c1 3300050495 Bacteria 1364
310 nmdc:mga07m45_126381_c1 3300050496 Bacteria 1478
311 nmdc:mga07m45_36501_c1 3300050496 Bacteria 2738
312 nmdc:mga07m45_436555_c1 3300050496 Bacteria 759
313 nmdc:mga07m45_49505_c1 3300050496 Bacteria 2365
314 nmdc:mga08y16_647380_c1 3300050511 Bacteria 1061
315 Ga0500554_042556 3300053102 Bacteria 1400
316 Ga0500556_0004963 3300053104 Bacteria 3765
317 Ga0500593_001254 3300053117 Bacteria 9166
318 Ga0500573_0062586 3300053140 Bacteria 2130
319 Ga0501084_0004747 3300054114 Bacteria 11106
320 Ga0501084_0103655 3300054114 Bacteria 2389
321 Ga0501084_0153128 3300054114 Bacteria 1944
322 Ga0501082_0046348 3300060353 Bacteria 3747
323 Ga0501082_0156445 3300060353 Bacteria 1980
324 Ga0501082_0269033 3300060353 Bacteria 1483
325 Ga0501082_0292361 3300060353 Bacteria 1418
326 Ga0501082_0716568 3300060353 Bacteria 876
327 Ga0466962_0046879 3300061719 Bacteria 2065
328 Ga0530510_0002302 3300061734 Bacteria 13088
329 Ga0530510_0070493 3300061734 Bacteria 2537
330 2644093023 2643221615 Bacteria 5487866
331 2644322634 2643221657 Bacteria 5490246
332 2740168223 2739367898 Bacteria 4367674
333 Ga0495618_0304609
334 Ga0068868_100627075
335 Ga0070660_100316083
336 Ga0070689_100571909
337 Ga0070661_100474767
338 Ga0070668_101821702
339 Ga0070675_100646623
340 Ga0070667_100036687
341 Ga0070667_100123312
342 Ga0070700_101130898
343 Ga0070686_100373826
344 Ga0070664_100048874
345 Ga0070664_100842801
346 Ga0068857_100225510
347 Ga0070702_100204518
348 Ga0068861_100033179
349 Ga0068861_100514917
350 Ga0068870_11321711
351 Ga0068860_100003554
352 Ga0068860_102494810
353 Ga0068862_101137250
354 Ga0081539_10115817
355 Ga0075365_10009835
356 Ga0075365_10028168
357 Ga0075365_10064611
358 Ga0075365_10067064
359 Ga0075365_10144522
360 Ga0075365_10154922
361 Ga0075365_10170599
362 Ga0075365_10180572
363 Ga0075365_10252082
364 Ga0075365_10253540
365 Ga0075365_10276011
366 Ga0075365_10362619
367 Ga0075365_10481813
368 Ga0075365_10517343
369 Ga0075365_10561062
370 Ga0075365_10714787
371 Ga0075365_10793285
372 Ga0075368_10130147
373 Ga0075363_100037096
374 Ga0075363_100049885
375 Ga0075363_100066977
376 Ga0075363_100148262
377 Ga0075363_100209875
378 Ga0075363_100236126
379 Ga0075363_100252447
380 Ga0075363_100294081
381 Ga0075364_10104511
382 Ga0075364_10105621
383 Ga0075364_10142898
384 Ga0075364_10143762
385 Ga0075364_10522174
386 Ga0075364_10540660
387 Ga0075364_10720842
388 Ga0075364_10832667
389 Ga0075367_10120524
390 Ga0075367_10173743
391 Ga0075367_10481623
392 Ga0075367_10570420
393 Ga0075367_10675003
394 Ga0075367_10697460
395 Ga0075370_10012675
396 Ga0075370_10013133
397 Ga0075370_10061413
398 Ga0075370_10518815
399 Ga0075370_10567599
400 Ga0075370_10681099
401 Ga0075370_10828113
402 Ga0111539_10725994
403 Ga0105243_11349896
404 Ga0157378_12596165
405 Ga0157375_10537717
406 Ga0157375_10592656
407 Ga0163163_10208589
408 Ga0157380_10066547
409 Ga0157377_11254405
410 Ga0163161_10425482
411 Ga0163161_11356400
412 Ga0207643_10359873
413 Ga0207662_10118235
414 Ga0207649_10156984
415 Ga0207669_10351724
416 Ga0207691_10556877
417 Ga0207679_10021120
418 Ga0207679_10717612
419 Ga0207712_10638359
420 Ga0207658_10042678
421 Ga0207674_10221774
422 Ga0207675_100695912
423 Ga0207683_10733061
424 Ga0209813_10021805
425 Ga0209813_10209038
426 Ga0268264_10000437
427 Ga0268264_11852997
428 Ga0316178_1042484
429 Ga0307408_102246447
430 Ga0316575_10020640
431 Ga0316579_10012727
432 Ga0316576_10082816
433 Ga0316576_10313964
434 Ga0316576_10467210
435 Ga0316578_10015471
436 Ga0316578_10201195
437 Ga0316577_10067137
438 Ga0316577_10227239
439 Ga0307410_10328740
440 Ga0307407_10075793
441 Ga0307407_10788569
442 Ga0307412_10831586
443 Ga0307412_10923654
444 Ga0307409_100288067
445 Ga0307409_100462986
446 Ga0307409_100564448
447 Ga0307409_100682722
448 Ga0307409_101276522
449 Ga0307414_10308931
450 Ga0307414_10408378
451 Ga0307411_10344626
452 Ga0307411_11157191
453 Ga0307411_11850353
454 Ga0307415_100089906
455 Ga0307415_100218606
456 Ga0307415_100867624
457 Ga0316583_10014260
458 Ga0316585_10091355
459 Ga0316580_10028748
460 Ga0316596_1119221
461 Ga0373928_0073947
462 Ga0316574_0032546
463 Ga0316574_0035588
464 Ga0316574_0080748
465 Ga0316582_0003686
466 Ga0316584_0001112
467 Ga0316584_0101041
468 Ga0395899_0487097
469 Ga0395898_0861239
470 Ga0395901_0039310
471 Ga0395901_0376418
472 Ga0451791_0725243
473 Ga0451797_0605972
474 Ga0451804_0421689
475 Ga0451833_1345330
476 Ga0451837_1841227
477 Ga0451839_0310386
478 Ga0451839_1008823
479 Ga0451849_0467778
480 Ga0451843_0070532
481 Ga0451843_0568051
482 Ga0451853_2164010
483 Ga0439463_155410
484 Ga0450907_007290
485 Ga0439464_0152870
486 Ga0466972_0467071
487 Ga0466965_0085472
488 Ga0466965_0342275
489 Ga0466966_0128721
490 Ga0466961_0122180
491 Ga0466961_0323304
492 Ga0466963_0096750
493 Ga0466963_0204707
494 Ga0466970_0082604
495 Ga0466970_0769812
496 Ga0466957_0064333
497 Ga0466957_0264744
498 Ga0466960_0001833
499 Ga0466960_0058209
500 Ga0466967_0052197
501 Ga0495620_0079234
502 Ga0496100_0363395
503 Ga0496102_0069567
504 Ga0496107_0217893
505 Ga0496110_0707438
506 Ga0496111_0429093
507 Ga0496111_0984677
508 Ga0496114_0737212
509 Ga0496114_1621020
510 Ga0496124_0123970
511 Ga0501031_0001081
512 Ga0501031_0010677
513 Ga0501031_0134985
514 Ga0501031_0230096
515 Ga0501032_0022276
516 Ga0501032_0044863
517 Ga0501033_0017657
518 Ga0501034_0641055
519 Ga0501036_0001655
520 Ga0501036_0015450
521 Ga0501036_0044326
522 Ga0501036_0274506
523 Ga0501037_0078746
524 Ga0501037_0147594
525 Ga0501037_0198822
526 Ga0501038_0053405
527 Ga0501038_0117486
528 Ga0501038_0446057
529 Ga0501038_0970584
530 Ga0501039_0004118
531 Ga0501039_0013602
532 Ga0501039_0057592
533 Ga0501039_0589496
534 Ga0501039_1102093
535 Ga0501040_0007216
536 Ga0501040_0013889
537 Ga0501040_0098115
538 Ga0501040_0524004
539 Ga0501041_0006558
540 Ga0501041_0023838
541 Ga0501041_0232648
542 Ga0501041_0301107
543 Ga0501042_0001683
544 Ga0501042_0017020
545 Ga0501042_0172158
546 Ga0501042_0714200
547 Ga0501043_0057587
548 Ga0501043_0747230
549 Ga0501046_0011182
550 Ga0501046_0118325
551 Ga0501048_0009264
552 Ga0501048_0223585
553 Ga0501067_0074521
554 Ga0501067_0864807
555 Ga0501069_0126933
556 Ga0501069_0348373
557 Ga0501070_1320902
558 Ga0501071_0008321
559 Ga0501071_0032874
560 Ga0501071_0125174
561 Ga0501071_0301068
562 Ga0501071_0858595
563 Ga0501072_0012516
564 Ga0501072_0019580
565 Ga0501073_0130657
566 Ga0501073_0178729
567 Ga0501073_0348755
568 Ga0501074_0018439
569 Ga0501074_0063712
570 Ga0501074_0384477
571 Ga0501074_1175159
572 Ga0501075_0005045
573 Ga0501075_0409389
574 Ga0501075_0473533
575 Ga0501075_1546838
576 Ga0501076_0003589
577 Ga0501076_0021523
578 Ga0501076_0201477
579 Ga0501076_1392251
580 Ga0501077_0030856
581 Ga0501077_0058266
582 Ga0501077_0386149
583 Ga0501079_0004162
584 Ga0501079_0043814
585 Ga0501079_0477244
586 Ga0501079_0792619
587 Ga0501079_1616694
588 Ga0501080_0008691
589 Ga0501080_0236319
590 Ga0501080_0697058
591 Ga0501081_0001410
592 Ga0501081_0066292
593 Ga0501081_0408277
594 Ga0501081_0454939
595 Ga0501081_0604513
596 Ga0501081_1328754
597 Ga0501083_0161083
598 Ga0501083_0343706
599 Ga0501035_0013412
600 Ga0501035_0026789
601 Ga0501035_0323265
602 Ga0501035_0968863
603 Ga0501044_0182605
604 Ga0501044_1120889
605 Ga0501045_0002699
606 Ga0501045_0008942
607 Ga0501045_0468242
608 Ga0501045_0504150
609 Ga0501045_0702072
610 nmdc:mga03n38_2205_c1
611 nmdc:mga03n38_349915_c1
612 nmdc:mga03n38_429626_c1
613 nmdc:mga03n38_56459_c1
614 nmdc:mga03n38_67909_c1
615 nmdc:mga00v17_109773_c1
616 nmdc:mga00v17_125921_c1
617 nmdc:mga00v17_205533_c1
618 nmdc:mga00v17_331960_c1
619 nmdc:mga00v17_493950_c1
620 nmdc:mga00v17_573327_c1
621 nmdc:mga00v17_809639_c1
622 nmdc:mga0yw44_133866_c1
623 nmdc:mga0yw44_163149_c1
624 nmdc:mga0yw44_270735_c1
625 nmdc:mga0yw44_333090_c1
626 nmdc:mga0yw44_343838_c1
627 nmdc:mga0yw44_435929_c1
628 nmdc:mga0yw44_457717_c1
629 nmdc:mga0yw44_55341_c1
630 nmdc:mga0yw44_61043_c1
631 nmdc:mga0yw44_658776_c1
632 nmdc:mga0yw44_668766_c1
633 nmdc:mga0yw44_801137_c1
634 nmdc:mga0yw44_891391_c1
635 nmdc:mga0yw44_9249_c1
636 nmdc:mga06z11_112055_c1
637 nmdc:mga06z11_374917_c1
638 nmdc:mga06z11_630525_c1
639 nmdc:mga04h51_207773_c1
640 nmdc:mga04h51_267745_c1
641 nmdc:mga04h51_53339_c1
642 nmdc:mga07m45_126381_c1
643 nmdc:mga07m45_36501_c1
644 nmdc:mga07m45_436555_c1
645 nmdc:mga07m45_49505_c1
646 nmdc:mga08y16_647380_c1
647 Ga0500554_042556
648 Ga0500556_0004963
649 Ga0500593_001254
650 Ga0500573_0062586
651 Ga0501084_0004747
652 Ga0501084_0103655
653 Ga0501084_0153128
654 Ga0501082_0046348
655 Ga0501082_0156445
656 Ga0501082_0269033
657 Ga0501082_0292361
658 Ga0501082_0716568
659 Ga0466962_0046879
660 Ga0530510_0002302
661 Ga0530510_0070493
662 2644093023
663 2644322634
664 2740168223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

1

84

0.85

PF01575

MaoC_dehydratas

MaoC like domain

1

113

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9404 4 130
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9401 4 130
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9222 1 130
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.9172 1 130
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.9153 1 130
ID Description Score Start End Superfamily
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9335 4 130 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9143 1 130 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.906 4 130 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9013 4 130 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8909 4 130 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1I3HZC3-F1-model_v4 Acyl dehydratase 0.9977 5 129 GO:0004312
GO:0005835
GO:0006633
AF-A0A1I3HZC3-F1-model_v4 Acyl dehydratase 0.9898 5 129 GO:0004312
GO:0005835
GO:0006633
AF-A0A4Q4Z6E4-F1-model_v4 Acyl dehydratase 0.9767 5 129 GO:0004312
GO:0005835
GO:0006633
AF-A0A5D0US70-F1-model_v4 Acyl dehydratase 0.9585 4 130 GO:0004312
GO:0005835
GO:0006633
AF-E3BBL1-F1-model_v4 deleted 0.9578 5 128

Map