F411051

General Info

Members Datasets Scaffolds Average Seq Length
332 196 664 216

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0578607|Ga0466967_0578607_228_1016
Length 262
Sequence MAVLMIQRIAAAHLIIDRAGRRASAARTTMAVGLALPRAGSVAPVTPLRVVVAEDQVLLREGLSRLLADAGFEVVAQAGDAVDLRRKVAAHHPDVAVIDVQMPPDRTDDGLRAAIEIRREHPETGILMLSQFRDEAYALDLIGENAGGVGYLLKDRIADIDSFADAVRRVAGGGSALDPEIVGLMVGRRRKHDPLEALTPREHQVLVLMAEGKSNLGIAESLSVSLAAVEKHVGRIFGKLGLGSEPLEHRRVLAVLTLLRAS

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
192 2919395869 Microbacterium resistens 2980 Isolate Unclassified
193 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
194 8002775197 Frankia nepalensis CN7 Isolate Nodule
195 8002784119 Frankia sp. AgB1.9 Isolate Nodule
196 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0.9
Rhizoplane 6.33
Rhizosphere 86.45
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0578607 3300045976 Bacteria 1107
2 JGI24740J21852_10003734 3300001979 Bacteria 6627
3 JGI25406J46586_10024759 3300003203 Bacteria 2345
4 Ga0070658_10000249 3300005327 Bacteria 47842
5 Ga0070658_10547910 3300005327 Bacteria 1001
6 Ga0070683_100015835 3300005329 Bacteria 6631
7 Ga0070683_100034673 3300005329 Bacteria 4611
8 Ga0070683_100043608 3300005329 Bacteria 4135
9 Ga0070683_100363727 3300005329 Bacteria 1378
10 Ga0070683_100848025 3300005329 Bacteria 876
11 Ga0070670_100058803 3300005331 Bacteria 3300
12 Ga0068869_100024314 3300005334 Bacteria 4196
13 Ga0070682_100232702 3300005337 Bacteria 1318
14 Ga0070682_100541595 3300005337 Bacteria 909
15 Ga0068868_100055013 3300005338 Bacteria 3139
16 Ga0068868_100128726 3300005338 Bacteria 2070
17 Ga0068868_100228685 3300005338 Bacteria 1560
18 Ga0070687_100016110 3300005343 Bacteria 3399
19 Ga0070661_100036177 3300005344 Bacteria 3589
20 Ga0070661_100501122 3300005344 Bacteria 972
21 Ga0070668_100284883 3300005347 Bacteria 1381
22 Ga0070668_100506932 3300005347 Bacteria 1045
23 Ga0070675_100042402 3300005354 Bacteria 3718
24 Ga0070675_100936172 3300005354 Bacteria 795
25 Ga0070673_100549210 3300005364 Bacteria 1049
26 Ga0070659_100015261 3300005366 Bacteria 5751
27 Ga0070714_100017376 3300005435 Bacteria 5827
28 Ga0070714_100390041 3300005435 Bacteria 1314
29 Ga0070711_100165145 3300005439 Bacteria 1682
30 Ga0070700_100043554 3300005441 Bacteria 2761
31 Ga0070700_100560840 3300005441 Bacteria 889
32 Ga0070663_100005600 3300005455 Bacteria 7476
33 Ga0070663_100038671 3300005455 Bacteria 3329
34 Ga0070678_100388541 3300005456 Bacteria 1209
35 Ga0070662_100044973 3300005457 Bacteria 3166
36 Ga0070685_10017018 3300005466 Bacteria 3884
37 Ga0070679_100183037 3300005530 Bacteria 2067
38 Ga0070684_100053097 3300005535 Bacteria 3526
39 Ga0070684_100137984 3300005535 Bacteria 2204
40 Ga0070684_100565786 3300005535 Bacteria 1055
41 Ga0070672_100567960 3300005543 Bacteria 986
42 Ga0070696_100008728 3300005546 Bacteria 6783
43 Ga0070665_100002655 3300005548 Bacteria 19445
44 Ga0070664_100038630 3300005564 Bacteria 4019
45 Ga0070664_100047563 3300005564 Bacteria 3624
46 Ga0070664_100401924 3300005564 Bacteria 1253
47 Ga0068857_100231691 3300005577 Bacteria 1689
48 Ga0068857_100722100 3300005577 Bacteria 948
49 Ga0068856_100460168 3300005614 Bacteria 1293
50 Ga0068856_100472987 3300005614 Bacteria 1274
51 Ga0068856_100525972 3300005614 Bacteria 1204
52 Ga0070702_100216926 3300005615 Bacteria 1277
53 Ga0070702_100561431 3300005615 Bacteria 849
54 Ga0068852_100096542 3300005616 Bacteria 2657
55 Ga0068859_100000043 3300005617 Bacteria 156893
56 Ga0068864_100061343 3300005618 Bacteria 3257
57 Ga0068864_100087702 3300005618 Bacteria 2740
58 Ga0068864_100149561 3300005618 Bacteria 2114
59 Ga0068864_100596820 3300005618 Bacteria 1071
60 Ga0068863_100001661 3300005841 Bacteria 21998
61 Ga0068862_100000009 3300005844 Bacteria 298620
62 Ga0068862_100051849 3300005844 Bacteria 3510
63 Ga0081455_10028536 3300005937 Bacteria 5098
64 Ga0081455_10194788 3300005937 Bacteria 1523
65 Ga0081538_10011558 3300005981 Bacteria 7144
66 Ga0081538_10073782 3300005981 Bacteria 1862
67 Ga0081539_10004671 3300005985 Bacteria 14864
68 Ga0070717_10013795 3300006028 Bacteria 6202
69 Ga0070717_10019073 3300006028 Bacteria 5371
70 Ga0070717_10284878 3300006028 Bacteria 1466
71 Ga0075365_10312132 3300006038 Bacteria 1107
72 Ga0075431_100123539 3300006847 Bacteria 2671
73 Ga0075429_100495064 3300006880 Bacteria 1071
74 Ga0068865_100087236 3300006881 Bacteria 2255
75 Ga0068865_100142739 3300006881 Bacteria 1807
76 Ga0097620_100000043 3300006931 Bacteria 156893
77 Ga0111539_10120986 3300009094 Bacteria 3067
78 Ga0111539_11262768 3300009094 Bacteria 857
79 Ga0105245_10043607 3300009098 Bacteria 4001
80 Ga0105245_10076666 3300009098 Bacteria 3046
81 Ga0105245_10163611 3300009098 Bacteria 2113
82 Ga0105245_10179434 3300009098 Bacteria 2022
83 Ga0105243_10357415 3300009148 Bacteria 1343
84 Ga0105241_10465363 3300009174 Bacteria 1121
85 Ga0105237_10067373 3300009545 Bacteria 3573
86 Ga0105237_11049686 3300009545 Bacteria 822
87 Ga0105237_11094900 3300009545 Bacteria 803
88 Ga0105238_10844701 3300009551 Bacteria 933
89 Ga0105249_10015909 3300009553 Bacteria 6667
90 Ga0157371_10114561 3300013102 Bacteria 1915
91 Ga0157369_10807616 3300013105 Bacteria 964
92 Ga0157374_10661138 3300013296 Bacteria 1057
93 Ga0157372_10622570 3300013307 Bacteria 1258
94 Ga0157372_10991897 3300013307 Bacteria 973
95 Ga0157372_11748612 3300013307 Bacteria 715
96 Ga0157375_10559328 3300013308 Bacteria 1305
97 Ga0157375_10804482 3300013308 Bacteria 1088
98 Ga0163163_10002266 3300014325 Bacteria 16224
99 Ga0163163_10043638 3300014325 Bacteria 4397
100 Ga0163163_10332473 3300014325 Bacteria 1574
101 Ga0163163_10581429 3300014325 Bacteria 1183
102 Ga0157380_10314781 3300014326 Bacteria 1448
103 Ga0157380_10389980 3300014326 Bacteria 1317
104 Ga0157380_10825404 3300014326 Bacteria 946
105 Ga0157377_10031432 3300014745 Bacteria 2885
106 Ga0157377_10053001 3300014745 Bacteria 2292
107 Ga0157379_10047474 3300014968 Bacteria 3831
108 Ga0157376_10252871 3300014969 Bacteria 1647
109 Ga0213876_10131564 3300021384 Bacteria 1330
110 Ga0213875_10011793 3300021388 Bacteria 4337
111 Ga0207705_10544808 3300025909 Bacteria 902
112 Ga0207671_10030472 3300025914 Bacteria 4023
113 Ga0207662_10320629 3300025918 Bacteria 1034
114 Ga0207649_10023059 3300025920 Bacteria 3601
115 Ga0207659_10135543 3300025926 Bacteria 1905
116 Ga0207659_10415024 3300025926 Bacteria 1128
117 Ga0207659_10690144 3300025926 Bacteria 874
118 Ga0207687_10127992 3300025927 Bacteria 1910
119 Ga0207687_10770995 3300025927 Bacteria 819
120 Ga0207664_10099547 3300025929 Bacteria 2399
121 Ga0207664_10391052 3300025929 Bacteria 1236
122 Ga0207664_10415602 3300025929 Bacteria 1198
123 Ga0207690_10012173 3300025932 Bacteria 5148
124 Ga0207709_10226234 3300025935 Bacteria 1352
125 Ga0207709_10545822 3300025935 Bacteria 911
126 Ga0207669_10385571 3300025937 Bacteria 1093
127 Ga0207704_10079822 3300025938 Bacteria 2110
128 Ga0207704_10117295 3300025938 Bacteria 1813
129 Ga0207691_10529708 3300025940 Bacteria 999
130 Ga0207689_10300307 3300025942 Bacteria 1331
131 Ga0207661_10033295 3300025944 Bacteria 3999
132 Ga0207661_10290016 3300025944 Bacteria 1464
133 Ga0207679_10058084 3300025945 Bacteria 2865
134 Ga0207679_10083850 3300025945 Bacteria 2444
135 Ga0207679_10285608 3300025945 Bacteria 1417
136 Ga0207679_10332179 3300025945 Bacteria 1319
137 Ga0207651_10450708 3300025960 Bacteria 1104
138 Ga0207712_10035022 3300025961 Bacteria 3406
139 Ga0207668_10124710 3300025972 Bacteria 1956
140 Ga0207677_10221290 3300026023 Bacteria 1518
141 Ga0207677_10673048 3300026023 Bacteria 916
142 Ga0207678_10010012 3300026067 Bacteria 8320
143 Ga0207708_10035493 3300026075 Bacteria 3794
144 Ga0207702_10305608 3300026078 Bacteria 1511
145 Ga0207641_10005215 3300026088 Bacteria 11116
146 Ga0207676_10084271 3300026095 Bacteria 2591
147 Ga0207676_10161266 3300026095 Bacteria 1943
148 Ga0207676_10470775 3300026095 Bacteria 1188
149 Ga0207674_10093318 3300026116 Bacteria 2999
150 Ga0207698_10052448 3300026142 Bacteria 3125
151 Ga0207698_10124843 3300026142 Bacteria 2187
152 Ga0207698_10658894 3300026142 Bacteria 1038
153 Ga0268266_10011227 3300028379 Bacteria 7795
154 Ga0268266_10147472 3300028379 Bacteria 2117
155 Ga0268265_10000050 3300028380 Bacteria 175787
156 Ga0268265_10099546 3300028380 Bacteria 2344
157 Ga0316177_1109758 3300030731 Bacteria 3387
158 Ga0307513_10578224 3300031456 Bacteria 834
159 Ga0307408_100008670 3300031548 Bacteria 6716
160 Ga0307408_100029586 3300031548 Bacteria 3796
161 Ga0307408_100101976 3300031548 Bacteria 2188
162 Ga0307408_100146545 3300031548 Bacteria 1859
163 Ga0307508_10346635 3300031616 Bacteria 1077
164 Ga0307405_10057502 3300031731 Bacteria 2444
165 Ga0307405_10439482 3300031731 Bacteria 1031
166 Ga0307413_10013784 3300031824 Bacteria 4080
167 Ga0307413_10019001 3300031824 Bacteria 3620
168 Ga0307413_10044822 3300031824 Bacteria 2617
169 Ga0307410_10000200 3300031852 Bacteria 22497
170 Ga0307410_10003083 3300031852 Bacteria 8256
171 Ga0307410_10199868 3300031852 Bacteria 1525
172 Ga0307410_10557583 3300031852 Bacteria 950
173 Ga0307406_10000043 3300031901 Bacteria 71775
174 Ga0307406_10277345 3300031901 Bacteria 1277
175 Ga0307406_10327821 3300031901 Bacteria 1187
176 Ga0307407_10000680 3300031903 Bacteria 10976
177 Ga0307407_10000849 3300031903 Bacteria 10207
178 Ga0307407_10041956 3300031903 Bacteria 2562
179 Ga0307412_10046199 3300031911 Unclassified 2852
180 Ga0307412_10105889 3300031911 Bacteria 1998
181 Ga0307412_10172464 3300031911 Bacteria 1619
182 Ga0307412_10322464 3300031911 Bacteria 1230
183 Ga0307409_100000091 3300031995 Bacteria 32395
184 Ga0307409_100014369 3300031995 Bacteria 5147
185 Ga0307409_100040673 3300031995 Bacteria 3464
186 Ga0307409_100040836 3300031995 Bacteria 3458
187 Ga0307409_100689388 3300031995 Bacteria 1020
188 Ga0307416_100000142 3300032002 Bacteria 42204
189 Ga0307416_100316078 3300032002 Bacteria 1561
190 Ga0307416_100432718 3300032002 Bacteria 1363
191 Ga0307411_10388687 3300032005 Bacteria 1150
192 Ga0307415_100003649 3300032126 Bacteria 7876
193 Ga0307415_100018372 3300032126 Bacteria 4221
194 Ga0307415_100025101 3300032126 Bacteria 3734
195 Ga0395900_0208356 3300037418 Bacteria 1975
196 Ga0395900_0822343 3300037418 Bacteria 856
197 Ga0395898_0054899 3300037466 Bacteria 3886
198 Ga0395898_0145699 3300037466 Bacteria 2267
199 Ga0436364_1000426 3300037853 Bacteria 33245
200 Ga0395901_0074479 3300038443 Bacteria 3542
201 Ga0395901_0767599 3300038443 Bacteria 956
202 Ga0395901_0812997 3300038443 Bacteria 923
203 Ga0395901_1265299 3300038443 Bacteria 701
204 Ga0436365_1660742 3300039437 Bacteria 1123
205 Ga0436363_0192092 3300039450 Bacteria 3191
206 Ga0451791_1305973 3300041451 Bacteria 5315
207 Ga0451791_1848299 3300041451 Bacteria 827
208 Ga0451793_0403571 3300041452 Bacteria 17013
209 Ga0451797_0557741 3300041453 Bacteria 3947
210 Ga0451795_0680889 3300041456 Bacteria 1838
211 Ga0451833_0052774 3300041491 Bacteria 868
212 Ga0451833_1277479 3300041491 Bacteria 2188
213 Ga0451841_0605510 3300041498 Bacteria 1702
214 Ga0451843_1495472 3300041509 Bacteria 5005
215 Ga0451853_0730917 3300041512 Bacteria 2836
216 Ga0439448_0119398 3300042005 Bacteria 904
217 Ga0439463_022766 3300042016 Bacteria 1569
218 Ga0439440_0028224 3300042993 Bacteria 1309
219 Ga0439440_0056295 3300042993 Bacteria 994
220 Ga0466972_0006602 3300044658 Bacteria 5827
221 Ga0466965_0003576 3300044683 Bacteria 6838
222 Ga0466965_0023827 3300044683 Bacteria 2957
223 Ga0466968_0003368 3300044735 Bacteria 5906
224 Ga0466968_0095038 3300044735 Bacteria 1325
225 Ga0466960_0001174 3300044901 Bacteria 9426
226 Ga0466960_0032147 3300044901 Bacteria 2427
227 Ga0466960_0052750 3300044901 Bacteria 1968
228 Ga0466960_0464580 3300044901 Bacteria 737
229 Ga0466959_0192180 3300045049 Bacteria 1424
230 Ga0466967_0062743 3300045976 Bacteria 3300
231 Ga0495603_0239162 3300046455 Bacteria 1046
232 Ga0495629_0371341 3300046459 Bacteria 974
233 Ga0495641_0018014 3300046461 Bacteria 3658
234 Ga0495650_0000121 3300046471 Bacteria 183055
235 Ga0495644_0066305 3300046523 Unclassified 1356
236 Ga0495663_0079981 3300046525 Bacteria 1052
237 Ga0495640_0094758 3300046533 Bacteria 1966
238 Ga0495645_0279980 3300046543 Bacteria 1097
239 Ga0495633_0231344 3300046558 Bacteria 845
240 Ga0495656_0098441 3300046615 Bacteria 1349
241 Ga0495656_0185782 3300046615 Bacteria 1024
242 Ga0495635_0183425 3300046663 Bacteria 1422
243 Ga0495614_0140423 3300048089 Bacteria 1073
244 Ga0496101_0454047 3300048904 Bacteria 1011
245 Ga0496105_0015708 3300048908 Bacteria 6040
246 Ga0496108_0181138 3300048911 Bacteria 1825
247 Ga0496108_0433491 3300048911 Bacteria 1148
248 Ga0496109_0003404 3300048912 Bacteria 13310
249 Ga0496109_0008905 3300048912 Bacteria 8552
250 Ga0496110_0013077 3300048913 Bacteria 6849
251 Ga0496111_0002198 3300048914 Bacteria 11692
252 Ga0496111_0398116 3300048914 Bacteria 1018
253 Ga0496113_0175480 3300048916 Bacteria 1698
254 Ga0496113_0361727 3300048916 Bacteria 1164
255 Ga0496114_0005780 3300048917 Bacteria 9713
256 Ga0496114_0031347 3300048917 Bacteria 4375
257 Ga0496114_0090473 3300048917 Bacteria 2598
258 Ga0496114_1040285 3300048917 Bacteria 703
259 Ga0496115_0589720 3300048918 Bacteria 885
260 Ga0496118_0064691 3300048921 Bacteria 2682
261 Ga0496119_0003580 3300048922 Bacteria 16045
262 Ga0496120_0094956 3300048923 Bacteria 1586
263 Ga0501031_0190753 3300049568 Bacteria 1338
264 Ga0501033_0006000 3300049570 Bacteria 9532
265 Ga0501033_0042477 3300049570 Bacteria 3390
266 Ga0501034_0014202 3300049571 Bacteria 8208
267 Ga0501034_0024589 3300049571 Bacteria 6127
268 Ga0501036_0015175 3300049572 Bacteria 6433
269 Ga0501036_0051896 3300049572 Bacteria 3473
270 Ga0501037_0044094 3300049573 Bacteria 3277
271 Ga0501037_0089553 3300049573 Bacteria 2226
272 Ga0501038_0012590 3300049574 Bacteria 7730
273 Ga0501038_0066150 3300049574 Bacteria 3079
274 Ga0501038_0164328 3300049574 Bacteria 1802
275 Ga0501039_0034018 3300049575 Bacteria 3932
276 Ga0501040_0123311 3300049576 Bacteria 1819
277 Ga0501040_0166353 3300049576 Bacteria 1560
278 Ga0501041_0037661 3300049577 Bacteria 2931
279 Ga0501042_0016606 3300049578 Bacteria 5057
280 Ga0501042_0022353 3300049578 Bacteria 4419
281 Ga0501047_0067347 3300049581 Bacteria 3451
282 Ga0501047_0101146 3300049581 Bacteria 2762
283 Ga0501047_0730767 3300049581 Bacteria 806
284 Ga0501068_0133873 3300049584 Bacteria 1551
285 Ga0501068_0262373 3300049584 Bacteria 1102
286 Ga0501069_0004355 3300049585 Bacteria 7306
287 Ga0501070_0078260 3300049586 Bacteria 2737
288 Ga0501071_0022992 3300049587 Bacteria 4350
289 Ga0501071_0027356 3300049587 Bacteria 4011
290 Ga0501072_0008925 3300049588 Bacteria 7620
291 Ga0501072_0077109 3300049588 Bacteria 2638
292 Ga0501073_0029483 3300049589 Bacteria 3920
293 Ga0501073_0272259 3300049589 Bacteria 1168
294 Ga0501074_0021527 3300049590 Bacteria 4681
295 Ga0501074_0076215 3300049590 Bacteria 2407
296 Ga0501074_0160789 3300049590 Bacteria 1604
297 Ga0501075_0019702 3300049591 Bacteria 4897
298 Ga0501076_0035613 3300049592 Bacteria 3894
299 Ga0501076_0049323 3300049592 Bacteria 3329
300 Ga0501077_0121384 3300049593 Bacteria 1656
301 Ga0501079_0523315 3300049741 Bacteria 932
302 Ga0501080_0046378 3300049742 Bacteria 4046
303 Ga0501080_0080518 3300049742 Bacteria 3027
304 Ga0501080_0579515 3300049742 Bacteria 997
305 Ga0501081_0130193 3300049743 Bacteria 1797
306 Ga0501083_0006297 3300049744 Bacteria 8417
307 Ga0501035_0105943 3300049822 Bacteria 2465
308 Ga0501035_0135913 3300049822 Bacteria 2140
309 Ga0501035_0346767 3300049822 Bacteria 1243
310 Ga0501044_0070064 3300049823 Bacteria 3568
311 Ga0501044_0548790 3300049823 Bacteria 1053
312 Ga0501045_0000884 3300049824 Bacteria 19484
313 Ga0501045_0022981 3300049824 Bacteria 4468
314 nmdc:mga06r32_799694_c1 3300050510 Bacteria 904
315 nmdc:mga08y16_230217_c1 3300050511 Bacteria 1917
316 nmdc:mga08y16_314615_c1 3300050511 Bacteria 1612
317 Ga0495619_0435139 3300053085 Bacteria 905
318 Ga0500644_0000164 3300053088 Bacteria 41953
319 Ga0500556_0000788 3300053104 Bacteria 18652
320 Ga0500616_0004419 3300053153 Bacteria 10030
321 Ga0500599_016569 3300053736 Bacteria 1018
322 Ga0501084_0019393 3300054114 Bacteria 5666
323 Ga0501084_0029178 3300054114 Bacteria 4614
324 Ga0501084_0165318 3300054114 Bacteria 1867
325 Ga0501082_0074897 3300060353 Bacteria 2916
326 Ga0530510_0037522 3300061734 Bacteria 3496
327 2723643278 2721755702 Bacteria 4373124
328 2919396482 2919395869 Bacteria 3704152
329 2946044747 2946041624 Bacteria 4191385
330 8002781523 8002775197 Bacteria 10728764
331 8002788991 8002784119 Bacteria 9788632
332 8054923595 8054920844 Bacteria 7068637
333 Ga0466967_0578607
334 JGI24740J21852_10003734
335 JGI25406J46586_10024759
336 Ga0070658_10000249
337 Ga0070658_10547910
338 Ga0070683_100015835
339 Ga0070683_100034673
340 Ga0070683_100043608
341 Ga0070683_100363727
342 Ga0070683_100848025
343 Ga0070670_100058803
344 Ga0068869_100024314
345 Ga0070682_100232702
346 Ga0070682_100541595
347 Ga0068868_100055013
348 Ga0068868_100128726
349 Ga0068868_100228685
350 Ga0070687_100016110
351 Ga0070661_100036177
352 Ga0070661_100501122
353 Ga0070668_100284883
354 Ga0070668_100506932
355 Ga0070675_100042402
356 Ga0070675_100936172
357 Ga0070673_100549210
358 Ga0070659_100015261
359 Ga0070714_100017376
360 Ga0070714_100390041
361 Ga0070711_100165145
362 Ga0070700_100043554
363 Ga0070700_100560840
364 Ga0070663_100005600
365 Ga0070663_100038671
366 Ga0070678_100388541
367 Ga0070662_100044973
368 Ga0070685_10017018
369 Ga0070679_100183037
370 Ga0070684_100053097
371 Ga0070684_100137984
372 Ga0070684_100565786
373 Ga0070672_100567960
374 Ga0070696_100008728
375 Ga0070665_100002655
376 Ga0070664_100038630
377 Ga0070664_100047563
378 Ga0070664_100401924
379 Ga0068857_100231691
380 Ga0068857_100722100
381 Ga0068856_100460168
382 Ga0068856_100472987
383 Ga0068856_100525972
384 Ga0070702_100216926
385 Ga0070702_100561431
386 Ga0068852_100096542
387 Ga0068859_100000043
388 Ga0068864_100061343
389 Ga0068864_100087702
390 Ga0068864_100149561
391 Ga0068864_100596820
392 Ga0068863_100001661
393 Ga0068862_100000009
394 Ga0068862_100051849
395 Ga0081455_10028536
396 Ga0081455_10194788
397 Ga0081538_10011558
398 Ga0081538_10073782
399 Ga0081539_10004671
400 Ga0070717_10013795
401 Ga0070717_10019073
402 Ga0070717_10284878
403 Ga0075365_10312132
404 Ga0075431_100123539
405 Ga0075429_100495064
406 Ga0068865_100087236
407 Ga0068865_100142739
408 Ga0097620_100000043
409 Ga0111539_10120986
410 Ga0111539_11262768
411 Ga0105245_10043607
412 Ga0105245_10076666
413 Ga0105245_10163611
414 Ga0105245_10179434
415 Ga0105243_10357415
416 Ga0105241_10465363
417 Ga0105237_10067373
418 Ga0105237_11049686
419 Ga0105237_11094900
420 Ga0105238_10844701
421 Ga0105249_10015909
422 Ga0157371_10114561
423 Ga0157369_10807616
424 Ga0157374_10661138
425 Ga0157372_10622570
426 Ga0157372_10991897
427 Ga0157372_11748612
428 Ga0157375_10559328
429 Ga0157375_10804482
430 Ga0163163_10002266
431 Ga0163163_10043638
432 Ga0163163_10332473
433 Ga0163163_10581429
434 Ga0157380_10314781
435 Ga0157380_10389980
436 Ga0157380_10825404
437 Ga0157377_10031432
438 Ga0157377_10053001
439 Ga0157379_10047474
440 Ga0157376_10252871
441 Ga0213876_10131564
442 Ga0213875_10011793
443 Ga0207705_10544808
444 Ga0207671_10030472
445 Ga0207662_10320629
446 Ga0207649_10023059
447 Ga0207659_10135543
448 Ga0207659_10415024
449 Ga0207659_10690144
450 Ga0207687_10127992
451 Ga0207687_10770995
452 Ga0207664_10099547
453 Ga0207664_10391052
454 Ga0207664_10415602
455 Ga0207690_10012173
456 Ga0207709_10226234
457 Ga0207709_10545822
458 Ga0207669_10385571
459 Ga0207704_10079822
460 Ga0207704_10117295
461 Ga0207691_10529708
462 Ga0207689_10300307
463 Ga0207661_10033295
464 Ga0207661_10290016
465 Ga0207679_10058084
466 Ga0207679_10083850
467 Ga0207679_10285608
468 Ga0207679_10332179
469 Ga0207651_10450708
470 Ga0207712_10035022
471 Ga0207668_10124710
472 Ga0207677_10221290
473 Ga0207677_10673048
474 Ga0207678_10010012
475 Ga0207708_10035493
476 Ga0207702_10305608
477 Ga0207641_10005215
478 Ga0207676_10084271
479 Ga0207676_10161266
480 Ga0207676_10470775
481 Ga0207674_10093318
482 Ga0207698_10052448
483 Ga0207698_10124843
484 Ga0207698_10658894
485 Ga0268266_10011227
486 Ga0268266_10147472
487 Ga0268265_10000050
488 Ga0268265_10099546
489 Ga0316177_1109758
490 Ga0307513_10578224
491 Ga0307408_100008670
492 Ga0307408_100029586
493 Ga0307408_100101976
494 Ga0307408_100146545
495 Ga0307508_10346635
496 Ga0307405_10057502
497 Ga0307405_10439482
498 Ga0307413_10013784
499 Ga0307413_10019001
500 Ga0307413_10044822
501 Ga0307410_10000200
502 Ga0307410_10003083
503 Ga0307410_10199868
504 Ga0307410_10557583
505 Ga0307406_10000043
506 Ga0307406_10277345
507 Ga0307406_10327821
508 Ga0307407_10000680
509 Ga0307407_10000849
510 Ga0307407_10041956
511 Ga0307412_10046199
512 Ga0307412_10105889
513 Ga0307412_10172464
514 Ga0307412_10322464
515 Ga0307409_100000091
516 Ga0307409_100014369
517 Ga0307409_100040673
518 Ga0307409_100040836
519 Ga0307409_100689388
520 Ga0307416_100000142
521 Ga0307416_100316078
522 Ga0307416_100432718
523 Ga0307411_10388687
524 Ga0307415_100003649
525 Ga0307415_100018372
526 Ga0307415_100025101
527 Ga0395900_0208356
528 Ga0395900_0822343
529 Ga0395898_0054899
530 Ga0395898_0145699
531 Ga0436364_1000426
532 Ga0395901_0074479
533 Ga0395901_0767599
534 Ga0395901_0812997
535 Ga0395901_1265299
536 Ga0436365_1660742
537 Ga0436363_0192092
538 Ga0451791_1305973
539 Ga0451791_1848299
540 Ga0451793_0403571
541 Ga0451797_0557741
542 Ga0451795_0680889
543 Ga0451833_0052774
544 Ga0451833_1277479
545 Ga0451841_0605510
546 Ga0451843_1495472
547 Ga0451853_0730917
548 Ga0439448_0119398
549 Ga0439463_022766
550 Ga0439440_0028224
551 Ga0439440_0056295
552 Ga0466972_0006602
553 Ga0466965_0003576
554 Ga0466965_0023827
555 Ga0466968_0003368
556 Ga0466968_0095038
557 Ga0466960_0001174
558 Ga0466960_0032147
559 Ga0466960_0052750
560 Ga0466960_0464580
561 Ga0466959_0192180
562 Ga0466967_0062743
563 Ga0495603_0239162
564 Ga0495629_0371341
565 Ga0495641_0018014
566 Ga0495650_0000121
567 Ga0495644_0066305
568 Ga0495663_0079981
569 Ga0495640_0094758
570 Ga0495645_0279980
571 Ga0495633_0231344
572 Ga0495656_0098441
573 Ga0495656_0185782
574 Ga0495635_0183425
575 Ga0495614_0140423
576 Ga0496101_0454047
577 Ga0496105_0015708
578 Ga0496108_0181138
579 Ga0496108_0433491
580 Ga0496109_0003404
581 Ga0496109_0008905
582 Ga0496110_0013077
583 Ga0496111_0002198
584 Ga0496111_0398116
585 Ga0496113_0175480
586 Ga0496113_0361727
587 Ga0496114_0005780
588 Ga0496114_0031347
589 Ga0496114_0090473
590 Ga0496114_1040285
591 Ga0496115_0589720
592 Ga0496118_0064691
593 Ga0496119_0003580
594 Ga0496120_0094956
595 Ga0501031_0190753
596 Ga0501033_0006000
597 Ga0501033_0042477
598 Ga0501034_0014202
599 Ga0501034_0024589
600 Ga0501036_0015175
601 Ga0501036_0051896
602 Ga0501037_0044094
603 Ga0501037_0089553
604 Ga0501038_0012590
605 Ga0501038_0066150
606 Ga0501038_0164328
607 Ga0501039_0034018
608 Ga0501040_0123311
609 Ga0501040_0166353
610 Ga0501041_0037661
611 Ga0501042_0016606
612 Ga0501042_0022353
613 Ga0501047_0067347
614 Ga0501047_0101146
615 Ga0501047_0730767
616 Ga0501068_0133873
617 Ga0501068_0262373
618 Ga0501069_0004355
619 Ga0501070_0078260
620 Ga0501071_0022992
621 Ga0501071_0027356
622 Ga0501072_0008925
623 Ga0501072_0077109
624 Ga0501073_0029483
625 Ga0501073_0272259
626 Ga0501074_0021527
627 Ga0501074_0076215
628 Ga0501074_0160789
629 Ga0501075_0019702
630 Ga0501076_0035613
631 Ga0501076_0049323
632 Ga0501077_0121384
633 Ga0501079_0523315
634 Ga0501080_0046378
635 Ga0501080_0080518
636 Ga0501080_0579515
637 Ga0501081_0130193
638 Ga0501083_0006297
639 Ga0501035_0105943
640 Ga0501035_0135913
641 Ga0501035_0346767
642 Ga0501044_0070064
643 Ga0501044_0548790
644 Ga0501045_0000884
645 Ga0501045_0022981
646 nmdc:mga06r32_799694_c1
647 nmdc:mga08y16_230217_c1
648 nmdc:mga08y16_314615_c1
649 Ga0495619_0435139
650 Ga0500644_0000164
651 Ga0500556_0000788
652 Ga0500616_0004419
653 Ga0500599_016569
654 Ga0501084_0019393
655 Ga0501084_0029178
656 Ga0501084_0165318
657 Ga0501082_0074897
658 Ga0530510_0037522
659 2723643278
660 2919396482
661 2946044747
662 8002781523
663 8002788991
664 8054923595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

196

247

0.96

PF00072

Response_reg

Response regulator receiver domain

50

167

0.94

PF08281

Sigma70_r4_2

Sigma-70, region 4

193

240

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9631 152 216
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9582 150 216
7r3e-assembly1.cif.gz_A fusion construct of pqse and rhlr in complex with the synthetic antagonist mbtl 0.9573 154 212
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9567 151 216
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9553 153 216
ID Description Score Start End Superfamily
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9651 154 216 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9553 154 216 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.955 154 213 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9524 154 213 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9518 154 216 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y7IIA2-F1-model_v4 Response regulator transcription factor 0.9877 1 75 GO:0000160
AF-A9WTE0-F1-model_v4 Two-component response regulator 0.9872 1 88 GO:0000160
AF-A0A538JGH7-F1-model_v4 Response regulator 0.9871 2 132 GO:0000160
GO:0004016
GO:0009190
AF-A0A6H9YBC7-F1-model_v4 Response regulator transcription factor 0.9868 1 138 GO:0000160
GO:0003677
AF-A0A3N0DSD5-F1-model_v4 Response regulator 0.9864 2 139 GO:0000160
GO:0004016
GO:0009190

Map