F411048

General Info

Members Datasets Scaffolds Average Seq Length
332 226 332 266

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0101243|Ga0451576_0101243_219_1139
Length 306
Sequence MHEGRRRRLCIYSCRIMAVQHYENFPVASVLLPAPLREPVAAIYGFARSADDFADEGELLPQQRRALLAGYQAELDAIGRHEATQHPVFLRLRPVIARYELPLQLFRDLLDAFIQDVGKDRYADFAELMDYCRRSADPVGRLLLHLFGQATAANLARSDAICSALQLINHWQDVGIDAAKGANGRIYLPQDEMARFGVDDGDILRRSVGKPASAVPGDTASHNFRQLLRFQVDRARALMLAGAPLGWDLPGRIGLEIRAIVAGGLRILDKIEAVDYDVFNRRPQLQPLDWPLILWQALVRPVDTNS

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
211 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.7
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10129247 3300005295 Bacteria 1951
2 Ga0070690_100001138 3300005330 Bacteria 13686
3 Ga0070690_100076043 3300005330 Bacteria 2190
4 Ga0068869_100006042 3300005334 Bacteria 7659
5 Ga0068869_100320159 3300005334 Bacteria 1258
6 Ga0070680_100003330 3300005336 Bacteria 11993
7 Ga0070680_100025834 3300005336 Bacteria 4695
8 Ga0070680_100320311 3300005336 Bacteria 1316
9 Ga0070682_100005403 3300005337 Bacteria 7113
10 Ga0068868_100000502 3300005338 Bacteria 26087
11 Ga0070689_100002575 3300005340 Bacteria 11890
12 Ga0070689_100353868 3300005340 Bacteria 1232
13 Ga0070691_10050163 3300005341 Bacteria 1991
14 Ga0070691_10252320 3300005341 Bacteria 947
15 Ga0070687_100000646 3300005343 Bacteria 11533
16 Ga0070687_100077587 3300005343 Bacteria 1803
17 Ga0070692_10006501 3300005345 Bacteria 5080
18 Ga0070692_10114366 3300005345 Bacteria 1497
19 Ga0070668_100014334 3300005347 Bacteria 5923
20 Ga0070669_100002406 3300005353 Bacteria 13540
21 Ga0070671_100059801 3300005355 Bacteria 3172
22 Ga0070674_100242185 3300005356 Bacteria 1412
23 Ga0070673_100283842 3300005364 Bacteria 1453
24 Ga0070688_100206265 3300005365 Bacteria 1378
25 Ga0070710_10088963 3300005437 Bacteria 1818
26 Ga0070701_10002627 3300005438 Bacteria 6960
27 Ga0070701_10160818 3300005438 Bacteria 1301
28 Ga0070705_100001778 3300005440 Bacteria 11152
29 Ga0070700_100001025 3300005441 Bacteria 13799
30 Ga0070700_100063320 3300005441 Bacteria 2339
31 Ga0070700_100512903 3300005441 Bacteria 925
32 Ga0070694_100002449 3300005444 Bacteria 10959
33 Ga0070708_100241732 3300005445 Bacteria 1695
34 Ga0070662_100260980 3300005457 Bacteria 1396
35 Ga0070681_10056874 3300005458 Bacteria 3892
36 Ga0068867_100001530 3300005459 Bacteria 16047
37 Ga0068867_100003238 3300005459 Bacteria 11477
38 Ga0068867_100186181 3300005459 Bacteria 1654
39 Ga0070679_100011554 3300005530 Bacteria 8415
40 Ga0070697_100355829 3300005536 Bacteria 1265
41 Ga0070697_100359329 3300005536 Bacteria 1259
42 Ga0070697_100394696 3300005536 Bacteria 1200
43 Ga0068853_100088686 3300005539 Bacteria 2716
44 Ga0070672_100276929 3300005543 Bacteria 1418
45 Ga0070686_100002227 3300005544 Bacteria 10698
46 Ga0070686_100272222 3300005544 Bacteria 1245
47 Ga0070695_100041397 3300005545 Bacteria 2920
48 Ga0070696_100011150 3300005546 Bacteria 6014
49 Ga0070693_100000317 3300005547 Bacteria 22200
50 Ga0070704_100001788 3300005549 Bacteria 11801
51 Ga0068855_100016225 3300005563 Bacteria 8957
52 Ga0068854_100021470 3300005578 Bacteria 4382
53 Ga0068856_100092298 3300005614 Bacteria 3013
54 Ga0070702_100011950 3300005615 Bacteria 4333
55 Ga0068859_100011290 3300005617 Bacteria 8988
56 Ga0068866_10001236 3300005718 Bacteria 11080
57 Ga0068861_100000995 3300005719 Bacteria 17287
58 Ga0068861_100047159 3300005719 Bacteria 3251
59 Ga0068858_100000972 3300005842 Bacteria 29656
60 Ga0068860_100007711 3300005843 Bacteria 10765
61 Ga0068860_100725390 3300005843 Bacteria 1005
62 Ga0068862_100004606 3300005844 Bacteria 11620
63 Ga0068862_100008982 3300005844 Bacteria 8276
64 Ga0068862_100125765 3300005844 Bacteria 2263
65 Ga0070716_100204459 3300006173 Bacteria 1315
66 Ga0097621_100107818 3300006237 Bacteria 2351
67 Ga0068871_100002717 3300006358 Bacteria 12071
68 Ga0075428_100004159 3300006844 Bacteria 15930
69 Ga0075430_100206686 3300006846 Bacteria 1629
70 Ga0075431_100682721 3300006847 Bacteria 1005
71 Ga0075433_10017097 3300006852 Bacteria 5998
72 Ga0075434_100001549 3300006871 Bacteria 19478
73 Ga0075434_100006056 3300006871 Bacteria 11061
74 Ga0075429_100223157 3300006880 Bacteria 1650
75 Ga0068865_100002670 3300006881 Bacteria 10589
76 Ga0075436_100006194 3300006914 Bacteria 8205
77 Ga0097620_100011290 3300006931 Bacteria 8988
78 Ga0075435_100044633 3300007076 Bacteria 3550
79 Ga0099794_10008903 3300007265 Bacteria 4184
80 Ga0111539_10085687 3300009094 Bacteria 3702
81 Ga0111539_10122266 3300009094 Bacteria 3051
82 Ga0111539_10224880 3300009094 Bacteria 2186
83 Ga0111539_10683193 3300009094 Bacteria 1195
84 Ga0105245_10011132 3300009098 Bacteria 7830
85 Ga0114129_10748341 3300009147 Bacteria 1251
86 Ga0105243_10004737 3300009148 Bacteria 10701
87 Ga0105243_10058417 3300009148 Bacteria 3074
88 Ga0105241_10069419 3300009174 Bacteria 2732
89 Ga0105242_10002129 3300009176 Bacteria 15614
90 Ga0105249_10021746 3300009553 Bacteria 5743
91 Ga0105249_10051917 3300009553 Bacteria 3743
92 Ga0105239_10021237 3300010375 Bacteria 7159
93 Ga0157378_10015710 3300013297 Bacteria 6630
94 Ga0163162_10123404 3300013306 Bacteria 2695
95 Ga0163162_10123431 3300013306 Bacteria 2695
96 Ga0157380_10000634 3300014326 Bacteria 21652
97 Ga0157380_10031695 3300014326 Bacteria 4059
98 Ga0157379_10165708 3300014968 Bacteria 1994
99 Ga0157376_10017450 3300014969 Bacteria 5476
100 Ga0207653_10020622 3300025885 Bacteria 2087
101 Ga0207692_10066285 3300025898 Bacteria 1887
102 Ga0207642_10000158 3300025899 Bacteria 19246
103 Ga0207647_10238539 3300025904 Bacteria 1045
104 Ga0207645_10125949 3300025907 Bacteria 1665
105 Ga0207643_10305307 3300025908 Bacteria 991
106 Ga0207707_10476944 3300025912 Bacteria 1066
107 Ga0207660_10015923 3300025917 Bacteria 4971
108 Ga0207660_10019132 3300025917 Bacteria 4574
109 Ga0207662_10002572 3300025918 Bacteria 9139
110 Ga0207681_10002558 3300025923 Bacteria 11550
111 Ga0207659_10013736 3300025926 Bacteria 5200
112 Ga0207687_10007450 3300025927 Bacteria 7205
113 Ga0207706_10147587 3300025933 Bacteria 2069
114 Ga0207686_10002257 3300025934 Bacteria 10571
115 Ga0207686_10133843 3300025934 Bacteria 1704
116 Ga0207709_10001373 3300025935 Bacteria 17075
117 Ga0207709_10028471 3300025935 Bacteria 3230
118 Ga0207670_10003042 3300025936 Bacteria 8850
119 Ga0207670_10147755 3300025936 Bacteria 1740
120 Ga0207670_10316908 3300025936 Bacteria 1226
121 Ga0207669_10033015 3300025937 Bacteria 2915
122 Ga0207704_10039917 3300025938 Bacteria 2738
123 Ga0207704_10696708 3300025938 Bacteria 841
124 Ga0207665_10069921 3300025939 Bacteria 2394
125 Ga0207665_10269806 3300025939 Bacteria 1263
126 Ga0207691_10085253 3300025940 Bacteria 2835
127 Ga0207691_10121776 3300025940 Bacteria 2311
128 Ga0207689_10001237 3300025942 Bacteria 24615
129 Ga0207667_10006231 3300025949 Bacteria 14475
130 Ga0207651_10080462 3300025960 Bacteria 2345
131 Ga0207712_10011067 3300025961 Bacteria 5744
132 Ga0207712_10021236 3300025961 Bacteria 4261
133 Ga0207668_10007330 3300025972 Bacteria 6555
134 Ga0207640_10016117 3300025981 Bacteria 4340
135 Ga0207677_10003856 3300026023 Bacteria 7984
136 Ga0207703_10034736 3300026035 Bacteria 4002
137 Ga0207703_10376191 3300026035 Bacteria 1313
138 Ga0207703_10386878 3300026035 Bacteria 1295
139 Ga0207708_10000635 3300026075 Bacteria 26973
140 Ga0207708_10005893 3300026075 Bacteria 9065
141 Ga0207708_10506955 3300026075 Bacteria 1012
142 Ga0207702_10070794 3300026078 Bacteria 3001
143 Ga0207702_10389396 3300026078 Bacteria 1342
144 Ga0207648_10000297 3300026089 Bacteria 54091
145 Ga0207648_10001242 3300026089 Bacteria 28575
146 Ga0207648_10700162 3300026089 Bacteria 939
147 Ga0207675_100006533 3300026118 Bacteria 11037
148 Ga0207675_100015842 3300026118 Bacteria 7030
149 Ga0207428_10086964 3300027907 Bacteria 2432
150 Ga0268265_10001851 3300028380 Bacteria 16855
151 Ga0268264_10001776 3300028381 Bacteria 19703
152 Ga0307408_100257328 3300031548 Bacteria 1443
153 Ga0307408_100317615 3300031548 Bacteria 1311
154 Ga0316575_10006818 3300031665 Bacteria 4128
155 Ga0307411_10289507 3300032005 Bacteria 1308
156 Ga0373948_0035393 3300034817 Bacteria 1025
157 Ga0373958_0010977 3300034819 Bacteria 1522
158 Ga0373938_0001893 3300034957 Bacteria 3348
159 Ga0373926_0001875 3300035083 Bacteria 6552
160 Ga0373929_0011485 3300035085 Bacteria 1669
161 Ga0373934_0000201 3300035086 Bacteria 22007
162 Ga0373934_0020080 3300035086 Bacteria 2568
163 Ga0373940_0007548 3300035088 Bacteria 2459
164 Ga0373940_0086413 3300035088 Bacteria 934
165 Ga0373944_0008183 3300035089 Bacteria 2820
166 Ga0373923_0119361 3300035111 Bacteria 1177
167 Ga0373936_0011420 3300035113 Bacteria 3360
168 Ga0373941_0064791 3300035115 Bacteria 1198
169 Ga0373953_0196790 3300035117 Bacteria 871
170 Ga0373954_0001301 3300035118 Bacteria 10045
171 Ga0373954_0003010 3300035118 Bacteria 7106
172 Ga0373956_0000736 3300035119 Bacteria 13465
173 Ga0373956_0020849 3300035119 Bacteria 2793
174 Ga0373957_0089177 3300035120 Bacteria 1224
175 Ga0373946_0001952 3300035171 Bacteria 7214
176 Ga0373955_0009176 3300035172 Bacteria 4625
177 Ga0373955_0055957 3300035172 Bacteria 2162
178 Ga0373942_0008021 3300035207 Bacteria 2455
179 Ga0373961_0060515 3300035241 Bacteria 1148
180 Ga0316574_0002350 3300035398 Bacteria 9462
181 Ga0373924_0019006 3300035410 Bacteria 2657
182 Ga0373924_0021964 3300035410 Bacteria 2491
183 Ga0373931_0013201 3300035691 Bacteria 4020
184 Ga0373931_0081760 3300035691 Bacteria 1784
185 Ga0373935_0037046 3300035692 Bacteria 3051
186 Ga0373927_0010462 3300035695 Bacteria 6184
187 Ga0373927_0151787 3300035695 Bacteria 1517
188 Ga0373933_0000456 3300035724 Bacteria 25602
189 Ga0373933_0065518 3300035724 Bacteria 2200
190 Ga0373947_0130016 3300035725 Bacteria 1607
191 Ga0373937_0036109 3300036401 Bacteria 4502
192 Ga0373937_0048014 3300036401 Bacteria 3906
193 Ga0373937_0082607 3300036401 Bacteria 2973
194 Ga0373937_0267455 3300036401 Bacteria 1613
195 Ga0373925_0085940 3300037068 Bacteria 2399
196 Ga0451577_0000891 3300042876 Bacteria 44308
197 Ga0451577_0024624 3300042876 Bacteria 5474
198 Ga0451577_0117296 3300042876 Bacteria 2384
199 Ga0451577_0168862 3300042876 Bacteria 1971
200 Ga0451577_0290533 3300042876 Bacteria 1481
201 Ga0453683_0114056 3300044673 Bacteria 1700
202 Ga0453683_0223647 3300044673 Bacteria 1197
203 Ga0453684_0000005 3300044712 Bacteria 1431632
204 Ga0453684_0000356 3300044712 Bacteria 189329
205 Ga0453684_0003069 3300044712 Bacteria 38658
206 Ga0453684_0006338 3300044712 Bacteria 22578
207 Ga0453684_0011062 3300044712 Bacteria 15236
208 Ga0451576_0000227 3300045051 Bacteria 137818
209 Ga0451576_0000461 3300045051 Bacteria 92083
210 Ga0451576_0001930 3300045051 Bacteria 33143
211 Ga0451576_0084787 3300045051 Bacteria 3296
212 Ga0451576_0089666 3300045051 Bacteria 3198
213 Ga0451576_0101243 3300045051 Bacteria 2996
214 Ga0451576_0136447 3300045051 Bacteria 2559
215 Ga0451576_0547601 3300045051 Bacteria 1215
216 Ga0451576_0718512 3300045051 Bacteria 1049
217 Ga0495592_0002177 3300046454 Bacteria 13792
218 Ga0495592_0021706 3300046454 Bacteria 4884
219 Ga0495592_0184430 3300046454 Bacteria 1419
220 Ga0495603_0014141 3300046455 Bacteria 4829
221 Ga0495651_0009656 3300046462 Bacteria 7418
222 Ga0495653_0196084 3300046463 Bacteria 1374
223 Ga0495580_0001000 3300046472 Bacteria 24868
224 Ga0495582_0015057 3300046473 Bacteria 4253
225 Ga0495605_0101920 3300046474 Bacteria 1318
226 Ga0495639_0012783 3300046475 Bacteria 3622
227 Ga0495662_0018061 3300046476 Bacteria 3412
228 Ga0495584_0140408 3300046491 Bacteria 1227
229 Ga0495608_0016997 3300046511 Bacteria 5032
230 Ga0495608_0328112 3300046511 Unclassified 944
231 Ga0495618_0018101 3300046514 Bacteria 4325
232 Ga0495628_0029851 3300046516 Bacteria 4418
233 Ga0495628_0181570 3300046516 Bacteria 1591
234 Ga0495630_0017650 3300046517 Bacteria 5230
235 Ga0495630_0076742 3300046517 Bacteria 2518
236 Ga0495630_0111166 3300046517 Bacteria 2075
237 Ga0495643_0028233 3300046522 Bacteria 3148
238 Ga0495663_0057441 3300046525 Bacteria 1217
239 Ga0495666_0017184 3300046526 Bacteria 3603
240 Ga0495652_0014578 3300046529 Bacteria 7049
241 Ga0495652_0177682 3300046529 Bacteria 1637
242 Ga0495640_0003081 3300046533 Bacteria 13436
243 Ga0495640_0030440 3300046533 Bacteria 3865
244 Ga0495586_0008493 3300046535 Bacteria 5465
245 Ga0495586_0012530 3300046535 Bacteria 4498
246 Ga0495587_0015728 3300046536 Bacteria 4718
247 Ga0495598_0054172 3300046537 Bacteria 1217
248 Ga0495598_0058072 3300046537 Bacteria 1186
249 Ga0495645_0000794 3300046543 Bacteria 21665
250 Ga0495645_0298994 3300046543 Bacteria 1052
251 Ga0495667_0104196 3300046559 Bacteria 1834
252 Ga0495667_0219642 3300046559 Bacteria 1213
253 Ga0495656_0005124 3300046615 Bacteria 4517
254 Ga0495656_0037111 3300046615 Bacteria 2010
255 Ga0495634_0189044 3300046642 Bacteria 1285
256 Ga0495635_0352041 3300046663 Bacteria 982
257 Ga0495659_0035204 3300046664 Bacteria 1764
258 Ga0495659_0059470 3300046664 Bacteria 1408
259 Ga0495588_0043055 3300046674 Bacteria 2309
260 Ga0495657_0029556 3300046675 Bacteria 3843
261 Ga0495599_0007636 3300046678 Bacteria 6567
262 Ga0495599_0041957 3300046678 Bacteria 2871
263 Ga0495623_0111120 3300046679 Bacteria 1661
264 Ga0495647_0000528 3300046681 Bacteria 11189
265 Ga0495658_0009064 3300046683 Bacteria 4947
266 Ga0495669_0100666 3300046684 Bacteria 1342
267 Ga0495613_0004264 3300046689 Bacteria 10706
268 Ga0495624_0063878 3300046690 Bacteria 2301
269 Ga0495600_0036574 3300046809 Bacteria 3191
270 Ga0495604_0024418 3300047317 Bacteria 4822
271 Ga0495680_0007469 3300047322 Bacteria 10016
272 Ga0495680_0234245 3300047322 Bacteria 1306
273 Ga0495675_0056515 3300047444 Bacteria 2488
274 Ga0495675_0107356 3300047444 Bacteria 1744
275 Ga0495615_0025023 3300048090 Bacteria 1382
276 Ga0495626_0077207 3300048091 Bacteria 1485
277 Ga0496124_0006518 3300048927 Bacteria 12700
278 Ga0501291_009175 3300049514 Bacteria 1382
279 Ga0501031_0014405 3300049568 Bacteria 5140
280 Ga0501032_0108137 3300049569 Bacteria 1841
281 Ga0501033_0006736 3300049570 Bacteria 8974
282 Ga0501036_0017789 3300049572 Bacteria 5952
283 Ga0501037_0019106 3300049573 Bacteria 5052
284 Ga0501038_0001136 3300049574 Bacteria 24136
285 Ga0501039_0001836 3300049575 Bacteria 15672
286 Ga0501040_0002478 3300049576 Bacteria 11888
287 Ga0501040_0090546 3300049576 Bacteria 2126
288 Ga0501041_0003134 3300049577 Bacteria 9518
289 Ga0501041_0142417 3300049577 Bacteria 1495
290 Ga0501042_0006020 3300049578 Bacteria 7853
291 Ga0501042_0037351 3300049578 Bacteria 3448
292 Ga0501043_0028404 3300049579 Bacteria 4391
293 Ga0501046_0009501 3300049580 Bacteria 8403
294 Ga0501048_0004002 3300049582 Bacteria 11198
295 Ga0501048_0278110 3300049582 Bacteria 1190
296 Ga0501068_0001814 3300049584 Bacteria 11339
297 Ga0501071_0004464 3300049587 Bacteria 8882
298 Ga0501071_0134785 3300049587 Bacteria 1837
299 Ga0501072_0002529 3300049588 Bacteria 13693
300 Ga0501072_0209850 3300049588 Bacteria 1552
301 Ga0501074_0029199 3300049590 Bacteria 3994
302 Ga0501075_0003779 3300049591 Bacteria 10178
303 Ga0501075_0019433 3300049591 Bacteria 4927
304 Ga0501075_0416176 3300049591 Bacteria 1025
305 Ga0501076_0014873 3300049592 Bacteria 5872
306 Ga0501077_0003413 3300049593 Bacteria 9551
307 Ga0501077_0109784 3300049593 Bacteria 1748
308 Ga0501079_0002808 3300049741 Bacteria 12697
309 Ga0501080_0052837 3300049742 Bacteria 3782
310 Ga0501081_0032521 3300049743 Bacteria 3538
311 Ga0501081_0075381 3300049743 Bacteria 2355
312 Ga0501280_001170 3300049776 Bacteria 5172
313 Ga0501283_007198 3300049779 Bacteria 1579
314 Ga0501044_0232617 3300049823 Bacteria 1790
315 Ga0501045_0004211 3300049824 Bacteria 9928
316 nmdc:mga05p37_112776_c1 3300050507 Bacteria 3344
317 nmdc:mga09592_1934_c1 3300050508 Bacteria 16664
318 nmdc:mga09592_251189_c1 3300050508 Bacteria 1533
319 nmdc:mga0qj67_19454_c1 3300050509 Bacteria 5187
320 nmdc:mga08y16_27087_c1 3300050511 Bacteria 6041
321 nmdc:mga08y16_88202_c1 3300050511 Bacteria 3233
322 nmdc:mga0n895_307_c1 3300050512 Bacteria 32508
323 nmdc:mga0n895_9013_c1 3300050512 Bacteria 8701
324 nmdc:mga0rr50_18554_c1 3300050513 Bacteria 4676
325 nmdc:mga08x19_3961_c1 3300050514 Bacteria 8815
326 nmdc:mga0a205_30972_c1 3300050515 Bacteria 5124
327 Ga0495601_0288886 3300053077 Bacteria 1069
328 Ga0495619_0263297 3300053085 Bacteria 1195
329 Ga0590074_008780 3300059423 Bacteria 1682
330 Ga0501082_0016089 3300060353 Bacteria 6434
331 Ga0530510_0013371 3300061734 Bacteria 5770
332 Ga0530510_0398109 3300061734 Bacteria 1038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025904 Ga0207647_10238539 Ga0207647_102385392 230
2 3300035118 Ga0373954_0003010 Ga0373954_0003010_6341_7084 244
3 3300046559 Ga0495667_0104196 Ga0495667_0104196_23_766 244
4 3300046522 Ga0495643_0028233 Ga0495643_0028233_1861_2670 246
5 3300046537 Ga0495598_0054172 Ga0495598_0054172_140_982 249
6 3300046525 Ga0495663_0057441 Ga0495663_0057441_278_1045 252
7 3300046615 Ga0495656_0005124 Ga0495656_0005124_538_1305 252
8 3300048090 Ga0495615_0025023 Ga0495615_0025023_159_926 252
9 3300048927 Ga0496124_0006518 Ga0496124_0006518_11052_11861 254
10 3300026089 Ga0207648_10700162 Ga0207648_107001621 258
11 3300005334 Ga0068869_100320159 Ga0068869_1003201593 262
12 3300005336 Ga0070680_100025834 Ga0070680_1000258344 262
13 3300005341 Ga0070691_10252320 Ga0070691_102523201 262
14 3300005343 Ga0070687_100077587 Ga0070687_1000775873 262
15 3300005345 Ga0070692_10114366 Ga0070692_101143662 262
16 3300005347 Ga0070668_100014334 Ga0070668_1000143346 262
17 3300005353 Ga0070669_100002406 Ga0070669_1000024065 262
18 3300005356 Ga0070674_100242185 Ga0070674_1002421853 262
19 3300005365 Ga0070688_100206265 Ga0070688_1002062652 262
20 3300005437 Ga0070710_10088963 Ga0070710_100889632 262
21 3300005438 Ga0070701_10160818 Ga0070701_101608183 262
22 3300005441 Ga0070700_100001025 Ga0070700_10000102513 262
23 3300005441 Ga0070700_100512903 Ga0070700_1005129031 262
24 3300005457 Ga0070662_100260980 Ga0070662_1002609802 262
25 3300005459 Ga0068867_100001530 Ga0068867_1000015304 262
26 3300005459 Ga0068867_100186181 Ga0068867_1001861812 262
27 3300005536 Ga0070697_100359329 Ga0070697_1003593293 262
28 3300005543 Ga0070672_100276929 Ga0070672_1002769292 262
29 3300005544 Ga0070686_100272222 Ga0070686_1002722222 262
30 3300005545 Ga0070695_100041397 Ga0070695_1000413972 262
31 3300005719 Ga0068861_100047159 Ga0068861_1000471594 262
32 3300005844 Ga0068862_100008982 Ga0068862_1000089823 262
33 3300005844 Ga0068862_100125765 Ga0068862_1001257653 262
34 3300006173 Ga0070716_100204459 Ga0070716_1002044593 262
35 3300006846 Ga0075430_100206686 Ga0075430_1002066862 262
36 3300006847 Ga0075431_100682721 Ga0075431_1006827212 262
37 3300006871 Ga0075434_100006056 Ga0075434_1000060565 262
38 3300006880 Ga0075429_100223157 Ga0075429_1002231572 262
39 3300009094 Ga0111539_10122266 Ga0111539_101222662 262
40 3300009094 Ga0111539_10224880 Ga0111539_102248802 262
41 3300009094 Ga0111539_10683193 Ga0111539_106831932 262
42 3300009147 Ga0114129_10748341 Ga0114129_107483412 262
43 3300009148 Ga0105243_10058417 Ga0105243_100584172 262
44 3300009553 Ga0105249_10051917 Ga0105249_100519174 262
45 3300013306 Ga0163162_10123404 Ga0163162_101234043 262
46 3300014326 Ga0157380_10000634 Ga0157380_1000063423 262
47 3300025898 Ga0207692_10066285 Ga0207692_100662853 262
48 3300025907 Ga0207645_10125949 Ga0207645_101259492 262
49 3300025908 Ga0207643_10305307 Ga0207643_103053072 262
50 3300025912 Ga0207707_10476944 Ga0207707_104769443 262
51 3300025917 Ga0207660_10019132 Ga0207660_100191324 262
52 3300025923 Ga0207681_10002558 Ga0207681_1000255810 262
53 3300025926 Ga0207659_10013736 Ga0207659_100137366 262
54 3300025933 Ga0207706_10147587 Ga0207706_101475873 262
55 3300025934 Ga0207686_10133843 Ga0207686_101338433 262
56 3300025935 Ga0207709_10028471 Ga0207709_100284712 262
57 3300025936 Ga0207670_10147755 Ga0207670_101477552 262
58 3300025937 Ga0207669_10033015 Ga0207669_100330153 262
59 3300025938 Ga0207704_10039917 Ga0207704_100399173 262
60 3300025938 Ga0207704_10696708 Ga0207704_106967081 262
61 3300025939 Ga0207665_10069921 Ga0207665_100699213 262
62 3300025940 Ga0207691_10085253 Ga0207691_100852534 262
63 3300025961 Ga0207712_10021236 Ga0207712_100212364 262
64 3300025972 Ga0207668_10007330 Ga0207668_100073304 262
65 3300026035 Ga0207703_10386878 Ga0207703_103868781 262
66 3300026075 Ga0207708_10005893 Ga0207708_100058932 262
67 3300026075 Ga0207708_10506955 Ga0207708_105069552 262
68 3300026078 Ga0207702_10389396 Ga0207702_103893961 262
69 3300026089 Ga0207648_10000297 Ga0207648_100002973 262
70 3300026118 Ga0207675_100015842 Ga0207675_1000158428 262
71 3300027907 Ga0207428_10086964 Ga0207428_100869643 262
72 3300028380 Ga0268265_10001851 Ga0268265_1000185113 262
73 3300031548 Ga0307408_100317615 Ga0307408_1003176152 262
74 3300035086 Ga0373934_0020080 Ga0373934_0020080_114_902 262
75 3300035117 Ga0373953_0196790 Ga0373953_0196790_29_817 262
76 3300035119 Ga0373956_0020849 Ga0373956_0020849_600_1388 262
77 3300035120 Ga0373957_0089177 Ga0373957_0089177_271_1059 262
78 3300035172 Ga0373955_0055957 Ga0373955_0055957_184_972 262
79 3300035410 Ga0373924_0021964 Ga0373924_0021964_480_1268 262
80 3300035695 Ga0373927_0151787 Ga0373927_0151787_297_1085 262
81 3300035724 Ga0373933_0065518 Ga0373933_0065518_1232_2020 262
82 3300035725 Ga0373947_0130016 Ga0373947_0130016_635_1423 262
83 3300036401 Ga0373937_0048014 Ga0373937_0048014_764_1552 262
84 3300046454 Ga0495592_0002177 Ga0495592_0002177_2696_3484 262
85 3300046454 Ga0495592_0184430 Ga0495592_0184430_268_1056 262
86 3300046463 Ga0495653_0196084 Ga0495653_0196084_407_1195 262
87 3300046476 Ga0495662_0018061 Ga0495662_0018061_222_1010 262
88 3300046491 Ga0495584_0140408 Ga0495584_0140408_153_941 262
89 3300046511 Ga0495608_0016997 Ga0495608_0016997_1849_2637 262
90 3300046514 Ga0495618_0018101 Ga0495618_0018101_54_842 262
91 3300046516 Ga0495628_0029851 Ga0495628_0029851_2869_3657 262
92 3300046517 Ga0495630_0017650 Ga0495630_0017650_3237_4025 262
93 3300046517 Ga0495630_0076742 Ga0495630_0076742_1575_2363 262
94 3300046529 Ga0495652_0177682 Ga0495652_0177682_300_1088 262
95 3300046533 Ga0495640_0003081 Ga0495640_0003081_9992_10780 262
96 3300046533 Ga0495640_0030440 Ga0495640_0030440_931_1719 262
97 3300046535 Ga0495586_0012530 Ga0495586_0012530_2378_3166 262
98 3300046536 Ga0495587_0015728 Ga0495587_0015728_2430_3218 262
99 3300046537 Ga0495598_0058072 Ga0495598_0058072_21_809 262
100 3300046543 Ga0495645_0298994 Ga0495645_0298994_83_871 262
101 3300046642 Ga0495634_0189044 Ga0495634_0189044_426_1214 262
102 3300046663 Ga0495635_0352041 Ga0495635_0352041_64_852 262
103 3300046664 Ga0495659_0059470 Ga0495659_0059470_464_1252 262
104 3300046678 Ga0495599_0007636 Ga0495599_0007636_2422_3210 262
105 3300046679 Ga0495623_0111120 Ga0495623_0111120_784_1572 262
106 3300046683 Ga0495658_0009064 Ga0495658_0009064_1878_2666 262
107 3300046684 Ga0495669_0100666 Ga0495669_0100666_330_1118 262
108 3300046689 Ga0495613_0004264 Ga0495613_0004264_7393_8181 262
109 3300046690 Ga0495624_0063878 Ga0495624_0063878_290_1078 262
110 3300046809 Ga0495600_0036574 Ga0495600_0036574_1951_2739 262
111 3300047317 Ga0495604_0024418 Ga0495604_0024418_957_1745 262
112 3300047322 Ga0495680_0007469 Ga0495680_0007469_6104_6892 262
113 3300047322 Ga0495680_0234245 Ga0495680_0234245_152_940 262
114 3300047444 Ga0495675_0107356 Ga0495675_0107356_732_1520 262
115 3300049514 Ga0501291_009175 Ga0501291_009175_63_851 262
116 3300049587 Ga0501071_0134785 Ga0501071_0134785_533_1333 262
117 3300049779 Ga0501283_007198 Ga0501283_007198_678_1466 262
118 3300050508 nmdc:mga09592_251189_c1 nmdc:mga09592_251189_c1_332_1120 262
119 3300050509 nmdc:mga0qj67_19454_c1 nmdc:mga0qj67_19454_c1_2535_3323 262
120 3300050511 nmdc:mga08y16_88202_c1 nmdc:mga08y16_88202_c1_1668_2456 262
121 3300050512 nmdc:mga0n895_9013_c1 nmdc:mga0n895_9013_c1_2577_3365 262
122 3300053085 Ga0495619_0263297 Ga0495619_0263297_349_1137 262
123 3300044712 Ga0453684_0011062 Ga0453684_0011062_8883_9719 264
124 3300044712 Ga0453684_0003069 Ga0453684_0003069_20243_21040 265
125 3300049582 Ga0501048_0278110 Ga0501048_0278110_208_1008 266
126 3300005336 Ga0070680_100320311 Ga0070680_1003203112 267
127 3300005536 Ga0070697_100355829 Ga0070697_1003558292 267
128 3300031665 Ga0316575_10006818 Ga0316575_100068182 267
129 3300035086 Ga0373934_0000201 Ga0373934_0000201_9065_9877 267
130 3300035118 Ga0373954_0001301 Ga0373954_0001301_6075_6887 267
131 3300035119 Ga0373956_0000736 Ga0373956_0000736_8580_9392 267
132 3300035172 Ga0373955_0009176 Ga0373955_0009176_586_1398 267
133 3300035398 Ga0316574_0002350 Ga0316574_0002350_4612_5415 267
134 3300035724 Ga0373933_0000456 Ga0373933_0000456_6812_7624 267
135 3300036401 Ga0373937_0036109 Ga0373937_0036109_280_1092 267
136 3300036401 Ga0373937_0082607 Ga0373937_0082607_1396_2208 267
137 3300046454 Ga0495592_0021706 Ga0495592_0021706_2756_3568 267
138 3300046462 Ga0495651_0009656 Ga0495651_0009656_1534_2346 267
139 3300046474 Ga0495605_0101920 Ga0495605_0101920_35_856 267
140 3300046511 Ga0495608_0328112 Ga0495608_0328112_120_932 267
141 3300046516 Ga0495628_0181570 Ga0495628_0181570_682_1494 267
142 3300046529 Ga0495652_0014578 Ga0495652_0014578_1453_2265 267
143 3300046543 Ga0495645_0000794 Ga0495645_0000794_19253_20065 267
144 3300046559 Ga0495667_0219642 Ga0495667_0219642_187_999 267
145 3300046615 Ga0495656_0037111 Ga0495656_0037111_227_1042 267
146 3300046664 Ga0495659_0035204 Ga0495659_0035204_260_1072 267
147 3300046675 Ga0495657_0029556 Ga0495657_0029556_736_1548 267
148 3300046678 Ga0495599_0041957 Ga0495599_0041957_306_1118 267
149 3300047444 Ga0495675_0056515 Ga0495675_0056515_1632_2444 267
150 3300048091 Ga0495626_0077207 Ga0495626_0077207_443_1252 267
151 3300053077 Ga0495601_0288886 Ga0495601_0288886_201_1013 267
152 3300005295 Ga0065707_10129247 Ga0065707_101292473 268
153 3300005330 Ga0070690_100001138 Ga0070690_1000011387 268
154 3300005330 Ga0070690_100076043 Ga0070690_1000760432 268
155 3300005334 Ga0068869_100006042 Ga0068869_1000060428 268
156 3300005336 Ga0070680_100003330 Ga0070680_1000033305 268
157 3300005337 Ga0070682_100005403 Ga0070682_1000054037 268
158 3300005338 Ga0068868_100000502 Ga0068868_1000005026 268
159 3300005340 Ga0070689_100002575 Ga0070689_10000257510 268
160 3300005340 Ga0070689_100353868 Ga0070689_1003538682 268
161 3300005341 Ga0070691_10050163 Ga0070691_100501633 268
162 3300005343 Ga0070687_100000646 Ga0070687_1000006464 268
163 3300005345 Ga0070692_10006501 Ga0070692_100065014 268
164 3300005355 Ga0070671_100059801 Ga0070671_1000598012 268
165 3300005364 Ga0070673_100283842 Ga0070673_1002838422 268
166 3300005438 Ga0070701_10002627 Ga0070701_100026275 268
167 3300005440 Ga0070705_100001778 Ga0070705_10000177810 268
168 3300005441 Ga0070700_100063320 Ga0070700_1000633203 268
169 3300005444 Ga0070694_100002449 Ga0070694_1000024495 268
170 3300005445 Ga0070708_100241732 Ga0070708_1002417323 268
171 3300005458 Ga0070681_10056874 Ga0070681_100568743 268
172 3300005459 Ga0068867_100003238 Ga0068867_1000032385 268
173 3300005530 Ga0070679_100011554 Ga0070679_10001155410 268
174 3300005536 Ga0070697_100394696 Ga0070697_1003946961 268
175 3300005539 Ga0068853_100088686 Ga0068853_1000886863 268
176 3300005544 Ga0070686_100002227 Ga0070686_1000022279 268
177 3300005546 Ga0070696_100011150 Ga0070696_1000111504 268
178 3300005547 Ga0070693_100000317 Ga0070693_10000031710 268
179 3300005549 Ga0070704_100001788 Ga0070704_1000017885 268
180 3300005563 Ga0068855_100016225 Ga0068855_1000162256 268
181 3300005578 Ga0068854_100021470 Ga0068854_1000214705 268
182 3300005614 Ga0068856_100092298 Ga0068856_1000922983 268
183 3300005615 Ga0070702_100011950 Ga0070702_1000119502 268
184 3300005617 Ga0068859_100011290 Ga0068859_1000112907 268
185 3300005718 Ga0068866_10001236 Ga0068866_100012366 268
186 3300005719 Ga0068861_100000995 Ga0068861_1000009955 268
187 3300005842 Ga0068858_100000972 Ga0068858_10000097216 268
188 3300005843 Ga0068860_100007711 Ga0068860_1000077116 268
189 3300005843 Ga0068860_100725390 Ga0068860_1007253902 268
190 3300005844 Ga0068862_100004606 Ga0068862_1000046069 268
191 3300006237 Ga0097621_100107818 Ga0097621_1001078182 268
192 3300006358 Ga0068871_100002717 Ga0068871_10000271710 268
193 3300006844 Ga0075428_100004159 Ga0075428_10000415916 268
194 3300006852 Ga0075433_10017097 Ga0075433_100170974 268
195 3300006871 Ga0075434_100001549 Ga0075434_1000015495 268
196 3300006881 Ga0068865_100002670 Ga0068865_1000026706 268
197 3300006914 Ga0075436_100006194 Ga0075436_1000061945 268
198 3300006931 Ga0097620_100011290 Ga0097620_1000112904 268
199 3300007076 Ga0075435_100044633 Ga0075435_1000446335 268
200 3300007265 Ga0099794_10008903 Ga0099794_100089034 268
201 3300009094 Ga0111539_10085687 Ga0111539_100856872 268
202 3300009098 Ga0105245_10011132 Ga0105245_100111325 268
203 3300009148 Ga0105243_10004737 Ga0105243_100047376 268
204 3300009174 Ga0105241_10069419 Ga0105241_100694193 268
205 3300009176 Ga0105242_10002129 Ga0105242_1000212911 268
206 3300009553 Ga0105249_10021746 Ga0105249_100217463 268
207 3300010375 Ga0105239_10021237 Ga0105239_100212376 268
208 3300013297 Ga0157378_10015710 Ga0157378_100157103 268
209 3300013306 Ga0163162_10123431 Ga0163162_101234312 268
210 3300014326 Ga0157380_10031695 Ga0157380_100316954 268
211 3300014968 Ga0157379_10165708 Ga0157379_101657083 268
212 3300014969 Ga0157376_10017450 Ga0157376_100174506 268
213 3300025885 Ga0207653_10020622 Ga0207653_100206222 268
214 3300025899 Ga0207642_10000158 Ga0207642_1000015814 268
215 3300025917 Ga0207660_10015923 Ga0207660_100159233 268
216 3300025918 Ga0207662_10002572 Ga0207662_100025725 268
217 3300025927 Ga0207687_10007450 Ga0207687_100074505 268
218 3300025934 Ga0207686_10002257 Ga0207686_1000225710 268
219 3300025935 Ga0207709_10001373 Ga0207709_1000137317 268
220 3300025936 Ga0207670_10003042 Ga0207670_100030425 268
221 3300025936 Ga0207670_10316908 Ga0207670_103169082 268
222 3300025939 Ga0207665_10269806 Ga0207665_102698061 268
223 3300025940 Ga0207691_10121776 Ga0207691_101217762 268
224 3300025942 Ga0207689_10001237 Ga0207689_1000123710 268
225 3300025949 Ga0207667_10006231 Ga0207667_100062312 268
226 3300025960 Ga0207651_10080462 Ga0207651_100804623 268
227 3300025961 Ga0207712_10011067 Ga0207712_100110674 268
228 3300025981 Ga0207640_10016117 Ga0207640_100161175 268
229 3300026023 Ga0207677_10003856 Ga0207677_100038563 268
230 3300026035 Ga0207703_10034736 Ga0207703_100347364 268
231 3300026035 Ga0207703_10376191 Ga0207703_103761911 268
232 3300026075 Ga0207708_10000635 Ga0207708_100006354 268
233 3300026078 Ga0207702_10070794 Ga0207702_100707942 268
234 3300026089 Ga0207648_10001242 Ga0207648_100012429 268
235 3300026118 Ga0207675_100006533 Ga0207675_1000065335 268
236 3300028381 Ga0268264_10001776 Ga0268264_1000177617 268
237 3300031548 Ga0307408_100257328 Ga0307408_1002573283 268
238 3300032005 Ga0307411_10289507 Ga0307411_102895073 268
239 3300034817 Ga0373948_0035393 Ga0373948_0035393_156_962 268
240 3300034819 Ga0373958_0010977 Ga0373958_0010977_36_842 268
241 3300034957 Ga0373938_0001893 Ga0373938_0001893_1941_2747 268
242 3300035083 Ga0373926_0001875 Ga0373926_0001875_3166_3972 268
243 3300035085 Ga0373929_0011485 Ga0373929_0011485_783_1589 268
244 3300035088 Ga0373940_0007548 Ga0373940_0007548_419_1225 268
245 3300035088 Ga0373940_0086413 Ga0373940_0086413_83_889 268
246 3300035089 Ga0373944_0008183 Ga0373944_0008183_306_1112 268
247 3300035111 Ga0373923_0119361 Ga0373923_0119361_237_1043 268
248 3300035113 Ga0373936_0011420 Ga0373936_0011420_1459_2265 268
249 3300035115 Ga0373941_0064791 Ga0373941_0064791_360_1166 268
250 3300035171 Ga0373946_0001952 Ga0373946_0001952_3445_4251 268
251 3300035207 Ga0373942_0008021 Ga0373942_0008021_156_962 268
252 3300035241 Ga0373961_0060515 Ga0373961_0060515_63_869 268
253 3300035410 Ga0373924_0019006 Ga0373924_0019006_51_857 268
254 3300035691 Ga0373931_0013201 Ga0373931_0013201_965_1771 268
255 3300035691 Ga0373931_0081760 Ga0373931_0081760_515_1321 268
256 3300035692 Ga0373935_0037046 Ga0373935_0037046_2211_3017 268
257 3300035695 Ga0373927_0010462 Ga0373927_0010462_717_1523 268
258 3300036401 Ga0373937_0267455 Ga0373937_0267455_57_863 268
259 3300037068 Ga0373925_0085940 Ga0373925_0085940_1151_1957 268
260 3300042876 Ga0451577_0000891 Ga0451577_0000891_18474_19283 268
261 3300042876 Ga0451577_0024624 Ga0451577_0024624_2882_3718 268
262 3300042876 Ga0451577_0117296 Ga0451577_0117296_1106_1927 268
263 3300042876 Ga0451577_0168862 Ga0451577_0168862_106_942 268
264 3300042876 Ga0451577_0290533 Ga0451577_0290533_386_1192 268
265 3300044673 Ga0453683_0114056 Ga0453683_0114056_628_1449 268
266 3300044673 Ga0453683_0223647 Ga0453683_0223647_339_1175 268
267 3300044712 Ga0453684_0000005 Ga0453684_0000005_346375_347184 268
268 3300044712 Ga0453684_0000356 Ga0453684_0000356_182416_183225 268
269 3300044712 Ga0453684_0006338 Ga0453684_0006338_20753_21574 268
270 3300045051 Ga0451576_0000227 Ga0451576_0000227_110245_111081 268
271 3300045051 Ga0451576_0000461 Ga0451576_0000461_36543_37364 268
272 3300045051 Ga0451576_0001930 Ga0451576_0001930_30851_31657 268
273 3300045051 Ga0451576_0084787 Ga0451576_0084787_297_1109 268
274 3300045051 Ga0451576_0089666 Ga0451576_0089666_1783_2601 268
275 3300045051 Ga0451576_0101243 Ga0451576_0101243_219_1139 268
276 3300045051 Ga0451576_0136447 Ga0451576_0136447_86_898 268
277 3300045051 Ga0451576_0547601 Ga0451576_0547601_227_1033 268
278 3300045051 Ga0451576_0718512 Ga0451576_0718512_89_895 268
279 3300046455 Ga0495603_0014141 Ga0495603_0014141_620_1426 268
280 3300046472 Ga0495580_0001000 Ga0495580_0001000_15972_16778 268
281 3300046473 Ga0495582_0015057 Ga0495582_0015057_1060_1866 268
282 3300046475 Ga0495639_0012783 Ga0495639_0012783_397_1203 268
283 3300046517 Ga0495630_0111166 Ga0495630_0111166_759_1565 268
284 3300046526 Ga0495666_0017184 Ga0495666_0017184_1630_2436 268
285 3300046535 Ga0495586_0008493 Ga0495586_0008493_626_1432 268
286 3300046674 Ga0495588_0043055 Ga0495588_0043055_1355_2161 268
287 3300046681 Ga0495647_0000528 Ga0495647_0000528_2595_3401 268
288 3300049568 Ga0501031_0014405 Ga0501031_0014405_3358_4164 268
289 3300049569 Ga0501032_0108137 Ga0501032_0108137_802_1608 268
290 3300049570 Ga0501033_0006736 Ga0501033_0006736_6074_6880 268
291 3300049572 Ga0501036_0017789 Ga0501036_0017789_439_1245 268
292 3300049573 Ga0501037_0019106 Ga0501037_0019106_1748_2554 268
293 3300049574 Ga0501038_0001136 Ga0501038_0001136_20691_21497 268
294 3300049575 Ga0501039_0001836 Ga0501039_0001836_8448_9254 268
295 3300049576 Ga0501040_0002478 Ga0501040_0002478_7896_8702 268
296 3300049576 Ga0501040_0090546 Ga0501040_0090546_1276_2082 268
297 3300049577 Ga0501041_0003134 Ga0501041_0003134_6102_6908 268
298 3300049577 Ga0501041_0142417 Ga0501041_0142417_376_1182 268
299 3300049578 Ga0501042_0006020 Ga0501042_0006020_5442_6248 268
300 3300049578 Ga0501042_0037351 Ga0501042_0037351_1437_2243 268
301 3300049579 Ga0501043_0028404 Ga0501043_0028404_647_1453 268
302 3300049580 Ga0501046_0009501 Ga0501046_0009501_1413_2219 268
303 3300049582 Ga0501048_0004002 Ga0501048_0004002_2619_3425 268
304 3300049584 Ga0501068_0001814 Ga0501068_0001814_8962_9768 268
305 3300049587 Ga0501071_0004464 Ga0501071_0004464_5801_6607 268
306 3300049588 Ga0501072_0002529 Ga0501072_0002529_1763_2569 268
307 3300049588 Ga0501072_0209850 Ga0501072_0209850_710_1516 268
308 3300049590 Ga0501074_0029199 Ga0501074_0029199_1594_2400 268
309 3300049591 Ga0501075_0003779 Ga0501075_0003779_7334_8140 268
310 3300049591 Ga0501075_0019433 Ga0501075_0019433_183_989 268
311 3300049591 Ga0501075_0416176 Ga0501075_0416176_116_922 268
312 3300049592 Ga0501076_0014873 Ga0501076_0014873_2645_3451 268
313 3300049593 Ga0501077_0003413 Ga0501077_0003413_3272_4078 268
314 3300049593 Ga0501077_0109784 Ga0501077_0109784_349_1155 268
315 3300049741 Ga0501079_0002808 Ga0501079_0002808_8879_9685 268
316 3300049742 Ga0501080_0052837 Ga0501080_0052837_1552_2358 268
317 3300049743 Ga0501081_0032521 Ga0501081_0032521_2294_3100 268
318 3300049743 Ga0501081_0075381 Ga0501081_0075381_114_920 268
319 3300049776 Ga0501280_001170 Ga0501280_001170_2651_3484 268
320 3300049823 Ga0501044_0232617 Ga0501044_0232617_339_1145 268
321 3300049824 Ga0501045_0004211 Ga0501045_0004211_5404_6210 268
322 3300050507 nmdc:mga05p37_112776_c1 nmdc:mga05p37_112776_c1_1884_2690 268
323 3300050508 nmdc:mga09592_1934_c1 nmdc:mga09592_1934_c1_10475_11281 268
324 3300050511 nmdc:mga08y16_27087_c1 nmdc:mga08y16_27087_c1_2502_3308 268
325 3300050512 nmdc:mga0n895_307_c1 nmdc:mga0n895_307_c1_29041_29847 268
326 3300050513 nmdc:mga0rr50_18554_c1 nmdc:mga0rr50_18554_c1_2674_3480 268
327 3300050514 nmdc:mga08x19_3961_c1 nmdc:mga08x19_3961_c1_4739_5545 268
328 3300050515 nmdc:mga0a205_30972_c1 nmdc:mga0a205_30972_c1_1614_2420 268
329 3300059423 Ga0590074_008780 Ga0590074_008780_429_1235 268
330 3300060353 Ga0501082_0016089 Ga0501082_0016089_4219_5025 268
331 3300061734 Ga0530510_0013371 Ga0530510_0013371_2294_3100 268
332 3300061734 Ga0530510_0398109 Ga0530510_0398109_222_1028 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

18

289

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hd1-assembly1.cif.gz_A crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius 0.9299 5 246
7vws-assembly2.cif.gz_B carbazole prenyl transferase lvqb4 0.8585 13 267
3vje-assembly2.cif.gz_B crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a 0.8495 5 267
2zcr-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-698 0.8455 12 267
7vws-assembly1.cif.gz_A carbazole prenyl transferase lvqb4 0.845 13 267
ID Description Score Start End Superfamily
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9245 5 246 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8926 13 249 1.10.600.10
af_Q9VYS5_51_308_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8636 13 246 1.10.600.10
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8603 13 267 1.10.600.10
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8528 12 248 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A4Q3JM64-F1-model_v4 deleted 0.9871 131 267
AF-A0A1F3YJV7-F1-model_v4 Squalene synthase HpnC 0.9867 55 267 GO:0004311
GO:0008299
AF-A0A127PPX7-F1-model_v4 Squalene synthase HpnC (EC 2.4.1.21) 0.9828 25 267 GO:0004311
GO:0008299
GO:0009011
GO:0051996
AF-A0A3G9GCC3-F1-model_v4 Phytoene synthase (EC 2.5.1.32) 0.98 21 267 GO:0004311
GO:0008299
GO:0016767
GO:0051996
AF-S6ACH7-F1-model_v4 Squalene synthase (EC 2.5.1.32) 0.9769 5 267 GO:0004311
GO:0008299
GO:0016767
GO:0051996

Feature Viewer

pLDDT pTM Quality
91.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map