F410940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 243 | 276 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10184740|Ga0157374_101847402 |
| Length | 274 |
| Sequence | MVSSAIKQQLATVPARRTLLPSRRKYFFVVRQLKVTSYMKQTDDFLVNGFATVDNIYTTEEVDRILNIISQANSEKETFRKSADLFAIRQFLTEVPATIDTIFNNNLKSVLTPLLGDKYFVVKSIYFDKPQTSNWYVSYHQDLTISVDKKLALNGFEFWTTKQNQFAVQPPLDILQKVVTVRIHLDDTDENNGALKVVPKSHSKGIYRPESIDWTIENEVCCNVSKGGIMLMKPLLLHSSGRTTNDRQRRVIHIEFSNQELPTELNWAERLNLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 5 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 6 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 7 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 8 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 9 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 10 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 11 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 12 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 13 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 14 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 15 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 16 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 17 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 18 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 19 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 20 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 21 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 22 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 23 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 24 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 25 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 26 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 27 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 28 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 29 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 30 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 31 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 32 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 33 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 34 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 35 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 36 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 37 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 38 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 39 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 40 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 41 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 42 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 43 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 44 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 45 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 46 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 47 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 48 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 49 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 50 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 51 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 52 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 53 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 54 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 55 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 56 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 57 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 58 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 59 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 60 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 61 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 62 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 63 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 64 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 65 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 66 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 67 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 68 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 69 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 70 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 71 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 159 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 163 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 187 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 189 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 190 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 191 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 192 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 216 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 217 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 218 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 219 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 220 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 221 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 222 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 228 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 233 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 234 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 235 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 236 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 237 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 240 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 241 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 242 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 243 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.13 |
| Metatranscriptomes | 0 |
| Isolates | 16.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 16.27 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 64.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_886264 | 2162886007 | Bacteria | 1451 |
| 2 | JGI24740J21852_10001772 | 3300001979 | Bacteria | 9900 |
| 3 | JGI24739J22299_10002672 | 3300001989 | Bacteria | 6867 |
| 4 | JGI24739J22299_10017158 | 3300001989 | Bacteria | 2615 |
| 5 | JGI24739J22299_10098821 | 3300001989 | Bacteria | 882 |
| 6 | JGI24737J22298_10002813 | 3300001990 | Bacteria | 6162 |
| 7 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 8 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 9 | JGI25158J39367_1003541 | 3300002739 | Bacteria | 2399 |
| 10 | JGI25152J39213_1000345 | 3300002773 | Bacteria | 29225 |
| 11 | JGI25150J39212_1000011 | 3300002774 | Bacteria | 195312 |
| 12 | JGI25151J46595_10000033 | 3300003187 | Bacteria | 195312 |
| 13 | JGI25153J46596_10000052 | 3300003215 | Bacteria | 139303 |
| 14 | JGI25153J46596_10003411 | 3300003215 | Bacteria | 8898 |
| 15 | rootH1_10054459 | 3300003316 | Bacteria | 5069 |
| 16 | rootH2_10046675 | 3300003320 | Bacteria | 8784 |
| 17 | rootH2_10217350 | 3300003320 | Bacteria | 2532 |
| 18 | rootL2_10255885 | 3300003322 | Bacteria | 1933 |
| 19 | rootH1_10011869 | 3300003323 | Bacteria | 39408 |
| 20 | rootH1_10029468 | 3300003323 | Bacteria | 1871 |
| 21 | rootH1_10092258 | 3300003323 | Bacteria | 14912 |
| 22 | rootH1_10347941 | 3300003323 | Bacteria | 1824 |
| 23 | JGI25160J50197_1003360 | 3300003354 | Bacteria | 7176 |
| 24 | JGI25160J50197_1007832 | 3300003354 | Bacteria | 4134 |
| 25 | JGI25160J50197_1019743 | 3300003354 | Bacteria | 2057 |
| 26 | Ga0055535_1002723 | 3300003761 | Bacteria | 5703 |
| 27 | Ga0055542_1009110 | 3300003762 | Bacteria | 1893 |
| 28 | Ga0055526_1035008 | 3300003771 | Bacteria | 1361 |
| 29 | Ga0055534_1006347 | 3300003784 | Bacteria | 2988 |
| 30 | Ga0055528_1000052 | 3300003790 | Bacteria | 91910 |
| 31 | Ga0055530_10000023 | 3300003791 | Bacteria | 135890 |
| 32 | Ga0065165_1000110 | 3300005262 | Bacteria | 137063 |
| 33 | Ga0065165_1003612 | 3300005262 | Bacteria | 10618 |
| 34 | Ga0065714_10002205 | 3300005288 | Bacteria | 57702 |
| 35 | Ga0065714_10012935 | 3300005288 | Bacteria | 4354 |
| 36 | Ga0065714_10064482 | 3300005288 | Bacteria | 53779 |
| 37 | Ga0065704_10072273 | 3300005289 | Bacteria | 8820 |
| 38 | Ga0065704_10079143 | 3300005289 | Bacteria | 4247 |
| 39 | Ga0065704_10094984 | 3300005289 | Bacteria | 2456 |
| 40 | Ga0070658_10001730 | 3300005327 | Bacteria | 18401 |
| 41 | Ga0070683_100030439 | 3300005329 | Bacteria | 4900 |
| 42 | Ga0070690_100131212 | 3300005330 | Unclassified | 1692 |
| 43 | Ga0070670_100278179 | 3300005331 | Bacteria | 1461 |
| 44 | Ga0070670_100472336 | 3300005331 | Bacteria | 1113 |
| 45 | Ga0070682_100000339 | 3300005337 | Bacteria | 32181 |
| 46 | Ga0070689_100513141 | 3300005340 | Unclassified | 1028 |
| 47 | Ga0070668_100513956 | 3300005347 | Bacteria | 1038 |
| 48 | Ga0070701_10001554 | 3300005438 | Bacteria | 8516 |
| 49 | Ga0070684_100024134 | 3300005535 | Bacteria | 5098 |
| 50 | Ga0068853_100031658 | 3300005539 | Bacteria | 4475 |
| 51 | Ga0068853_100130635 | 3300005539 | Bacteria | 2248 |
| 52 | Ga0068853_100415508 | 3300005539 | Bacteria | 1261 |
| 53 | Ga0068853_100698903 | 3300005539 | Unclassified | 967 |
| 54 | Ga0070686_100020618 | 3300005544 | Unclassified | 3903 |
| 55 | Ga0070704_100036269 | 3300005549 | Unclassified | 3359 |
| 56 | Ga0068855_100000009 | 3300005563 | Bacteria | 246035 |
| 57 | Ga0068855_100003439 | 3300005563 | Bacteria | 19374 |
| 58 | Ga0068857_100305154 | 3300005577 | Bacteria | 1468 |
| 59 | Ga0068856_100011181 | 3300005614 | Bacteria | 8713 |
| 60 | Ga0068856_100623625 | 3300005614 | Bacteria | 1099 |
| 61 | Ga0068851_10168118 | 3300005834 | Bacteria | 1208 |
| 62 | Ga0097621_100024760 | 3300006237 | Bacteria | 4691 |
| 63 | Ga0068871_100098379 | 3300006358 | Bacteria | 2447 |
| 64 | Ga0075428_100325802 | 3300006844 | Bacteria | 1650 |
| 65 | Ga0075429_100216680 | 3300006880 | Bacteria | 1677 |
| 66 | Ga0068865_100332170 | 3300006881 | Bacteria | 1226 |
| 67 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 68 | Ga0105244_10017451 | 3300009036 | Bacteria | 4055 |
| 69 | Ga0105240_10000487 | 3300009093 | Bacteria | 73453 |
| 70 | Ga0105240_10419167 | 3300009093 | Bacteria | 1504 |
| 71 | Ga0114129_10008068 | 3300009147 | Bacteria | 15001 |
| 72 | Ga0105243_10000006 | 3300009148 | Bacteria | 465541 |
| 73 | Ga0105243_10000601 | 3300009148 | Bacteria | 35879 |
| 74 | Ga0105241_10168017 | 3300009174 | Unclassified | 1809 |
| 75 | Ga0105237_10001246 | 3300009545 | Bacteria | 33969 |
| 76 | Ga0105237_10001779 | 3300009545 | Bacteria | 27854 |
| 77 | Ga0105237_10275315 | 3300009545 | Unclassified | 1686 |
| 78 | Ga0105238_10000183 | 3300009551 | Bacteria | 68599 |
| 79 | Ga0105238_10082989 | 3300009551 | Bacteria | 3194 |
| 80 | Ga0105249_10012985 | 3300009553 | Bacteria | 7351 |
| 81 | Ga0105239_10297843 | 3300010375 | Bacteria | 1816 |
| 82 | Ga0105239_10366453 | 3300010375 | Bacteria | 1628 |
| 83 | Ga0157371_10000482 | 3300013102 | Bacteria | 48630 |
| 84 | Ga0157371_10013676 | 3300013102 | Bacteria | 6157 |
| 85 | Ga0157371_10033068 | 3300013102 | Bacteria | 3718 |
| 86 | Ga0157371_10111152 | 3300013102 | Bacteria | 1945 |
| 87 | Ga0157370_10000026 | 3300013104 | Bacteria | 152092 |
| 88 | Ga0157370_10001379 | 3300013104 | Bacteria | 30046 |
| 89 | Ga0157370_10005442 | 3300013104 | Bacteria | 14281 |
| 90 | Ga0157370_10015000 | 3300013104 | Bacteria | 7900 |
| 91 | Ga0157370_10051809 | 3300013104 | Bacteria | 3920 |
| 92 | Ga0157370_10232366 | 3300013104 | Bacteria | 1706 |
| 93 | Ga0157370_10372858 | 3300013104 | Bacteria | 1315 |
| 94 | Ga0157369_10000285 | 3300013105 | Bacteria | 67687 |
| 95 | Ga0157369_10174952 | 3300013105 | Bacteria | 2260 |
| 96 | Ga0157374_10184740 | 3300013296 | Bacteria | 2038 |
| 97 | Ga0157378_10350769 | 3300013297 | Bacteria | 1441 |
| 98 | Ga0163162_10001276 | 3300013306 | Bacteria | 23566 |
| 99 | Ga0163162_10018875 | 3300013306 | Bacteria | 6761 |
| 100 | Ga0157372_10000017 | 3300013307 | Bacteria | 219543 |
| 101 | Ga0157372_10002801 | 3300013307 | Bacteria | 18838 |
| 102 | Ga0157372_10263596 | 3300013307 | Bacteria | 2001 |
| 103 | Ga0157375_10002061 | 3300013308 | Bacteria | 17358 |
| 104 | Ga0157375_10901874 | 3300013308 | Bacteria | 1028 |
| 105 | Ga0163163_10052489 | 3300014325 | Bacteria | 4022 |
| 106 | Ga0182008_10000015 | 3300014497 | Bacteria | 243121 |
| 107 | Ga0182008_10000020 | 3300014497 | Bacteria | 228333 |
| 108 | Ga0182008_10000274 | 3300014497 | Bacteria | 40340 |
| 109 | Ga0157376_10240048 | 3300014969 | Bacteria | 1688 |
| 110 | Ga0157376_10565099 | 3300014969 | Bacteria | 1127 |
| 111 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 112 | Ga0182006_1000120 | 3300015261 | Bacteria | 84872 |
| 113 | Ga0182006_1000209 | 3300015261 | Bacteria | 58193 |
| 114 | Ga0182006_1018332 | 3300015261 | Bacteria | 2960 |
| 115 | Ga0182007_10000016 | 3300015262 | Bacteria | 202375 |
| 116 | Ga0183373_1011 | 3300015682 | Bacteria | 138873 |
| 117 | Ga0163161_10001093 | 3300017792 | Bacteria | 20526 |
| 118 | Ga0163161_10069535 | 3300017792 | Bacteria | 2573 |
| 119 | Ga0163161_10099636 | 3300017792 | Bacteria | 2161 |
| 120 | Ga0209436_100513 | 3300025208 | Bacteria | 16909 |
| 121 | Ga0209258_100116 | 3300025242 | Bacteria | 190317 |
| 122 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 123 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 124 | Ga0209646_1004158 | 3300025246 | Unclassified | 2681 |
| 125 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 126 | Ga0209148_1000175 | 3300025254 | Bacteria | 129536 |
| 127 | Ga0209148_1017437 | 3300025254 | Bacteria | 1219 |
| 128 | Ga0209129_1000076 | 3300025258 | Bacteria | 195353 |
| 129 | Ga0209129_1014273 | 3300025258 | Bacteria | 1700 |
| 130 | Ga0209455_1007533 | 3300025272 | Bacteria | 3062 |
| 131 | Ga0209673_1000153 | 3300025273 | Bacteria | 146821 |
| 132 | Ga0209130_1002423 | 3300025284 | Bacteria | 9390 |
| 133 | Ga0209675_1000053 | 3300025291 | Bacteria | 194511 |
| 134 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 135 | Ga0209564_1003629 | 3300025295 | Bacteria | 10258 |
| 136 | Ga0209564_1027623 | 3300025295 | Bacteria | 1838 |
| 137 | Ga0209758_1000114 | 3300025297 | Bacteria | 199324 |
| 138 | Ga0209758_1012964 | 3300025297 | Bacteria | 4601 |
| 139 | Ga0209758_1027778 | 3300025297 | Bacteria | 2410 |
| 140 | Ga0209050_1000377 | 3300025298 | Bacteria | 84222 |
| 141 | Ga0207426_1000114 | 3300025302 | Bacteria | 228273 |
| 142 | Ga0207426_1000327 | 3300025302 | Bacteria | 90905 |
| 143 | Ga0207426_1000774 | 3300025302 | Bacteria | 35182 |
| 144 | Ga0209051_1030989 | 3300025303 | Bacteria | 2066 |
| 145 | Ga0209257_1000939 | 3300025304 | Bacteria | 40250 |
| 146 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 147 | Ga0207655_1018196 | 3300025728 | Bacteria | 3744 |
| 148 | Ga0207705_10007213 | 3300025909 | Bacteria | 8184 |
| 149 | Ga0207654_10259012 | 3300025911 | Unclassified | 1169 |
| 150 | Ga0207695_10000778 | 3300025913 | Bacteria | 60342 |
| 151 | Ga0207695_10002667 | 3300025913 | Bacteria | 26073 |
| 152 | Ga0207671_10003214 | 3300025914 | Bacteria | 16444 |
| 153 | Ga0207671_10022021 | 3300025914 | Bacteria | 4826 |
| 154 | Ga0207671_10053968 | 3300025914 | Bacteria | 2978 |
| 155 | Ga0207671_10178562 | 3300025914 | Unclassified | 1651 |
| 156 | Ga0207657_10307325 | 3300025919 | Bacteria | 1255 |
| 157 | Ga0207657_10501909 | 3300025919 | Unclassified | 950 |
| 158 | Ga0207694_10000225 | 3300025924 | Bacteria | 54907 |
| 159 | Ga0207650_10004151 | 3300025925 | Bacteria | 9903 |
| 160 | Ga0207650_10285919 | 3300025925 | Bacteria | 1344 |
| 161 | Ga0207709_10000007 | 3300025935 | Bacteria | 752025 |
| 162 | Ga0207709_10000489 | 3300025935 | Bacteria | 35962 |
| 163 | Ga0207661_10033657 | 3300025944 | Bacteria | 3979 |
| 164 | Ga0207667_10000045 | 3300025949 | Bacteria | 246053 |
| 165 | Ga0207667_10006792 | 3300025949 | Bacteria | 13818 |
| 166 | Ga0207667_10029126 | 3300025949 | Bacteria | 5990 |
| 167 | Ga0207668_10295764 | 3300025972 | Bacteria | 1334 |
| 168 | Ga0207648_10333603 | 3300026089 | Bacteria | 1364 |
| 169 | Ga0207674_10075650 | 3300026116 | Bacteria | 3376 |
| 170 | Ga0207674_10139147 | 3300026116 | Bacteria | 2388 |
| 171 | Ga0207674_10247552 | 3300026116 | Unclassified | 1729 |
| 172 | Ga0307515_10000091 | 3300028794 | Bacteria | 214014 |
| 173 | Ga0307511_10072117 | 3300030521 | Bacteria | 2511 |
| 174 | Ga0265327_10000024 | 3300031251 | Bacteria | 382499 |
| 175 | Ga0307509_10071306 | 3300031507 | Bacteria | 3625 |
| 176 | Ga0307508_10119826 | 3300031616 | Bacteria | 2234 |
| 177 | Ga0307516_10098227 | 3300031730 | Unclassified | 2747 |
| 178 | Ga0307405_10000023 | 3300031731 | Bacteria | 141450 |
| 179 | Ga0307518_10090851 | 3300031838 | Bacteria | 2197 |
| 180 | Ga0307412_10000032 | 3300031911 | Bacteria | 207098 |
| 181 | Ga0307416_100000017 | 3300032002 | Bacteria | 201722 |
| 182 | Ga0307414_10061323 | 3300032004 | Bacteria | 2664 |
| 183 | Ga0307411_10064472 | 3300032005 | Bacteria | 2453 |
| 184 | Ga0373930_0008558 | 3300034816 | Bacteria | 1791 |
| 185 | Ga0373928_0000035 | 3300035084 | Bacteria | 23241 |
| 186 | Ga0373949_0008628 | 3300035090 | Bacteria | 2230 |
| 187 | Ga0373932_0000007 | 3300035112 | Bacteria | 207459 |
| 188 | Ga0373945_0032738 | 3300035116 | Bacteria | 1843 |
| 189 | Ga0373946_0108958 | 3300035171 | Bacteria | 1251 |
| 190 | Ga0373962_0000111 | 3300035242 | Bacteria | 17722 |
| 191 | Ga0316574_0116655 | 3300035398 | Bacteria | 1713 |
| 192 | Ga0373931_0000024 | 3300035691 | Bacteria | 129909 |
| 193 | Ga0373935_0125300 | 3300035692 | Unclassified | 1720 |
| 194 | Ga0373927_0011615 | 3300035695 | Bacteria | 5864 |
| 195 | Ga0373927_0067737 | 3300035695 | Bacteria | 2309 |
| 196 | Ga0316584_0008562 | 3300036712 | Bacteria | 7053 |
| 197 | Ga0373925_0000403 | 3300037068 | Bacteria | 43935 |
| 198 | Ga0395899_0000382 | 3300037312 | Bacteria | 52888 |
| 199 | Ga0436365_0692265 | 3300039437 | Bacteria | 1551 |
| 200 | Ga0436361_0630962 | 3300039447 | Bacteria | 1252 |
| 201 | Ga0439465_0000110 | 3300041413 | Bacteria | 19080 |
| 202 | Ga0451802_1850536 | 3300041460 | Bacteria | 1135 |
| 203 | Ga0451806_480488 | 3300041462 | Bacteria | 1011 |
| 204 | Ga0439442_002905 | 3300042002 | Bacteria | 3376 |
| 205 | Ga0439457_004560 | 3300042014 | Bacteria | 3594 |
| 206 | Ga0439446_0032458 | 3300042156 | Bacteria | 1515 |
| 207 | Ga0439434_0031459 | 3300042435 | Bacteria | 1613 |
| 208 | Ga0466972_0000075 | 3300044658 | Bacteria | 94290 |
| 209 | Ga0466972_0016642 | 3300044658 | Bacteria | 3676 |
| 210 | Ga0466957_0008518 | 3300044842 | Bacteria | 5836 |
| 211 | Ga0466960_0020344 | 3300044901 | Bacteria | 2939 |
| 212 | Ga0466959_0305185 | 3300045049 | Bacteria | 1090 |
| 213 | Ga0451576_0095432 | 3300045051 | Unclassified | 3093 |
| 214 | Ga0495627_000002 | 3300046453 | Bacteria | 903861 |
| 215 | Ga0495627_007989 | 3300046453 | Bacteria | 4000 |
| 216 | Ga0495590_0039340 | 3300046457 | Bacteria | 1649 |
| 217 | Ga0495638_0081399 | 3300046460 | Bacteria | 1966 |
| 218 | Ga0495650_0012456 | 3300046471 | Bacteria | 4575 |
| 219 | Ga0495596_0003280 | 3300046500 | Bacteria | 8258 |
| 220 | Ga0495606_0001701 | 3300046507 | Bacteria | 28416 |
| 221 | Ga0495606_0022840 | 3300046507 | Bacteria | 4545 |
| 222 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 223 | Ga0495631_0117255 | 3300046518 | Bacteria | 1145 |
| 224 | Ga0495632_0003020 | 3300046519 | Bacteria | 12269 |
| 225 | Ga0495643_0000926 | 3300046522 | Bacteria | 30682 |
| 226 | Ga0495663_0001776 | 3300046525 | Bacteria | 6680 |
| 227 | Ga0495654_0000006 | 3300046530 | Bacteria | 451432 |
| 228 | Ga0495668_0003962 | 3300046616 | Bacteria | 10791 |
| 229 | Ga0495625_0000825 | 3300046660 | Bacteria | 42700 |
| 230 | Ga0495625_0048028 | 3300046660 | Bacteria | 3075 |
| 231 | Ga0495649_0043872 | 3300046694 | Bacteria | 2441 |
| 232 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 233 | Ga0495686_0000812 | 3300047472 | Bacteria | 40457 |
| 234 | Ga0495686_0005473 | 3300047472 | Bacteria | 10007 |
| 235 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 236 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 237 | Ga0496118_0000163 | 3300048921 | Bacteria | 119492 |
| 238 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 239 | Ga0496121_0000082 | 3300048924 | Bacteria | 228557 |
| 240 | Ga0496122_0000073 | 3300048925 | Bacteria | 222403 |
| 241 | Ga0496122_0000163 | 3300048925 | Bacteria | 158337 |
| 242 | Ga0496122_0000258 | 3300048925 | Bacteria | 119618 |
| 243 | Ga0496122_0000782 | 3300048925 | Bacteria | 61189 |
| 244 | Ga0496122_0001248 | 3300048925 | Bacteria | 42723 |
| 245 | Ga0496122_0012675 | 3300048925 | Bacteria | 8354 |
| 246 | Ga0496123_0000853 | 3300048926 | Bacteria | 48656 |
| 247 | Ga0496123_0010355 | 3300048926 | Bacteria | 8255 |
| 248 | Ga0496123_0010721 | 3300048926 | Bacteria | 8053 |
| 249 | Ga0496123_0014926 | 3300048926 | Bacteria | 6404 |
| 250 | Ga0496124_0001110 | 3300048927 | Bacteria | 42348 |
| 251 | Ga0496125_0002152 | 3300048928 | Bacteria | 26391 |
| 252 | Ga0496125_0005212 | 3300048928 | Bacteria | 14587 |
| 253 | Ga0496125_0038737 | 3300048928 | Bacteria | 4118 |
| 254 | Ga0501034_0286974 | 3300049571 | Bacteria | 1585 |
| 255 | Ga0501043_0250984 | 3300049579 | Bacteria | 1363 |
| 256 | Ga0501225_0003596 | 3300049705 | Bacteria | 4672 |
| 257 | Ga0501080_0013495 | 3300049742 | Bacteria | 7517 |
| 258 | Ga0501241_000018 | 3300049758 | Bacteria | 95195 |
| 259 | Ga0501268_009137 | 3300049765 | Bacteria | 1518 |
| 260 | Ga0501269_000014 | 3300049766 | Bacteria | 59850 |
| 261 | nmdc:mga05p37_10194_c2 | 3300050507 | Bacteria | 9428 |
| 262 | nmdc:mga09592_210681_c1 | 3300050508 | Bacteria | 1684 |
| 263 | Ga0500578_0000091 | 3300053086 | Bacteria | 102427 |
| 264 | Ga0500578_0047180 | 3300053086 | Bacteria | 2764 |
| 265 | Ga0500583_0000122 | 3300053092 | Bacteria | 36660 |
| 266 | Ga0500556_0097975 | 3300053104 | Bacteria | 1127 |
| 267 | Ga0500572_012883 | 3300053111 | Bacteria | 2058 |
| 268 | Ga0500642_0108015 | 3300053130 | Unclassified | 1298 |
| 269 | Ga0500559_0040763 | 3300053136 | Unclassified | 2023 |
| 270 | Ga0500616_0139073 | 3300053153 | Bacteria | 1137 |
| 271 | Ga0500622_0001663 | 3300053156 | Bacteria | 17376 |
| 272 | Ga0500624_000311 | 3300053157 | Bacteria | 16698 |
| 273 | Ga0500627_0039262 | 3300053158 | Unclassified | 2026 |
| 274 | Ga0500627_0213398 | 3300053158 | Unclassified | 863 |
| 275 | Ga0500645_021401 | 3300053730 | Bacteria | 1996 |
| 276 | Ga0500645_064711 | 3300053730 | Bacteria | 1054 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0125300 | Ga0373935_0125300_1139_1672 | 175 |
| 2 | 3300009551 | Ga0105238_10082989 | Ga0105238_100829892 | 189 |
| 3 | 3300025913 | Ga0207695_10002667 | Ga0207695_1000266710 | 189 |
| 4 | 3300025914 | Ga0207671_10022021 | Ga0207671_100220214 | 189 |
| 5 | 3300046471 | Ga0495650_0012456 | Ga0495650_0012456_2477_3235 | 212 |
| 6 | 3300002773 | JGI25152J39213_1000345 | JGI25152J39213_10003455 | 215 |
| 7 | 3300002774 | JGI25150J39212_1000011 | JGI25150J39212_100001132 | 215 |
| 8 | 3300003187 | JGI25151J46595_10000033 | JGI25151J46595_1000003332 | 215 |
| 9 | 3300003215 | JGI25153J46596_10000052 | JGI25153J46596_1000005292 | 215 |
| 10 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003863 | 215 |
| 11 | 3300025258 | Ga0209129_1000076 | Ga0209129_100007631 | 215 |
| 12 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007862 | 215 |
| 13 | 3300025297 | Ga0209758_1000114 | Ga0209758_1000114136 | 215 |
| 14 | 3300049705 | Ga0501225_0003596 | Ga0501225_0003596_1935_2651 | 215 |
| 15 | 3300003323 | rootH1_10011869 | rootH1_1001186924 | 217 |
| 16 | 3300053086 | Ga0500578_0000091 | Ga0500578_0000091_84593_85321 | 217 |
| 17 | 3300049742 | Ga0501080_0013495 | Ga0501080_0013495_4266_4928 | 218 |
| 18 | 3300010375 | Ga0105239_10366453 | Ga0105239_103664531 | 219 |
| 19 | 3300031731 | Ga0307405_10000023 | Ga0307405_1000002399 | 219 |
| 20 | 3300034816 | Ga0373930_0008558 | Ga0373930_0008558_215_880 | 219 |
| 21 | 3300035084 | Ga0373928_0000035 | Ga0373928_0000035_6323_6988 | 219 |
| 22 | 3300035090 | Ga0373949_0008628 | Ga0373949_0008628_999_1664 | 219 |
| 23 | 3300035112 | Ga0373932_0000007 | Ga0373932_0000007_70140_70805 | 219 |
| 24 | 3300035116 | Ga0373945_0032738 | Ga0373945_0032738_243_908 | 219 |
| 25 | 3300035171 | Ga0373946_0108958 | Ga0373946_0108958_135_800 | 219 |
| 26 | 3300035242 | Ga0373962_0000111 | Ga0373962_0000111_7742_8407 | 219 |
| 27 | 3300035691 | Ga0373931_0000024 | Ga0373931_0000024_29838_30503 | 219 |
| 28 | 3300035695 | Ga0373927_0011615 | Ga0373927_0011615_4847_5512 | 219 |
| 29 | 3300035695 | Ga0373927_0067737 | Ga0373927_0067737_1239_1904 | 219 |
| 30 | 3300037068 | Ga0373925_0000403 | Ga0373925_0000403_12243_12908 | 219 |
| 31 | 3300049571 | Ga0501034_0286974 | Ga0501034_0286974_737_1402 | 219 |
| 32 | 3300005563 | Ga0068855_100000009 | Ga0068855_100000009227 | 220 |
| 33 | 3300006844 | Ga0075428_100325802 | Ga0075428_1003258023 | 220 |
| 34 | 3300006880 | Ga0075429_100216680 | Ga0075429_1002166803 | 220 |
| 35 | 3300014497 | Ga0182008_10000020 | Ga0182008_1000002065 | 220 |
| 36 | 3300025949 | Ga0207667_10000045 | Ga0207667_1000004510 | 220 |
| 37 | 3300035398 | Ga0316574_0116655 | Ga0316574_0116655_482_1159 | 220 |
| 38 | 3300036712 | Ga0316584_0008562 | Ga0316584_0008562_1013_1690 | 220 |
| 39 | 3300050508 | nmdc:mga09592_210681_c1 | nmdc:mga09592_210681_c1_124_861 | 220 |
| 40 | 3300053157 | Ga0500624_000311 | Ga0500624_000311_2144_2875 | 220 |
| 41 | 3300005330 | Ga0070690_100131212 | Ga0070690_1001312122 | 221 |
| 42 | 3300005331 | Ga0070670_100472336 | Ga0070670_1004723361 | 221 |
| 43 | 3300005438 | Ga0070701_10001554 | Ga0070701_100015543 | 221 |
| 44 | 3300005544 | Ga0070686_100020618 | Ga0070686_1000206182 | 221 |
| 45 | 3300005549 | Ga0070704_100036269 | Ga0070704_1000362692 | 221 |
| 46 | 3300009148 | Ga0105243_10000006 | Ga0105243_10000006205 | 221 |
| 47 | 3300025935 | Ga0207709_10000007 | Ga0207709_10000007444 | 221 |
| 48 | 3300030521 | Ga0307511_10072117 | Ga0307511_100721174 | 221 |
| 49 | 3300045051 | Ga0451576_0095432 | Ga0451576_0095432_2211_2903 | 221 |
| 50 | 3300005614 | Ga0068856_100623625 | Ga0068856_1006236252 | 222 |
| 51 | 3300041460 | Ga0451802_1850536 | Ga0451802_1850536_190_921 | 222 |
| 52 | 3300053086 | Ga0500578_0047180 | Ga0500578_0047180_1193_1921 | 222 |
| 53 | 3300005288 | Ga0065714_10002205 | Ga0065714_1000220510 | 223 |
| 54 | 3300009036 | Ga0105244_10017451 | Ga0105244_100174513 | 223 |
| 55 | 3300010375 | Ga0105239_10297843 | Ga0105239_102978433 | 223 |
| 56 | 3300013105 | Ga0157369_10000285 | Ga0157369_1000028554 | 223 |
| 57 | 3300015262 | Ga0182007_10000016 | Ga0182007_1000001686 | 223 |
| 58 | 3300025728 | Ga0207655_1018196 | Ga0207655_10181963 | 223 |
| 59 | 3300041462 | Ga0451806_480488 | Ga0451806_480488_269_1000 | 223 |
| 60 | 3300047472 | Ga0495686_0000010 | Ga0495686_0000010_297411_298082 | 223 |
| 61 | 3300005327 | Ga0070658_10001730 | Ga0070658_1000173010 | 224 |
| 62 | 3300013102 | Ga0157371_10000482 | Ga0157371_1000048243 | 224 |
| 63 | 3300013308 | Ga0157375_10901874 | Ga0157375_109018742 | 224 |
| 64 | 3300015682 | Ga0183373_1011 | Ga0183373_101150 | 224 |
| 65 | 3300017792 | Ga0163161_10099636 | Ga0163161_100996362 | 224 |
| 66 | 3300025909 | Ga0207705_10007213 | Ga0207705_100072135 | 224 |
| 67 | 3300025919 | Ga0207657_10501909 | Ga0207657_105019091 | 224 |
| 68 | 3300025949 | Ga0207667_10029126 | Ga0207667_100291266 | 224 |
| 69 | 3300001989 | JGI24739J22299_10017158 | JGI24739J22299_100171582 | 226 |
| 70 | 3300001990 | JGI24737J22298_10002813 | JGI24737J22298_100028133 | 226 |
| 71 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_10000006225 | 226 |
| 72 | 3300013102 | Ga0157371_10111152 | Ga0157371_101111522 | 226 |
| 73 | 3300013105 | Ga0157369_10174952 | Ga0157369_101749523 | 226 |
| 74 | 3300013307 | Ga0157372_10002801 | Ga0157372_1000280111 | 226 |
| 75 | 3300046518 | Ga0495631_0117255 | Ga0495631_0117255_150_869 | 226 |
| 76 | 3300001989 | JGI24739J22299_10002672 | JGI24739J22299_100026727 | 227 |
| 77 | 3300005577 | Ga0068857_100305154 | Ga0068857_1003051542 | 227 |
| 78 | 3300013102 | Ga0157371_10013676 | Ga0157371_100136764 | 227 |
| 79 | 3300013104 | Ga0157370_10005442 | Ga0157370_1000544214 | 227 |
| 80 | 3300026089 | Ga0207648_10333603 | Ga0207648_103336031 | 227 |
| 81 | 3300026116 | Ga0207674_10075650 | Ga0207674_100756502 | 227 |
| 82 | 3300005539 | Ga0068853_100415508 | Ga0068853_1004155082 | 228 |
| 83 | 3300005614 | Ga0068856_100011181 | Ga0068856_1000111818 | 228 |
| 84 | 3300009093 | Ga0105240_10000487 | Ga0105240_1000048716 | 228 |
| 85 | 3300009093 | Ga0105240_10419167 | Ga0105240_104191671 | 228 |
| 86 | 3300009174 | Ga0105241_10168017 | Ga0105241_101680172 | 228 |
| 87 | 3300009545 | Ga0105237_10275315 | Ga0105237_102753152 | 228 |
| 88 | 3300025911 | Ga0207654_10259012 | Ga0207654_102590122 | 228 |
| 89 | 3300025913 | Ga0207695_10000778 | Ga0207695_1000077836 | 228 |
| 90 | 3300025914 | Ga0207671_10178562 | Ga0207671_101785622 | 228 |
| 91 | 3300026116 | Ga0207674_10139147 | Ga0207674_101391473 | 228 |
| 92 | 3300046519 | Ga0495632_0003020 | Ga0495632_0003020_9304_9990 | 228 |
| 93 | 3300048924 | Ga0496121_0000082 | Ga0496121_0000082_40993_41688 | 228 |
| 94 | 3300053104 | Ga0500556_0097975 | Ga0500556_0097975_79_801 | 228 |
| 95 | 3300005289 | Ga0065704_10079143 | Ga0065704_100791435 | 229 |
| 96 | 3300005539 | Ga0068853_100031658 | Ga0068853_1000316585 | 229 |
| 97 | 3300005834 | Ga0068851_10168118 | Ga0068851_101681181 | 229 |
| 98 | 3300044658 | Ga0466972_0016642 | Ga0466972_0016642_1896_2585 | 229 |
| 99 | 3300044901 | Ga0466960_0020344 | Ga0466960_0020344_1757_2446 | 229 |
| 100 | 3300013104 | Ga0157370_10000026 | Ga0157370_10000026114 | 230 |
| 101 | iso_pu_bacteria | 2818991442 | 2819575114 | 230 |
| 102 | 3300031730 | Ga0307516_10098227 | Ga0307516_100982274 | 231 |
| 103 | 3300046460 | Ga0495638_0081399 | Ga0495638_0081399_623_1345 | 231 |
| 104 | iso_pu_bacteria | 2889415604 | 2889419908 | 231 |
| 105 | 3300005340 | Ga0070689_100513141 | Ga0070689_1005131411 | 232 |
| 106 | 3300005539 | Ga0068853_100130635 | Ga0068853_1001306354 | 232 |
| 107 | 3300031507 | Ga0307509_10071306 | Ga0307509_100713062 | 232 |
| 108 | 3300044658 | Ga0466972_0000075 | Ga0466972_0000075_48029_48757 | 232 |
| 109 | 3300053111 | Ga0500572_012883 | Ga0500572_012883_273_983 | 232 |
| 110 | iso_pu_bacteria | 2977232053 | 2977236861 | 232 |
| 111 | 3300003323 | rootH1_10092258 | rootH1_100922588 | 233 |
| 112 | 3300003323 | rootH1_10347941 | rootH1_103479413 | 233 |
| 113 | 3300047472 | Ga0495686_0000812 | Ga0495686_0000812_16980_17681 | 233 |
| 114 | iso_pu_bacteria | 2585428061 | 2587751327 | 233 |
| 115 | iso_pu_bacteria | 2585428115 | 2587944043 | 233 |
| 116 | iso_pu_bacteria | 2775506739 | 2775672057 | 233 |
| 117 | iso_pu_bacteria | 2881955468 | 2881957286 | 233 |
| 118 | iso_pu_bacteria | 2919097161 | 2919098507 | 233 |
| 119 | iso_pu_bacteria | 2945924605 | 2945926111 | 233 |
| 120 | iso_pu_bacteria | 2977243572 | 2977245068 | 233 |
| 121 | iso_pu_bacteria | 2993480792 | 2993481434 | 233 |
| 122 | 3300009147 | Ga0114129_10008068 | Ga0114129_100080684 | 234 |
| 123 | 3300009551 | Ga0105238_10000183 | Ga0105238_1000018344 | 234 |
| 124 | 3300025924 | Ga0207694_10000225 | Ga0207694_1000022547 | 234 |
| 125 | 3300028794 | Ga0307515_10000091 | Ga0307515_100000918 | 234 |
| 126 | 3300045049 | Ga0466959_0305185 | Ga0466959_0305185_57_767 | 234 |
| 127 | 3300049579 | Ga0501043_0250984 | Ga0501043_0250984_559_1299 | 234 |
| 128 | 3300050507 | nmdc:mga05p37_10194_c2 | nmdc:mga05p37_10194_c2_7177_7911 | 234 |
| 129 | 3300053158 | Ga0500627_0213398 | Ga0500627_0213398_140_853 | 234 |
| 130 | iso_pu_bacteria | 2738541273 | 2738699134 | 234 |
| 131 | iso_pu_bacteria | 2738541284 | 2738763797 | 234 |
| 132 | iso_pu_bacteria | 2738543014 | 2739254850 | 234 |
| 133 | iso_pu_bacteria | 2884791551 | 2884792371 | 234 |
| 134 | 3300001979 | JGI24740J21852_10001772 | JGI24740J21852_100017728 | 235 |
| 135 | 3300002738 | JGI25154J39366_1000006 | JGI25154J39366_1000006245 | 235 |
| 136 | 3300003215 | JGI25153J46596_10003411 | JGI25153J46596_100034113 | 235 |
| 137 | 3300003316 | rootH1_10054459 | rootH1_100544594 | 235 |
| 138 | 3300003354 | JGI25160J50197_1019743 | JGI25160J50197_10197434 | 235 |
| 139 | 3300005262 | Ga0065165_1003612 | Ga0065165_10036128 | 235 |
| 140 | 3300005289 | Ga0065704_10072273 | Ga0065704_100722737 | 235 |
| 141 | 3300025246 | Ga0209646_1000031 | Ga0209646_1000031274 | 235 |
| 142 | 3300025250 | Ga0209026_1000019 | Ga0209026_1000019274 | 235 |
| 143 | 3300025258 | Ga0209129_1014273 | Ga0209129_10142733 | 235 |
| 144 | 3300025297 | Ga0209758_1012964 | Ga0209758_10129649 | 235 |
| 145 | 3300025302 | Ga0207426_1000327 | Ga0207426_100032723 | 235 |
| 146 | iso_pu_bacteria | 2585428187 | 2588233024 | 235 |
| 147 | iso_pu_bacteria | 2738541302 | 2738856733 | 235 |
| 148 | iso_pu_bacteria | 2739367651 | 2739587405 | 235 |
| 149 | iso_pu_bacteria | 2818991437 | 2819550241 | 235 |
| 150 | iso_pu_bacteria | 2842722452 | 2842726848 | 235 |
| 151 | iso_pu_bacteria | 2842909656 | 2842911690 | 235 |
| 152 | iso_pu_bacteria | 2849281842 | 2849285045 | 235 |
| 153 | iso_pu_bacteria | 2881247448 | 2881247955 | 235 |
| 154 | iso_pu_bacteria | 2929921140 | 2929921605 | 235 |
| 155 | iso_pu_bacteria | 2954016120 | 2954019697 | 235 |
| 156 | iso_pu_bacteria | 8003151029 | 8003152947 | 235 |
| 157 | 3300003323 | rootH1_10029468 | rootH1_100294682 | 236 |
| 158 | 3300005331 | Ga0070670_100278179 | Ga0070670_1002781792 | 236 |
| 159 | 3300005539 | Ga0068853_100698903 | Ga0068853_1006989032 | 236 |
| 160 | 3300006237 | Ga0097621_100024760 | Ga0097621_1000247607 | 236 |
| 161 | 3300006358 | Ga0068871_100098379 | Ga0068871_1000983793 | 236 |
| 162 | 3300006881 | Ga0068865_100332170 | Ga0068865_1003321701 | 236 |
| 163 | 3300009545 | Ga0105237_10001246 | Ga0105237_1000124622 | 236 |
| 164 | 3300013104 | Ga0157370_10015000 | Ga0157370_100150003 | 236 |
| 165 | 3300013297 | Ga0157378_10350769 | Ga0157378_103507692 | 236 |
| 166 | 3300014325 | Ga0163163_10052489 | Ga0163163_100524891 | 236 |
| 167 | 3300014969 | Ga0157376_10240048 | Ga0157376_102400483 | 236 |
| 168 | 3300025254 | Ga0209148_1017437 | Ga0209148_10174372 | 236 |
| 169 | 3300025272 | Ga0209455_1007533 | Ga0209455_10075332 | 236 |
| 170 | 3300025914 | Ga0207671_10003214 | Ga0207671_100032142 | 236 |
| 171 | 3300025925 | Ga0207650_10004151 | Ga0207650_100041512 | 236 |
| 172 | 3300039437 | Ga0436365_0692265 | Ga0436365_0692265_724_1434 | 236 |
| 173 | 3300046694 | Ga0495649_0043872 | Ga0495649_0043872_610_1350 | 236 |
| 174 | 3300053092 | Ga0500583_0000122 | Ga0500583_0000122_31134_31844 | 236 |
| 175 | 3300053136 | Ga0500559_0040763 | Ga0500559_0040763_492_1202 | 236 |
| 176 | iso_pu_bacteria | 2511231000 | 2511231853 | 236 |
| 177 | iso_pu_bacteria | 2582581278 | 2585142956 | 236 |
| 178 | iso_pu_bacteria | 2582581281 | 2585156291 | 236 |
| 179 | iso_pu_bacteria | 2582581282 | 2585160500 | 236 |
| 180 | iso_pu_bacteria | 2585428045 | 2587680184 | 236 |
| 181 | iso_pu_bacteria | 2585428060 | 2587746000 | 236 |
| 182 | iso_pu_bacteria | 2585428182 | 2588210178 | 236 |
| 183 | iso_pu_bacteria | 2585428183 | 2588214606 | 236 |
| 184 | iso_pu_bacteria | 2585428184 | 2588217829 | 236 |
| 185 | iso_pu_bacteria | 2585428185 | 2588222963 | 236 |
| 186 | iso_pu_bacteria | 2588253712 | 2588444241 | 236 |
| 187 | iso_pu_bacteria | 2588254255 | 2590601413 | 236 |
| 188 | iso_pu_bacteria | 2588254257 | 2590614009 | 236 |
| 189 | iso_pu_bacteria | 2728369107 | 2729199906 | 236 |
| 190 | iso_pu_bacteria | 2739367663 | 2739646792 | 236 |
| 191 | iso_pu_bacteria | 2751185877 | 2753673005 | 236 |
| 192 | iso_pu_bacteria | 2765235839 | 2765574084 | 236 |
| 193 | iso_pu_bacteria | 2772190705 | 2772606414 | 236 |
| 194 | iso_pu_bacteria | 2816332188 | 2816874299 | 236 |
| 195 | iso_pu_bacteria | 2818991460 | 2819681646 | 236 |
| 196 | iso_pu_bacteria | 2842083920 | 2842086042 | 236 |
| 197 | iso_pu_bacteria | 2883068021 | 2883069740 | 236 |
| 198 | iso_pu_bacteria | 2889290771 | 2889295398 | 236 |
| 199 | iso_pu_bacteria | 2905999023 | 2905999911 | 236 |
| 200 | 3300001989 | JGI24739J22299_10098821 | JGI24739J22299_100988211 | 237 |
| 201 | 3300002739 | JGI25158J39367_1003541 | JGI25158J39367_10035411 | 237 |
| 202 | 3300003320 | rootH2_10046675 | rootH2_100466754 | 237 |
| 203 | 3300003320 | rootH2_10217350 | rootH2_102173502 | 237 |
| 204 | 3300003322 | rootL2_10255885 | rootL2_102558851 | 237 |
| 205 | 3300003354 | JGI25160J50197_1003360 | JGI25160J50197_10033604 | 237 |
| 206 | 3300003354 | JGI25160J50197_1007832 | JGI25160J50197_10078323 | 237 |
| 207 | 3300003761 | Ga0055535_1002723 | Ga0055535_10027232 | 237 |
| 208 | 3300003762 | Ga0055542_1009110 | Ga0055542_10091103 | 237 |
| 209 | 3300003771 | Ga0055526_1035008 | Ga0055526_10350082 | 237 |
| 210 | 3300003784 | Ga0055534_1006347 | Ga0055534_10063471 | 237 |
| 211 | 3300003790 | Ga0055528_1000052 | Ga0055528_100005227 | 237 |
| 212 | 3300003791 | Ga0055530_10000023 | Ga0055530_1000002399 | 237 |
| 213 | 3300005262 | Ga0065165_1000110 | Ga0065165_100011067 | 237 |
| 214 | 3300005288 | Ga0065714_10064482 | Ga0065714_1006448216 | 237 |
| 215 | 3300005289 | Ga0065704_10094984 | Ga0065704_100949843 | 237 |
| 216 | 3300005329 | Ga0070683_100030439 | Ga0070683_1000304392 | 237 |
| 217 | 3300005337 | Ga0070682_100000339 | Ga0070682_1000003392 | 237 |
| 218 | 3300005347 | Ga0070668_100513956 | Ga0070668_1005139562 | 237 |
| 219 | 3300005535 | Ga0070684_100024134 | Ga0070684_1000241347 | 237 |
| 220 | 3300005563 | Ga0068855_100003439 | Ga0068855_1000034392 | 237 |
| 221 | 3300009036 | Ga0105244_10000001 | Ga0105244_10000001266 | 237 |
| 222 | 3300009148 | Ga0105243_10000601 | Ga0105243_1000060113 | 237 |
| 223 | 3300009545 | Ga0105237_10001779 | Ga0105237_100017796 | 237 |
| 224 | 3300009553 | Ga0105249_10012985 | Ga0105249_100129851 | 237 |
| 225 | 3300013104 | Ga0157370_10001379 | Ga0157370_1000137915 | 237 |
| 226 | 3300013104 | Ga0157370_10051809 | Ga0157370_100518091 | 237 |
| 227 | 3300013104 | Ga0157370_10232366 | Ga0157370_102323661 | 237 |
| 228 | 3300013104 | Ga0157370_10372858 | Ga0157370_103728581 | 237 |
| 229 | 3300013307 | Ga0157372_10263596 | Ga0157372_102635961 | 237 |
| 230 | 3300013308 | Ga0157375_10002061 | Ga0157375_100020613 | 237 |
| 231 | 3300014497 | Ga0182008_10000015 | Ga0182008_10000015185 | 237 |
| 232 | 3300014497 | Ga0182008_10000274 | Ga0182008_100002744 | 237 |
| 233 | 3300014969 | Ga0157376_10565099 | Ga0157376_105650991 | 237 |
| 234 | 3300015261 | Ga0182006_1000003 | Ga0182006_1000003198 | 237 |
| 235 | 3300015261 | Ga0182006_1000120 | Ga0182006_100012039 | 237 |
| 236 | 3300017792 | Ga0163161_10001093 | Ga0163161_1000109311 | 237 |
| 237 | 3300025208 | Ga0209436_100513 | Ga0209436_1005133 | 237 |
| 238 | 3300025242 | Ga0209258_100116 | Ga0209258_100116158 | 237 |
| 239 | 3300025246 | Ga0209646_1004158 | Ga0209646_10041583 | 237 |
| 240 | 3300025254 | Ga0209148_1000175 | Ga0209148_100017589 | 237 |
| 241 | 3300025273 | Ga0209673_1000153 | Ga0209673_100015395 | 237 |
| 242 | 3300025284 | Ga0209130_1002423 | Ga0209130_10024234 | 237 |
| 243 | 3300025291 | Ga0209675_1000053 | Ga0209675_1000053179 | 237 |
| 244 | 3300025295 | Ga0209564_1003629 | Ga0209564_10036298 | 237 |
| 245 | 3300025295 | Ga0209564_1027623 | Ga0209564_10276232 | 237 |
| 246 | 3300025297 | Ga0209758_1027778 | Ga0209758_10277783 | 237 |
| 247 | 3300025298 | Ga0209050_1000377 | Ga0209050_100037764 | 237 |
| 248 | 3300025302 | Ga0207426_1000114 | Ga0207426_100011466 | 237 |
| 249 | 3300025302 | Ga0207426_1000774 | Ga0207426_100077412 | 237 |
| 250 | 3300025303 | Ga0209051_1030989 | Ga0209051_10309892 | 237 |
| 251 | 3300025304 | Ga0209257_1000939 | Ga0209257_100093917 | 237 |
| 252 | 3300025728 | Ga0207655_1000013 | Ga0207655_1000013392 | 237 |
| 253 | 3300025914 | Ga0207671_10053968 | Ga0207671_100539684 | 237 |
| 254 | 3300025919 | Ga0207657_10307325 | Ga0207657_103073252 | 237 |
| 255 | 3300025935 | Ga0207709_10000489 | Ga0207709_1000048918 | 237 |
| 256 | 3300025944 | Ga0207661_10033657 | Ga0207661_100336572 | 237 |
| 257 | 3300025949 | Ga0207667_10006792 | Ga0207667_1000679213 | 237 |
| 258 | 3300025972 | Ga0207668_10295764 | Ga0207668_102957642 | 237 |
| 259 | 3300031911 | Ga0307412_10000032 | Ga0307412_10000032134 | 237 |
| 260 | 3300032002 | Ga0307416_100000017 | Ga0307416_100000017208 | 237 |
| 261 | 3300032004 | Ga0307414_10061323 | Ga0307414_100613232 | 237 |
| 262 | 3300039447 | Ga0436361_0630962 | Ga0436361_0630962_520_1242 | 237 |
| 263 | 3300041413 | Ga0439465_0000110 | Ga0439465_0000110_15815_16528 | 237 |
| 264 | 3300046453 | Ga0495627_007989 | Ga0495627_007989_1811_2527 | 237 |
| 265 | 3300046457 | Ga0495590_0039340 | Ga0495590_0039340_97_813 | 237 |
| 266 | 3300046500 | Ga0495596_0003280 | Ga0495596_0003280_3554_4276 | 237 |
| 267 | 3300046507 | Ga0495606_0001701 | Ga0495606_0001701_7230_7955 | 237 |
| 268 | 3300046507 | Ga0495606_0022840 | Ga0495606_0022840_1577_2308 | 237 |
| 269 | 3300046512 | Ga0495610_0000006 | Ga0495610_0000006_672282_673004 | 237 |
| 270 | 3300046525 | Ga0495663_0001776 | Ga0495663_0001776_290_1015 | 237 |
| 271 | 3300046616 | Ga0495668_0003962 | Ga0495668_0003962_4138_4875 | 237 |
| 272 | 3300048919 | Ga0496116_0000006 | Ga0496116_0000006_208622_209389 | 237 |
| 273 | 3300048920 | Ga0496117_0000027 | Ga0496117_0000027_145791_146558 | 237 |
| 274 | 3300048921 | Ga0496118_0000163 | Ga0496118_0000163_85806_86573 | 237 |
| 275 | 3300048922 | Ga0496119_0000006 | Ga0496119_0000006_443536_444303 | 237 |
| 276 | 3300048925 | Ga0496122_0000073 | Ga0496122_0000073_190618_191340 | 237 |
| 277 | 3300048925 | Ga0496122_0000163 | Ga0496122_0000163_127569_128291 | 237 |
| 278 | 3300048925 | Ga0496122_0000258 | Ga0496122_0000258_92564_93331 | 237 |
| 279 | 3300048925 | Ga0496122_0000782 | Ga0496122_0000782_23193_23912 | 237 |
| 280 | 3300048925 | Ga0496122_0001248 | Ga0496122_0001248_9628_10350 | 237 |
| 281 | 3300048925 | Ga0496122_0012675 | Ga0496122_0012675_3004_3726 | 237 |
| 282 | 3300048926 | Ga0496123_0000853 | Ga0496123_0000853_17116_17883 | 237 |
| 283 | 3300048926 | Ga0496123_0010355 | Ga0496123_0010355_4031_4753 | 237 |
| 284 | 3300048926 | Ga0496123_0010721 | Ga0496123_0010721_750_1469 | 237 |
| 285 | 3300048926 | Ga0496123_0014926 | Ga0496123_0014926_1610_2332 | 237 |
| 286 | 3300048927 | Ga0496124_0001110 | Ga0496124_0001110_36206_36973 | 237 |
| 287 | 3300048928 | Ga0496125_0002152 | Ga0496125_0002152_1311_2033 | 237 |
| 288 | 3300048928 | Ga0496125_0005212 | Ga0496125_0005212_12290_13057 | 237 |
| 289 | 3300048928 | Ga0496125_0038737 | Ga0496125_0038737_1716_2429 | 237 |
| 290 | 3300049758 | Ga0501241_000018 | Ga0501241_000018_83862_84575 | 237 |
| 291 | 3300049765 | Ga0501268_009137 | Ga0501268_009137_26_751 | 237 |
| 292 | 3300049766 | Ga0501269_000014 | Ga0501269_000014_16922_17635 | 237 |
| 293 | 3300053130 | Ga0500642_0108015 | Ga0500642_0108015_312_1025 | 237 |
| 294 | 3300053158 | Ga0500627_0039262 | Ga0500627_0039262_195_908 | 237 |
| 295 | iso_pu_bacteria | 2902048731 | 2902050289 | 237 |
| 296 | iso_pu_bacteria | 2984606641 | 2984608424 | 237 |
| 297 | 3300015261 | Ga0182006_1018332 | Ga0182006_10183322 | 238 |
| 298 | 3300046453 | Ga0495627_000002 | Ga0495627_000002_743727_744449 | 238 |
| 299 | 3300046530 | Ga0495654_0000006 | Ga0495654_0000006_235963_236685 | 238 |
| 300 | 3300047472 | Ga0495686_0005473 | Ga0495686_0005473_903_1625 | 238 |
| 301 | 3300053153 | Ga0500616_0139073 | Ga0500616_0139073_284_1006 | 238 |
| 302 | 3300053156 | Ga0500622_0001663 | Ga0500622_0001663_13389_14108 | 238 |
| 303 | 3300053730 | Ga0500645_021401 | Ga0500645_021401_208_930 | 238 |
| 304 | 3300053730 | Ga0500645_064711 | Ga0500645_064711_127_849 | 238 |
| 305 | iso_pu_bacteria | 2739367874 | 2740058932 | 238 |
| 306 | iso_pu_bacteria | 2818991444 | 2819586037 | 238 |
| 307 | iso_pu_bacteria | 2929177148 | 2929181532 | 238 |
| 308 | iso_pu_bacteria | 2946013367 | 2946016665 | 238 |
| 309 | 2162886007 | SwRhRL2b_contig_886264 | SwRhRL2b_0032.00001760 | 239 |
| 310 | 3300005288 | Ga0065714_10012935 | Ga0065714_100129353 | 239 |
| 311 | 3300013102 | Ga0157371_10033068 | Ga0157371_100330682 | 239 |
| 312 | 3300013296 | Ga0157374_10184740 | Ga0157374_101847402 | 239 |
| 313 | 3300013306 | Ga0163162_10001276 | Ga0163162_1000127615 | 239 |
| 314 | 3300013306 | Ga0163162_10018875 | Ga0163162_100188758 | 239 |
| 315 | 3300013307 | Ga0157372_10000017 | Ga0157372_10000017178 | 239 |
| 316 | 3300015261 | Ga0182006_1000209 | Ga0182006_100020928 | 239 |
| 317 | 3300017792 | Ga0163161_10069535 | Ga0163161_100695352 | 239 |
| 318 | 3300025925 | Ga0207650_10285919 | Ga0207650_102859191 | 239 |
| 319 | 3300026116 | Ga0207674_10247552 | Ga0207674_102475522 | 239 |
| 320 | 3300031251 | Ga0265327_10000024 | Ga0265327_10000024235 | 239 |
| 321 | 3300031616 | Ga0307508_10119826 | Ga0307508_101198262 | 239 |
| 322 | 3300031838 | Ga0307518_10090851 | Ga0307518_100908514 | 239 |
| 323 | 3300032005 | Ga0307411_10064472 | Ga0307411_100644721 | 239 |
| 324 | 3300037312 | Ga0395899_0000382 | Ga0395899_0000382_47959_48687 | 239 |
| 325 | 3300042002 | Ga0439442_002905 | Ga0439442_002905_518_1261 | 239 |
| 326 | 3300042014 | Ga0439457_004560 | Ga0439457_004560_1371_2111 | 239 |
| 327 | 3300042156 | Ga0439446_0032458 | Ga0439446_0032458_239_982 | 239 |
| 328 | 3300042435 | Ga0439434_0031459 | Ga0439434_0031459_545_1288 | 239 |
| 329 | 3300044842 | Ga0466957_0008518 | Ga0466957_0008518_2577_3317 | 239 |
| 330 | 3300046522 | Ga0495643_0000926 | Ga0495643_0000926_9404_10129 | 239 |
| 331 | 3300046660 | Ga0495625_0000825 | Ga0495625_0000825_18726_19454 | 239 |
| 332 | 3300046660 | Ga0495625_0048028 | Ga0495625_0048028_652_1377 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dt0-assembly1.cif.gz_H-2 | proline hydroxylase h11-n101i mutant | 0.7819 | 5 | 227 |
| 4mhr-assembly1.cif.gz_A | crystal structure of ectd from s. alaskensis in its apoform | 0.7719 | 5 | 229 |
| 5ep9-assembly3.cif.gz_C | crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis | 0.7707 | 3 | 223 |
| 5ep9-assembly4.cif.gz_D | crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis | 0.7688 | 3 | 225 |
| 4mhu-assembly3.cif.gz_A | crystal structure of ectd from s. alaskensis with bound fe | 0.7608 | 5 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ep9C00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7707 | 3 | 223 | 2.60.120.620 |
| 4naoA00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7445 | 3 | 223 | 2.60.120.620 |
| 4mhuB00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7422 | 5 | 229 | 2.60.120.620 |
| 5epaF00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7367 | 4 | 225 | 2.60.120.620 |
| 2a1xA00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.7269 | 10 | 222 | 2.60.120.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A086A9S1-F1-model_v4 | Phytanoyl-CoA dioxygenase | 0.9971 | 1 | 236 |
GO:0005506
GO:0016706 |
| AF-A0A135WKG8-F1-model_v4 | Phytanoyl-CoA dioxygenase | 0.997 | 3 | 236 |
GO:0005506
GO:0016706 |
| AF-A0A1A7KH66-F1-model_v4 | Phytanoyl-CoA dioxygenase (PhyH) | 0.9943 | 1 | 237 |
GO:0005506
GO:0016706 |
| AF-A0A7Y0IGF8-F1-model_v4 | Ectoine hydroxylase-related dioxygenase (Phytanoyl-CoA dioxygenase family) | 0.9932 | 1 | 239 |
GO:0005506
GO:0016706 |
| AF-A0A0A2LVR1-F1-model_v4 | Phytanoyl-CoA dioxygenase | 0.9929 | 1 | 239 |
GO:0005506
GO:0016706 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar