F410940

General Info

Members Datasets Scaffolds Average Seq Length
332 243 276 235

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10184740|Ga0157374_101847402
Length 274
Sequence MVSSAIKQQLATVPARRTLLPSRRKYFFVVRQLKVTSYMKQTDDFLVNGFATVDNIYTTEEVDRILNIISQANSEKETFRKSADLFAIRQFLTEVPATIDTIFNNNLKSVLTPLLGDKYFVVKSIYFDKPQTSNWYVSYHQDLTISVDKKLALNGFEFWTTKQNQFAVQPPLDILQKVVTVRIHLDDTDENNGALKVVPKSHSKGIYRPESIDWTIENEVCCNVSKGGIMLMKPLLLHSSGRTTNDRQRRVIHIEFSNQELPTELNWAERLNLN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
9 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
20 2738541284 Pedobacter sp. YR016 Isolate Unclassified
21 2738541302 Pedobacter sp. CF074 Isolate Unclassified
22 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
23 2739367651 Pedobacter sp. OK291 Isolate Unclassified
24 2739367663 Pedobacter sp. YR510 Isolate Unclassified
25 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
26 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
27 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
28 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
29 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
30 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
31 2818991437 Pedobacter terrae 518 Isolate Unclassified
32 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
33 2818991444 Filimonas endophytica 3197 Isolate Unclassified
34 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
35 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
36 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
37 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
38 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
39 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
40 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
41 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
42 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
43 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
44 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
45 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
46 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
47 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
48 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
49 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
50 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
51 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
52 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
53 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
54 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
55 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
56 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
57 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
60 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
189 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
241 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.13
Metatranscriptomes 0
Isolates 16.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 16.27
Nodule 0
Rhizoplane 0.6
Rhizosphere 64.46
Stem 0
Stem Tuber 0
Unclassified 18.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_886264 2162886007 Bacteria 1451
2 JGI24740J21852_10001772 3300001979 Bacteria 9900
3 JGI24739J22299_10002672 3300001989 Bacteria 6867
4 JGI24739J22299_10017158 3300001989 Bacteria 2615
5 JGI24739J22299_10098821 3300001989 Bacteria 882
6 JGI24737J22298_10002813 3300001990 Bacteria 6162
7 JGI24735J21928_10000006 3300002067 Bacteria 339303
8 JGI25154J39366_1000006 3300002738 Bacteria 336396
9 JGI25158J39367_1003541 3300002739 Bacteria 2399
10 JGI25152J39213_1000345 3300002773 Bacteria 29225
11 JGI25150J39212_1000011 3300002774 Bacteria 195312
12 JGI25151J46595_10000033 3300003187 Bacteria 195312
13 JGI25153J46596_10000052 3300003215 Bacteria 139303
14 JGI25153J46596_10003411 3300003215 Bacteria 8898
15 rootH1_10054459 3300003316 Bacteria 5069
16 rootH2_10046675 3300003320 Bacteria 8784
17 rootH2_10217350 3300003320 Bacteria 2532
18 rootL2_10255885 3300003322 Bacteria 1933
19 rootH1_10011869 3300003323 Bacteria 39408
20 rootH1_10029468 3300003323 Bacteria 1871
21 rootH1_10092258 3300003323 Bacteria 14912
22 rootH1_10347941 3300003323 Bacteria 1824
23 JGI25160J50197_1003360 3300003354 Bacteria 7176
24 JGI25160J50197_1007832 3300003354 Bacteria 4134
25 JGI25160J50197_1019743 3300003354 Bacteria 2057
26 Ga0055535_1002723 3300003761 Bacteria 5703
27 Ga0055542_1009110 3300003762 Bacteria 1893
28 Ga0055526_1035008 3300003771 Bacteria 1361
29 Ga0055534_1006347 3300003784 Bacteria 2988
30 Ga0055528_1000052 3300003790 Bacteria 91910
31 Ga0055530_10000023 3300003791 Bacteria 135890
32 Ga0065165_1000110 3300005262 Bacteria 137063
33 Ga0065165_1003612 3300005262 Bacteria 10618
34 Ga0065714_10002205 3300005288 Bacteria 57702
35 Ga0065714_10012935 3300005288 Bacteria 4354
36 Ga0065714_10064482 3300005288 Bacteria 53779
37 Ga0065704_10072273 3300005289 Bacteria 8820
38 Ga0065704_10079143 3300005289 Bacteria 4247
39 Ga0065704_10094984 3300005289 Bacteria 2456
40 Ga0070658_10001730 3300005327 Bacteria 18401
41 Ga0070683_100030439 3300005329 Bacteria 4900
42 Ga0070690_100131212 3300005330 Unclassified 1692
43 Ga0070670_100278179 3300005331 Bacteria 1461
44 Ga0070670_100472336 3300005331 Bacteria 1113
45 Ga0070682_100000339 3300005337 Bacteria 32181
46 Ga0070689_100513141 3300005340 Unclassified 1028
47 Ga0070668_100513956 3300005347 Bacteria 1038
48 Ga0070701_10001554 3300005438 Bacteria 8516
49 Ga0070684_100024134 3300005535 Bacteria 5098
50 Ga0068853_100031658 3300005539 Bacteria 4475
51 Ga0068853_100130635 3300005539 Bacteria 2248
52 Ga0068853_100415508 3300005539 Bacteria 1261
53 Ga0068853_100698903 3300005539 Unclassified 967
54 Ga0070686_100020618 3300005544 Unclassified 3903
55 Ga0070704_100036269 3300005549 Unclassified 3359
56 Ga0068855_100000009 3300005563 Bacteria 246035
57 Ga0068855_100003439 3300005563 Bacteria 19374
58 Ga0068857_100305154 3300005577 Bacteria 1468
59 Ga0068856_100011181 3300005614 Bacteria 8713
60 Ga0068856_100623625 3300005614 Bacteria 1099
61 Ga0068851_10168118 3300005834 Bacteria 1208
62 Ga0097621_100024760 3300006237 Bacteria 4691
63 Ga0068871_100098379 3300006358 Bacteria 2447
64 Ga0075428_100325802 3300006844 Bacteria 1650
65 Ga0075429_100216680 3300006880 Bacteria 1677
66 Ga0068865_100332170 3300006881 Bacteria 1226
67 Ga0105244_10000001 3300009036 Bacteria 1034899
68 Ga0105244_10017451 3300009036 Bacteria 4055
69 Ga0105240_10000487 3300009093 Bacteria 73453
70 Ga0105240_10419167 3300009093 Bacteria 1504
71 Ga0114129_10008068 3300009147 Bacteria 15001
72 Ga0105243_10000006 3300009148 Bacteria 465541
73 Ga0105243_10000601 3300009148 Bacteria 35879
74 Ga0105241_10168017 3300009174 Unclassified 1809
75 Ga0105237_10001246 3300009545 Bacteria 33969
76 Ga0105237_10001779 3300009545 Bacteria 27854
77 Ga0105237_10275315 3300009545 Unclassified 1686
78 Ga0105238_10000183 3300009551 Bacteria 68599
79 Ga0105238_10082989 3300009551 Bacteria 3194
80 Ga0105249_10012985 3300009553 Bacteria 7351
81 Ga0105239_10297843 3300010375 Bacteria 1816
82 Ga0105239_10366453 3300010375 Bacteria 1628
83 Ga0157371_10000482 3300013102 Bacteria 48630
84 Ga0157371_10013676 3300013102 Bacteria 6157
85 Ga0157371_10033068 3300013102 Bacteria 3718
86 Ga0157371_10111152 3300013102 Bacteria 1945
87 Ga0157370_10000026 3300013104 Bacteria 152092
88 Ga0157370_10001379 3300013104 Bacteria 30046
89 Ga0157370_10005442 3300013104 Bacteria 14281
90 Ga0157370_10015000 3300013104 Bacteria 7900
91 Ga0157370_10051809 3300013104 Bacteria 3920
92 Ga0157370_10232366 3300013104 Bacteria 1706
93 Ga0157370_10372858 3300013104 Bacteria 1315
94 Ga0157369_10000285 3300013105 Bacteria 67687
95 Ga0157369_10174952 3300013105 Bacteria 2260
96 Ga0157374_10184740 3300013296 Bacteria 2038
97 Ga0157378_10350769 3300013297 Bacteria 1441
98 Ga0163162_10001276 3300013306 Bacteria 23566
99 Ga0163162_10018875 3300013306 Bacteria 6761
100 Ga0157372_10000017 3300013307 Bacteria 219543
101 Ga0157372_10002801 3300013307 Bacteria 18838
102 Ga0157372_10263596 3300013307 Bacteria 2001
103 Ga0157375_10002061 3300013308 Bacteria 17358
104 Ga0157375_10901874 3300013308 Bacteria 1028
105 Ga0163163_10052489 3300014325 Bacteria 4022
106 Ga0182008_10000015 3300014497 Bacteria 243121
107 Ga0182008_10000020 3300014497 Bacteria 228333
108 Ga0182008_10000274 3300014497 Bacteria 40340
109 Ga0157376_10240048 3300014969 Bacteria 1688
110 Ga0157376_10565099 3300014969 Bacteria 1127
111 Ga0182006_1000003 3300015261 Bacteria 826681
112 Ga0182006_1000120 3300015261 Bacteria 84872
113 Ga0182006_1000209 3300015261 Bacteria 58193
114 Ga0182006_1018332 3300015261 Bacteria 2960
115 Ga0182007_10000016 3300015262 Bacteria 202375
116 Ga0183373_1011 3300015682 Bacteria 138873
117 Ga0163161_10001093 3300017792 Bacteria 20526
118 Ga0163161_10069535 3300017792 Bacteria 2573
119 Ga0163161_10099636 3300017792 Bacteria 2161
120 Ga0209436_100513 3300025208 Bacteria 16909
121 Ga0209258_100116 3300025242 Bacteria 190317
122 Ga0207425_1000003 3300025245 Bacteria 1145342
123 Ga0209646_1000031 3300025246 Bacteria 381260
124 Ga0209646_1004158 3300025246 Unclassified 2681
125 Ga0209026_1000019 3300025250 Bacteria 381260
126 Ga0209148_1000175 3300025254 Bacteria 129536
127 Ga0209148_1017437 3300025254 Bacteria 1219
128 Ga0209129_1000076 3300025258 Bacteria 195353
129 Ga0209129_1014273 3300025258 Bacteria 1700
130 Ga0209455_1007533 3300025272 Bacteria 3062
131 Ga0209673_1000153 3300025273 Bacteria 146821
132 Ga0209130_1002423 3300025284 Bacteria 9390
133 Ga0209675_1000053 3300025291 Bacteria 194511
134 Ga0209025_1000007 3300025294 Bacteria 1145109
135 Ga0209564_1003629 3300025295 Bacteria 10258
136 Ga0209564_1027623 3300025295 Bacteria 1838
137 Ga0209758_1000114 3300025297 Bacteria 199324
138 Ga0209758_1012964 3300025297 Bacteria 4601
139 Ga0209758_1027778 3300025297 Bacteria 2410
140 Ga0209050_1000377 3300025298 Bacteria 84222
141 Ga0207426_1000114 3300025302 Bacteria 228273
142 Ga0207426_1000327 3300025302 Bacteria 90905
143 Ga0207426_1000774 3300025302 Bacteria 35182
144 Ga0209051_1030989 3300025303 Bacteria 2066
145 Ga0209257_1000939 3300025304 Bacteria 40250
146 Ga0207655_1000013 3300025728 Bacteria 637510
147 Ga0207655_1018196 3300025728 Bacteria 3744
148 Ga0207705_10007213 3300025909 Bacteria 8184
149 Ga0207654_10259012 3300025911 Unclassified 1169
150 Ga0207695_10000778 3300025913 Bacteria 60342
151 Ga0207695_10002667 3300025913 Bacteria 26073
152 Ga0207671_10003214 3300025914 Bacteria 16444
153 Ga0207671_10022021 3300025914 Bacteria 4826
154 Ga0207671_10053968 3300025914 Bacteria 2978
155 Ga0207671_10178562 3300025914 Unclassified 1651
156 Ga0207657_10307325 3300025919 Bacteria 1255
157 Ga0207657_10501909 3300025919 Unclassified 950
158 Ga0207694_10000225 3300025924 Bacteria 54907
159 Ga0207650_10004151 3300025925 Bacteria 9903
160 Ga0207650_10285919 3300025925 Bacteria 1344
161 Ga0207709_10000007 3300025935 Bacteria 752025
162 Ga0207709_10000489 3300025935 Bacteria 35962
163 Ga0207661_10033657 3300025944 Bacteria 3979
164 Ga0207667_10000045 3300025949 Bacteria 246053
165 Ga0207667_10006792 3300025949 Bacteria 13818
166 Ga0207667_10029126 3300025949 Bacteria 5990
167 Ga0207668_10295764 3300025972 Bacteria 1334
168 Ga0207648_10333603 3300026089 Bacteria 1364
169 Ga0207674_10075650 3300026116 Bacteria 3376
170 Ga0207674_10139147 3300026116 Bacteria 2388
171 Ga0207674_10247552 3300026116 Unclassified 1729
172 Ga0307515_10000091 3300028794 Bacteria 214014
173 Ga0307511_10072117 3300030521 Bacteria 2511
174 Ga0265327_10000024 3300031251 Bacteria 382499
175 Ga0307509_10071306 3300031507 Bacteria 3625
176 Ga0307508_10119826 3300031616 Bacteria 2234
177 Ga0307516_10098227 3300031730 Unclassified 2747
178 Ga0307405_10000023 3300031731 Bacteria 141450
179 Ga0307518_10090851 3300031838 Bacteria 2197
180 Ga0307412_10000032 3300031911 Bacteria 207098
181 Ga0307416_100000017 3300032002 Bacteria 201722
182 Ga0307414_10061323 3300032004 Bacteria 2664
183 Ga0307411_10064472 3300032005 Bacteria 2453
184 Ga0373930_0008558 3300034816 Bacteria 1791
185 Ga0373928_0000035 3300035084 Bacteria 23241
186 Ga0373949_0008628 3300035090 Bacteria 2230
187 Ga0373932_0000007 3300035112 Bacteria 207459
188 Ga0373945_0032738 3300035116 Bacteria 1843
189 Ga0373946_0108958 3300035171 Bacteria 1251
190 Ga0373962_0000111 3300035242 Bacteria 17722
191 Ga0316574_0116655 3300035398 Bacteria 1713
192 Ga0373931_0000024 3300035691 Bacteria 129909
193 Ga0373935_0125300 3300035692 Unclassified 1720
194 Ga0373927_0011615 3300035695 Bacteria 5864
195 Ga0373927_0067737 3300035695 Bacteria 2309
196 Ga0316584_0008562 3300036712 Bacteria 7053
197 Ga0373925_0000403 3300037068 Bacteria 43935
198 Ga0395899_0000382 3300037312 Bacteria 52888
199 Ga0436365_0692265 3300039437 Bacteria 1551
200 Ga0436361_0630962 3300039447 Bacteria 1252
201 Ga0439465_0000110 3300041413 Bacteria 19080
202 Ga0451802_1850536 3300041460 Bacteria 1135
203 Ga0451806_480488 3300041462 Bacteria 1011
204 Ga0439442_002905 3300042002 Bacteria 3376
205 Ga0439457_004560 3300042014 Bacteria 3594
206 Ga0439446_0032458 3300042156 Bacteria 1515
207 Ga0439434_0031459 3300042435 Bacteria 1613
208 Ga0466972_0000075 3300044658 Bacteria 94290
209 Ga0466972_0016642 3300044658 Bacteria 3676
210 Ga0466957_0008518 3300044842 Bacteria 5836
211 Ga0466960_0020344 3300044901 Bacteria 2939
212 Ga0466959_0305185 3300045049 Bacteria 1090
213 Ga0451576_0095432 3300045051 Unclassified 3093
214 Ga0495627_000002 3300046453 Bacteria 903861
215 Ga0495627_007989 3300046453 Bacteria 4000
216 Ga0495590_0039340 3300046457 Bacteria 1649
217 Ga0495638_0081399 3300046460 Bacteria 1966
218 Ga0495650_0012456 3300046471 Bacteria 4575
219 Ga0495596_0003280 3300046500 Bacteria 8258
220 Ga0495606_0001701 3300046507 Bacteria 28416
221 Ga0495606_0022840 3300046507 Bacteria 4545
222 Ga0495610_0000006 3300046512 Bacteria 856822
223 Ga0495631_0117255 3300046518 Bacteria 1145
224 Ga0495632_0003020 3300046519 Bacteria 12269
225 Ga0495643_0000926 3300046522 Bacteria 30682
226 Ga0495663_0001776 3300046525 Bacteria 6680
227 Ga0495654_0000006 3300046530 Bacteria 451432
228 Ga0495668_0003962 3300046616 Bacteria 10791
229 Ga0495625_0000825 3300046660 Bacteria 42700
230 Ga0495625_0048028 3300046660 Bacteria 3075
231 Ga0495649_0043872 3300046694 Bacteria 2441
232 Ga0495686_0000010 3300047472 Bacteria 573229
233 Ga0495686_0000812 3300047472 Bacteria 40457
234 Ga0495686_0005473 3300047472 Bacteria 10007
235 Ga0496116_0000006 3300048919 Bacteria 811937
236 Ga0496117_0000027 3300048920 Bacteria 412234
237 Ga0496118_0000163 3300048921 Bacteria 119492
238 Ga0496119_0000006 3300048922 Bacteria 505999
239 Ga0496121_0000082 3300048924 Bacteria 228557
240 Ga0496122_0000073 3300048925 Bacteria 222403
241 Ga0496122_0000163 3300048925 Bacteria 158337
242 Ga0496122_0000258 3300048925 Bacteria 119618
243 Ga0496122_0000782 3300048925 Bacteria 61189
244 Ga0496122_0001248 3300048925 Bacteria 42723
245 Ga0496122_0012675 3300048925 Bacteria 8354
246 Ga0496123_0000853 3300048926 Bacteria 48656
247 Ga0496123_0010355 3300048926 Bacteria 8255
248 Ga0496123_0010721 3300048926 Bacteria 8053
249 Ga0496123_0014926 3300048926 Bacteria 6404
250 Ga0496124_0001110 3300048927 Bacteria 42348
251 Ga0496125_0002152 3300048928 Bacteria 26391
252 Ga0496125_0005212 3300048928 Bacteria 14587
253 Ga0496125_0038737 3300048928 Bacteria 4118
254 Ga0501034_0286974 3300049571 Bacteria 1585
255 Ga0501043_0250984 3300049579 Bacteria 1363
256 Ga0501225_0003596 3300049705 Bacteria 4672
257 Ga0501080_0013495 3300049742 Bacteria 7517
258 Ga0501241_000018 3300049758 Bacteria 95195
259 Ga0501268_009137 3300049765 Bacteria 1518
260 Ga0501269_000014 3300049766 Bacteria 59850
261 nmdc:mga05p37_10194_c2 3300050507 Bacteria 9428
262 nmdc:mga09592_210681_c1 3300050508 Bacteria 1684
263 Ga0500578_0000091 3300053086 Bacteria 102427
264 Ga0500578_0047180 3300053086 Bacteria 2764
265 Ga0500583_0000122 3300053092 Bacteria 36660
266 Ga0500556_0097975 3300053104 Bacteria 1127
267 Ga0500572_012883 3300053111 Bacteria 2058
268 Ga0500642_0108015 3300053130 Unclassified 1298
269 Ga0500559_0040763 3300053136 Unclassified 2023
270 Ga0500616_0139073 3300053153 Bacteria 1137
271 Ga0500622_0001663 3300053156 Bacteria 17376
272 Ga0500624_000311 3300053157 Bacteria 16698
273 Ga0500627_0039262 3300053158 Unclassified 2026
274 Ga0500627_0213398 3300053158 Unclassified 863
275 Ga0500645_021401 3300053730 Bacteria 1996
276 Ga0500645_064711 3300053730 Bacteria 1054

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0125300 Ga0373935_0125300_1139_1672 175
2 3300009551 Ga0105238_10082989 Ga0105238_100829892 189
3 3300025913 Ga0207695_10002667 Ga0207695_1000266710 189
4 3300025914 Ga0207671_10022021 Ga0207671_100220214 189
5 3300046471 Ga0495650_0012456 Ga0495650_0012456_2477_3235 212
6 3300002773 JGI25152J39213_1000345 JGI25152J39213_10003455 215
7 3300002774 JGI25150J39212_1000011 JGI25150J39212_100001132 215
8 3300003187 JGI25151J46595_10000033 JGI25151J46595_1000003332 215
9 3300003215 JGI25153J46596_10000052 JGI25153J46596_1000005292 215
10 3300025245 Ga0207425_1000003 Ga0207425_1000003863 215
11 3300025258 Ga0209129_1000076 Ga0209129_100007631 215
12 3300025294 Ga0209025_1000007 Ga0209025_1000007862 215
13 3300025297 Ga0209758_1000114 Ga0209758_1000114136 215
14 3300049705 Ga0501225_0003596 Ga0501225_0003596_1935_2651 215
15 3300003323 rootH1_10011869 rootH1_1001186924 217
16 3300053086 Ga0500578_0000091 Ga0500578_0000091_84593_85321 217
17 3300049742 Ga0501080_0013495 Ga0501080_0013495_4266_4928 218
18 3300010375 Ga0105239_10366453 Ga0105239_103664531 219
19 3300031731 Ga0307405_10000023 Ga0307405_1000002399 219
20 3300034816 Ga0373930_0008558 Ga0373930_0008558_215_880 219
21 3300035084 Ga0373928_0000035 Ga0373928_0000035_6323_6988 219
22 3300035090 Ga0373949_0008628 Ga0373949_0008628_999_1664 219
23 3300035112 Ga0373932_0000007 Ga0373932_0000007_70140_70805 219
24 3300035116 Ga0373945_0032738 Ga0373945_0032738_243_908 219
25 3300035171 Ga0373946_0108958 Ga0373946_0108958_135_800 219
26 3300035242 Ga0373962_0000111 Ga0373962_0000111_7742_8407 219
27 3300035691 Ga0373931_0000024 Ga0373931_0000024_29838_30503 219
28 3300035695 Ga0373927_0011615 Ga0373927_0011615_4847_5512 219
29 3300035695 Ga0373927_0067737 Ga0373927_0067737_1239_1904 219
30 3300037068 Ga0373925_0000403 Ga0373925_0000403_12243_12908 219
31 3300049571 Ga0501034_0286974 Ga0501034_0286974_737_1402 219
32 3300005563 Ga0068855_100000009 Ga0068855_100000009227 220
33 3300006844 Ga0075428_100325802 Ga0075428_1003258023 220
34 3300006880 Ga0075429_100216680 Ga0075429_1002166803 220
35 3300014497 Ga0182008_10000020 Ga0182008_1000002065 220
36 3300025949 Ga0207667_10000045 Ga0207667_1000004510 220
37 3300035398 Ga0316574_0116655 Ga0316574_0116655_482_1159 220
38 3300036712 Ga0316584_0008562 Ga0316584_0008562_1013_1690 220
39 3300050508 nmdc:mga09592_210681_c1 nmdc:mga09592_210681_c1_124_861 220
40 3300053157 Ga0500624_000311 Ga0500624_000311_2144_2875 220
41 3300005330 Ga0070690_100131212 Ga0070690_1001312122 221
42 3300005331 Ga0070670_100472336 Ga0070670_1004723361 221
43 3300005438 Ga0070701_10001554 Ga0070701_100015543 221
44 3300005544 Ga0070686_100020618 Ga0070686_1000206182 221
45 3300005549 Ga0070704_100036269 Ga0070704_1000362692 221
46 3300009148 Ga0105243_10000006 Ga0105243_10000006205 221
47 3300025935 Ga0207709_10000007 Ga0207709_10000007444 221
48 3300030521 Ga0307511_10072117 Ga0307511_100721174 221
49 3300045051 Ga0451576_0095432 Ga0451576_0095432_2211_2903 221
50 3300005614 Ga0068856_100623625 Ga0068856_1006236252 222
51 3300041460 Ga0451802_1850536 Ga0451802_1850536_190_921 222
52 3300053086 Ga0500578_0047180 Ga0500578_0047180_1193_1921 222
53 3300005288 Ga0065714_10002205 Ga0065714_1000220510 223
54 3300009036 Ga0105244_10017451 Ga0105244_100174513 223
55 3300010375 Ga0105239_10297843 Ga0105239_102978433 223
56 3300013105 Ga0157369_10000285 Ga0157369_1000028554 223
57 3300015262 Ga0182007_10000016 Ga0182007_1000001686 223
58 3300025728 Ga0207655_1018196 Ga0207655_10181963 223
59 3300041462 Ga0451806_480488 Ga0451806_480488_269_1000 223
60 3300047472 Ga0495686_0000010 Ga0495686_0000010_297411_298082 223
61 3300005327 Ga0070658_10001730 Ga0070658_1000173010 224
62 3300013102 Ga0157371_10000482 Ga0157371_1000048243 224
63 3300013308 Ga0157375_10901874 Ga0157375_109018742 224
64 3300015682 Ga0183373_1011 Ga0183373_101150 224
65 3300017792 Ga0163161_10099636 Ga0163161_100996362 224
66 3300025909 Ga0207705_10007213 Ga0207705_100072135 224
67 3300025919 Ga0207657_10501909 Ga0207657_105019091 224
68 3300025949 Ga0207667_10029126 Ga0207667_100291266 224
69 3300001989 JGI24739J22299_10017158 JGI24739J22299_100171582 226
70 3300001990 JGI24737J22298_10002813 JGI24737J22298_100028133 226
71 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006225 226
72 3300013102 Ga0157371_10111152 Ga0157371_101111522 226
73 3300013105 Ga0157369_10174952 Ga0157369_101749523 226
74 3300013307 Ga0157372_10002801 Ga0157372_1000280111 226
75 3300046518 Ga0495631_0117255 Ga0495631_0117255_150_869 226
76 3300001989 JGI24739J22299_10002672 JGI24739J22299_100026727 227
77 3300005577 Ga0068857_100305154 Ga0068857_1003051542 227
78 3300013102 Ga0157371_10013676 Ga0157371_100136764 227
79 3300013104 Ga0157370_10005442 Ga0157370_1000544214 227
80 3300026089 Ga0207648_10333603 Ga0207648_103336031 227
81 3300026116 Ga0207674_10075650 Ga0207674_100756502 227
82 3300005539 Ga0068853_100415508 Ga0068853_1004155082 228
83 3300005614 Ga0068856_100011181 Ga0068856_1000111818 228
84 3300009093 Ga0105240_10000487 Ga0105240_1000048716 228
85 3300009093 Ga0105240_10419167 Ga0105240_104191671 228
86 3300009174 Ga0105241_10168017 Ga0105241_101680172 228
87 3300009545 Ga0105237_10275315 Ga0105237_102753152 228
88 3300025911 Ga0207654_10259012 Ga0207654_102590122 228
89 3300025913 Ga0207695_10000778 Ga0207695_1000077836 228
90 3300025914 Ga0207671_10178562 Ga0207671_101785622 228
91 3300026116 Ga0207674_10139147 Ga0207674_101391473 228
92 3300046519 Ga0495632_0003020 Ga0495632_0003020_9304_9990 228
93 3300048924 Ga0496121_0000082 Ga0496121_0000082_40993_41688 228
94 3300053104 Ga0500556_0097975 Ga0500556_0097975_79_801 228
95 3300005289 Ga0065704_10079143 Ga0065704_100791435 229
96 3300005539 Ga0068853_100031658 Ga0068853_1000316585 229
97 3300005834 Ga0068851_10168118 Ga0068851_101681181 229
98 3300044658 Ga0466972_0016642 Ga0466972_0016642_1896_2585 229
99 3300044901 Ga0466960_0020344 Ga0466960_0020344_1757_2446 229
100 3300013104 Ga0157370_10000026 Ga0157370_10000026114 230
101 iso_pu_bacteria 2818991442 2819575114 230
102 3300031730 Ga0307516_10098227 Ga0307516_100982274 231
103 3300046460 Ga0495638_0081399 Ga0495638_0081399_623_1345 231
104 iso_pu_bacteria 2889415604 2889419908 231
105 3300005340 Ga0070689_100513141 Ga0070689_1005131411 232
106 3300005539 Ga0068853_100130635 Ga0068853_1001306354 232
107 3300031507 Ga0307509_10071306 Ga0307509_100713062 232
108 3300044658 Ga0466972_0000075 Ga0466972_0000075_48029_48757 232
109 3300053111 Ga0500572_012883 Ga0500572_012883_273_983 232
110 iso_pu_bacteria 2977232053 2977236861 232
111 3300003323 rootH1_10092258 rootH1_100922588 233
112 3300003323 rootH1_10347941 rootH1_103479413 233
113 3300047472 Ga0495686_0000812 Ga0495686_0000812_16980_17681 233
114 iso_pu_bacteria 2585428061 2587751327 233
115 iso_pu_bacteria 2585428115 2587944043 233
116 iso_pu_bacteria 2775506739 2775672057 233
117 iso_pu_bacteria 2881955468 2881957286 233
118 iso_pu_bacteria 2919097161 2919098507 233
119 iso_pu_bacteria 2945924605 2945926111 233
120 iso_pu_bacteria 2977243572 2977245068 233
121 iso_pu_bacteria 2993480792 2993481434 233
122 3300009147 Ga0114129_10008068 Ga0114129_100080684 234
123 3300009551 Ga0105238_10000183 Ga0105238_1000018344 234
124 3300025924 Ga0207694_10000225 Ga0207694_1000022547 234
125 3300028794 Ga0307515_10000091 Ga0307515_100000918 234
126 3300045049 Ga0466959_0305185 Ga0466959_0305185_57_767 234
127 3300049579 Ga0501043_0250984 Ga0501043_0250984_559_1299 234
128 3300050507 nmdc:mga05p37_10194_c2 nmdc:mga05p37_10194_c2_7177_7911 234
129 3300053158 Ga0500627_0213398 Ga0500627_0213398_140_853 234
130 iso_pu_bacteria 2738541273 2738699134 234
131 iso_pu_bacteria 2738541284 2738763797 234
132 iso_pu_bacteria 2738543014 2739254850 234
133 iso_pu_bacteria 2884791551 2884792371 234
134 3300001979 JGI24740J21852_10001772 JGI24740J21852_100017728 235
135 3300002738 JGI25154J39366_1000006 JGI25154J39366_1000006245 235
136 3300003215 JGI25153J46596_10003411 JGI25153J46596_100034113 235
137 3300003316 rootH1_10054459 rootH1_100544594 235
138 3300003354 JGI25160J50197_1019743 JGI25160J50197_10197434 235
139 3300005262 Ga0065165_1003612 Ga0065165_10036128 235
140 3300005289 Ga0065704_10072273 Ga0065704_100722737 235
141 3300025246 Ga0209646_1000031 Ga0209646_1000031274 235
142 3300025250 Ga0209026_1000019 Ga0209026_1000019274 235
143 3300025258 Ga0209129_1014273 Ga0209129_10142733 235
144 3300025297 Ga0209758_1012964 Ga0209758_10129649 235
145 3300025302 Ga0207426_1000327 Ga0207426_100032723 235
146 iso_pu_bacteria 2585428187 2588233024 235
147 iso_pu_bacteria 2738541302 2738856733 235
148 iso_pu_bacteria 2739367651 2739587405 235
149 iso_pu_bacteria 2818991437 2819550241 235
150 iso_pu_bacteria 2842722452 2842726848 235
151 iso_pu_bacteria 2842909656 2842911690 235
152 iso_pu_bacteria 2849281842 2849285045 235
153 iso_pu_bacteria 2881247448 2881247955 235
154 iso_pu_bacteria 2929921140 2929921605 235
155 iso_pu_bacteria 2954016120 2954019697 235
156 iso_pu_bacteria 8003151029 8003152947 235
157 3300003323 rootH1_10029468 rootH1_100294682 236
158 3300005331 Ga0070670_100278179 Ga0070670_1002781792 236
159 3300005539 Ga0068853_100698903 Ga0068853_1006989032 236
160 3300006237 Ga0097621_100024760 Ga0097621_1000247607 236
161 3300006358 Ga0068871_100098379 Ga0068871_1000983793 236
162 3300006881 Ga0068865_100332170 Ga0068865_1003321701 236
163 3300009545 Ga0105237_10001246 Ga0105237_1000124622 236
164 3300013104 Ga0157370_10015000 Ga0157370_100150003 236
165 3300013297 Ga0157378_10350769 Ga0157378_103507692 236
166 3300014325 Ga0163163_10052489 Ga0163163_100524891 236
167 3300014969 Ga0157376_10240048 Ga0157376_102400483 236
168 3300025254 Ga0209148_1017437 Ga0209148_10174372 236
169 3300025272 Ga0209455_1007533 Ga0209455_10075332 236
170 3300025914 Ga0207671_10003214 Ga0207671_100032142 236
171 3300025925 Ga0207650_10004151 Ga0207650_100041512 236
172 3300039437 Ga0436365_0692265 Ga0436365_0692265_724_1434 236
173 3300046694 Ga0495649_0043872 Ga0495649_0043872_610_1350 236
174 3300053092 Ga0500583_0000122 Ga0500583_0000122_31134_31844 236
175 3300053136 Ga0500559_0040763 Ga0500559_0040763_492_1202 236
176 iso_pu_bacteria 2511231000 2511231853 236
177 iso_pu_bacteria 2582581278 2585142956 236
178 iso_pu_bacteria 2582581281 2585156291 236
179 iso_pu_bacteria 2582581282 2585160500 236
180 iso_pu_bacteria 2585428045 2587680184 236
181 iso_pu_bacteria 2585428060 2587746000 236
182 iso_pu_bacteria 2585428182 2588210178 236
183 iso_pu_bacteria 2585428183 2588214606 236
184 iso_pu_bacteria 2585428184 2588217829 236
185 iso_pu_bacteria 2585428185 2588222963 236
186 iso_pu_bacteria 2588253712 2588444241 236
187 iso_pu_bacteria 2588254255 2590601413 236
188 iso_pu_bacteria 2588254257 2590614009 236
189 iso_pu_bacteria 2728369107 2729199906 236
190 iso_pu_bacteria 2739367663 2739646792 236
191 iso_pu_bacteria 2751185877 2753673005 236
192 iso_pu_bacteria 2765235839 2765574084 236
193 iso_pu_bacteria 2772190705 2772606414 236
194 iso_pu_bacteria 2816332188 2816874299 236
195 iso_pu_bacteria 2818991460 2819681646 236
196 iso_pu_bacteria 2842083920 2842086042 236
197 iso_pu_bacteria 2883068021 2883069740 236
198 iso_pu_bacteria 2889290771 2889295398 236
199 iso_pu_bacteria 2905999023 2905999911 236
200 3300001989 JGI24739J22299_10098821 JGI24739J22299_100988211 237
201 3300002739 JGI25158J39367_1003541 JGI25158J39367_10035411 237
202 3300003320 rootH2_10046675 rootH2_100466754 237
203 3300003320 rootH2_10217350 rootH2_102173502 237
204 3300003322 rootL2_10255885 rootL2_102558851 237
205 3300003354 JGI25160J50197_1003360 JGI25160J50197_10033604 237
206 3300003354 JGI25160J50197_1007832 JGI25160J50197_10078323 237
207 3300003761 Ga0055535_1002723 Ga0055535_10027232 237
208 3300003762 Ga0055542_1009110 Ga0055542_10091103 237
209 3300003771 Ga0055526_1035008 Ga0055526_10350082 237
210 3300003784 Ga0055534_1006347 Ga0055534_10063471 237
211 3300003790 Ga0055528_1000052 Ga0055528_100005227 237
212 3300003791 Ga0055530_10000023 Ga0055530_1000002399 237
213 3300005262 Ga0065165_1000110 Ga0065165_100011067 237
214 3300005288 Ga0065714_10064482 Ga0065714_1006448216 237
215 3300005289 Ga0065704_10094984 Ga0065704_100949843 237
216 3300005329 Ga0070683_100030439 Ga0070683_1000304392 237
217 3300005337 Ga0070682_100000339 Ga0070682_1000003392 237
218 3300005347 Ga0070668_100513956 Ga0070668_1005139562 237
219 3300005535 Ga0070684_100024134 Ga0070684_1000241347 237
220 3300005563 Ga0068855_100003439 Ga0068855_1000034392 237
221 3300009036 Ga0105244_10000001 Ga0105244_10000001266 237
222 3300009148 Ga0105243_10000601 Ga0105243_1000060113 237
223 3300009545 Ga0105237_10001779 Ga0105237_100017796 237
224 3300009553 Ga0105249_10012985 Ga0105249_100129851 237
225 3300013104 Ga0157370_10001379 Ga0157370_1000137915 237
226 3300013104 Ga0157370_10051809 Ga0157370_100518091 237
227 3300013104 Ga0157370_10232366 Ga0157370_102323661 237
228 3300013104 Ga0157370_10372858 Ga0157370_103728581 237
229 3300013307 Ga0157372_10263596 Ga0157372_102635961 237
230 3300013308 Ga0157375_10002061 Ga0157375_100020613 237
231 3300014497 Ga0182008_10000015 Ga0182008_10000015185 237
232 3300014497 Ga0182008_10000274 Ga0182008_100002744 237
233 3300014969 Ga0157376_10565099 Ga0157376_105650991 237
234 3300015261 Ga0182006_1000003 Ga0182006_1000003198 237
235 3300015261 Ga0182006_1000120 Ga0182006_100012039 237
236 3300017792 Ga0163161_10001093 Ga0163161_1000109311 237
237 3300025208 Ga0209436_100513 Ga0209436_1005133 237
238 3300025242 Ga0209258_100116 Ga0209258_100116158 237
239 3300025246 Ga0209646_1004158 Ga0209646_10041583 237
240 3300025254 Ga0209148_1000175 Ga0209148_100017589 237
241 3300025273 Ga0209673_1000153 Ga0209673_100015395 237
242 3300025284 Ga0209130_1002423 Ga0209130_10024234 237
243 3300025291 Ga0209675_1000053 Ga0209675_1000053179 237
244 3300025295 Ga0209564_1003629 Ga0209564_10036298 237
245 3300025295 Ga0209564_1027623 Ga0209564_10276232 237
246 3300025297 Ga0209758_1027778 Ga0209758_10277783 237
247 3300025298 Ga0209050_1000377 Ga0209050_100037764 237
248 3300025302 Ga0207426_1000114 Ga0207426_100011466 237
249 3300025302 Ga0207426_1000774 Ga0207426_100077412 237
250 3300025303 Ga0209051_1030989 Ga0209051_10309892 237
251 3300025304 Ga0209257_1000939 Ga0209257_100093917 237
252 3300025728 Ga0207655_1000013 Ga0207655_1000013392 237
253 3300025914 Ga0207671_10053968 Ga0207671_100539684 237
254 3300025919 Ga0207657_10307325 Ga0207657_103073252 237
255 3300025935 Ga0207709_10000489 Ga0207709_1000048918 237
256 3300025944 Ga0207661_10033657 Ga0207661_100336572 237
257 3300025949 Ga0207667_10006792 Ga0207667_1000679213 237
258 3300025972 Ga0207668_10295764 Ga0207668_102957642 237
259 3300031911 Ga0307412_10000032 Ga0307412_10000032134 237
260 3300032002 Ga0307416_100000017 Ga0307416_100000017208 237
261 3300032004 Ga0307414_10061323 Ga0307414_100613232 237
262 3300039447 Ga0436361_0630962 Ga0436361_0630962_520_1242 237
263 3300041413 Ga0439465_0000110 Ga0439465_0000110_15815_16528 237
264 3300046453 Ga0495627_007989 Ga0495627_007989_1811_2527 237
265 3300046457 Ga0495590_0039340 Ga0495590_0039340_97_813 237
266 3300046500 Ga0495596_0003280 Ga0495596_0003280_3554_4276 237
267 3300046507 Ga0495606_0001701 Ga0495606_0001701_7230_7955 237
268 3300046507 Ga0495606_0022840 Ga0495606_0022840_1577_2308 237
269 3300046512 Ga0495610_0000006 Ga0495610_0000006_672282_673004 237
270 3300046525 Ga0495663_0001776 Ga0495663_0001776_290_1015 237
271 3300046616 Ga0495668_0003962 Ga0495668_0003962_4138_4875 237
272 3300048919 Ga0496116_0000006 Ga0496116_0000006_208622_209389 237
273 3300048920 Ga0496117_0000027 Ga0496117_0000027_145791_146558 237
274 3300048921 Ga0496118_0000163 Ga0496118_0000163_85806_86573 237
275 3300048922 Ga0496119_0000006 Ga0496119_0000006_443536_444303 237
276 3300048925 Ga0496122_0000073 Ga0496122_0000073_190618_191340 237
277 3300048925 Ga0496122_0000163 Ga0496122_0000163_127569_128291 237
278 3300048925 Ga0496122_0000258 Ga0496122_0000258_92564_93331 237
279 3300048925 Ga0496122_0000782 Ga0496122_0000782_23193_23912 237
280 3300048925 Ga0496122_0001248 Ga0496122_0001248_9628_10350 237
281 3300048925 Ga0496122_0012675 Ga0496122_0012675_3004_3726 237
282 3300048926 Ga0496123_0000853 Ga0496123_0000853_17116_17883 237
283 3300048926 Ga0496123_0010355 Ga0496123_0010355_4031_4753 237
284 3300048926 Ga0496123_0010721 Ga0496123_0010721_750_1469 237
285 3300048926 Ga0496123_0014926 Ga0496123_0014926_1610_2332 237
286 3300048927 Ga0496124_0001110 Ga0496124_0001110_36206_36973 237
287 3300048928 Ga0496125_0002152 Ga0496125_0002152_1311_2033 237
288 3300048928 Ga0496125_0005212 Ga0496125_0005212_12290_13057 237
289 3300048928 Ga0496125_0038737 Ga0496125_0038737_1716_2429 237
290 3300049758 Ga0501241_000018 Ga0501241_000018_83862_84575 237
291 3300049765 Ga0501268_009137 Ga0501268_009137_26_751 237
292 3300049766 Ga0501269_000014 Ga0501269_000014_16922_17635 237
293 3300053130 Ga0500642_0108015 Ga0500642_0108015_312_1025 237
294 3300053158 Ga0500627_0039262 Ga0500627_0039262_195_908 237
295 iso_pu_bacteria 2902048731 2902050289 237
296 iso_pu_bacteria 2984606641 2984608424 237
297 3300015261 Ga0182006_1018332 Ga0182006_10183322 238
298 3300046453 Ga0495627_000002 Ga0495627_000002_743727_744449 238
299 3300046530 Ga0495654_0000006 Ga0495654_0000006_235963_236685 238
300 3300047472 Ga0495686_0005473 Ga0495686_0005473_903_1625 238
301 3300053153 Ga0500616_0139073 Ga0500616_0139073_284_1006 238
302 3300053156 Ga0500622_0001663 Ga0500622_0001663_13389_14108 238
303 3300053730 Ga0500645_021401 Ga0500645_021401_208_930 238
304 3300053730 Ga0500645_064711 Ga0500645_064711_127_849 238
305 iso_pu_bacteria 2739367874 2740058932 238
306 iso_pu_bacteria 2818991444 2819586037 238
307 iso_pu_bacteria 2929177148 2929181532 238
308 iso_pu_bacteria 2946013367 2946016665 238
309 2162886007 SwRhRL2b_contig_886264 SwRhRL2b_0032.00001760 239
310 3300005288 Ga0065714_10012935 Ga0065714_100129353 239
311 3300013102 Ga0157371_10033068 Ga0157371_100330682 239
312 3300013296 Ga0157374_10184740 Ga0157374_101847402 239
313 3300013306 Ga0163162_10001276 Ga0163162_1000127615 239
314 3300013306 Ga0163162_10018875 Ga0163162_100188758 239
315 3300013307 Ga0157372_10000017 Ga0157372_10000017178 239
316 3300015261 Ga0182006_1000209 Ga0182006_100020928 239
317 3300017792 Ga0163161_10069535 Ga0163161_100695352 239
318 3300025925 Ga0207650_10285919 Ga0207650_102859191 239
319 3300026116 Ga0207674_10247552 Ga0207674_102475522 239
320 3300031251 Ga0265327_10000024 Ga0265327_10000024235 239
321 3300031616 Ga0307508_10119826 Ga0307508_101198262 239
322 3300031838 Ga0307518_10090851 Ga0307518_100908514 239
323 3300032005 Ga0307411_10064472 Ga0307411_100644721 239
324 3300037312 Ga0395899_0000382 Ga0395899_0000382_47959_48687 239
325 3300042002 Ga0439442_002905 Ga0439442_002905_518_1261 239
326 3300042014 Ga0439457_004560 Ga0439457_004560_1371_2111 239
327 3300042156 Ga0439446_0032458 Ga0439446_0032458_239_982 239
328 3300042435 Ga0439434_0031459 Ga0439434_0031459_545_1288 239
329 3300044842 Ga0466957_0008518 Ga0466957_0008518_2577_3317 239
330 3300046522 Ga0495643_0000926 Ga0495643_0000926_9404_10129 239
331 3300046660 Ga0495625_0000825 Ga0495625_0000825_18726_19454 239
332 3300046660 Ga0495625_0048028 Ga0495625_0048028_652_1377 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

45

251

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dt0-assembly1.cif.gz_H-2 proline hydroxylase h11-n101i mutant 0.7819 5 227
4mhr-assembly1.cif.gz_A crystal structure of ectd from s. alaskensis in its apoform 0.7719 5 229
5ep9-assembly3.cif.gz_C crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7707 3 223
5ep9-assembly4.cif.gz_D crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7688 3 225
4mhu-assembly3.cif.gz_A crystal structure of ectd from s. alaskensis with bound fe 0.7608 5 229
ID Description Score Start End Superfamily
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7707 3 223 2.60.120.620
4naoA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7445 3 223 2.60.120.620
4mhuB00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7422 5 229 2.60.120.620
5epaF00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7367 4 225 2.60.120.620
2a1xA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.7269 10 222 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A086A9S1-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9971 1 236 GO:0005506
GO:0016706
AF-A0A135WKG8-F1-model_v4 Phytanoyl-CoA dioxygenase 0.997 3 236 GO:0005506
GO:0016706
AF-A0A1A7KH66-F1-model_v4 Phytanoyl-CoA dioxygenase (PhyH) 0.9943 1 237 GO:0005506
GO:0016706
AF-A0A7Y0IGF8-F1-model_v4 Ectoine hydroxylase-related dioxygenase (Phytanoyl-CoA dioxygenase family) 0.9932 1 239 GO:0005506
GO:0016706
AF-A0A0A2LVR1-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9929 1 239 GO:0005506
GO:0016706

Feature Viewer

pLDDT pTM Quality
92.94 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map