F410856

General Info

Members Datasets Scaffolds Average Seq Length
332 180 664 141

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100459100|Ga0070698_1004591002
Length 163
Sequence MSRVVYTNTPSRADQETLRESGGVRAVTSEEEGAGVNILPDGVYGYTYSPGLPNAPLFATRRFRSYEIHKVAGEVFIVGFVTAEAARDLASAPADVTIQLRPEPDAEMSVLVKIPYSRIHTHRQYAAPNQQGFTVTVRPHLGAAGPFSAGRAGSLDHSDQEPV

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
139 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
155 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.4
Stem 0
Stem Tuber 0
Unclassified 12.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100459100 3300005471 Bacteria 1210
2 Ga0065714_10149002 3300005288 Bacteria 1118
3 Ga0065704_10278482 3300005289 Bacteria 927
4 Ga0065704_10405009 3300005289 Bacteria 748
5 Ga0065712_10003674 3300005290 Bacteria 8584
6 Ga0065715_10009288 3300005293 Bacteria 7521
7 Ga0065715_10093008 3300005293 Bacteria 4841
8 Ga0065707_10005510 3300005295 Bacteria 3457
9 Ga0065707_10156870 3300005295 Bacteria 1600
10 Ga0070658_10351649 3300005327 Unclassified 1261
11 Ga0070676_10279258 3300005328 Bacteria 1125
12 Ga0070676_11046799 3300005328 Unclassified 614
13 Ga0070670_100015730 3300005331 Bacteria 6495
14 Ga0070677_10017993 3300005333 Bacteria 2540
15 Ga0068869_100190580 3300005334 Bacteria 1612
16 Ga0070666_10012376 3300005335 Bacteria 5379
17 Ga0070680_100943755 3300005336 Bacteria 744
18 Ga0070680_101024717 3300005336 Bacteria 713
19 Ga0068868_100391481 3300005338 Bacteria 1198
20 Ga0070689_100256672 3300005340 Bacteria 1444
21 Ga0070687_100025735 3300005343 Bacteria 2827
22 Ga0070661_100209981 3300005344 Bacteria 1490
23 Ga0070668_100049093 3300005347 Bacteria 3247
24 Ga0070668_100513667 3300005347 Unclassified 1039
25 Ga0070669_100002535 3300005353 Bacteria 13200
26 Ga0070669_100432650 3300005353 Bacteria 1082
27 Ga0070675_100105481 3300005354 Unclassified 2378
28 Ga0070675_100416751 3300005354 Bacteria 1200
29 Ga0070675_100581302 3300005354 Bacteria 1015
30 Ga0070675_101061776 3300005354 Bacteria 744
31 Ga0070671_100065332 3300005355 Bacteria 3030
32 Ga0070671_100542698 3300005355 Unclassified 1002
33 Ga0070674_100000057 3300005356 Bacteria 49618
34 Ga0070673_100004882 3300005364 Bacteria 8537
35 Ga0070673_100589707 3300005364 Bacteria 1013
36 Ga0070673_101776777 3300005364 Bacteria 584
37 Ga0070673_102348347 3300005364 Bacteria 507
38 Ga0070688_100023862 3300005365 Bacteria 3603
39 Ga0070701_10067539 3300005438 Unclassified 1902
40 Ga0070701_10426476 3300005438 Unclassified 846
41 Ga0070700_100028167 3300005441 Bacteria 3338
42 Ga0070700_100574779 3300005441 Bacteria 879
43 Ga0070694_100017424 3300005444 Bacteria 4541
44 Ga0070678_100318464 3300005456 Bacteria 1327
45 Ga0070662_100551213 3300005457 Bacteria 966
46 Ga0068867_100001312 3300005459 Bacteria 17219
47 Ga0068867_100165735 3300005459 Unclassified 1746
48 Ga0070685_10346585 3300005466 Bacteria 1014
49 Ga0070685_10370432 3300005466 Bacteria 984
50 Ga0070707_100772160 3300005468 Bacteria 925
51 Ga0070698_100111027 3300005471 Bacteria 2707
52 Ga0070698_100856411 3300005471 Bacteria 854
53 Ga0070698_102147429 3300005471 Unclassified 512
54 Ga0070699_100059073 3300005518 Bacteria 3323
55 Ga0070699_101187293 3300005518 Bacteria 700
56 Ga0070679_100385450 3300005530 Bacteria 1348
57 Ga0070697_100053041 3300005536 Bacteria 3296
58 Ga0070697_100339003 3300005536 Bacteria 1297
59 Ga0070672_100035528 3300005543 Bacteria 3789
60 Ga0070672_100130946 3300005543 Bacteria 2061
61 Ga0070672_100143706 3300005543 Bacteria 1970
62 Ga0070686_100120230 3300005544 Bacteria 1802
63 Ga0070695_100127737 3300005545 Bacteria 1748
64 Ga0070695_101461398 3300005545 Bacteria 568
65 Ga0070696_100026091 3300005546 Bacteria 3974
66 Ga0070696_101266242 3300005546 Bacteria 625
67 Ga0070693_100324922 3300005547 Bacteria 1045
68 Ga0070693_100401629 3300005547 Bacteria 950
69 Ga0070665_101108537 3300005548 Bacteria 803
70 Ga0070704_100002059 3300005549 Bacteria 11161
71 Ga0070704_101773589 3300005549 Bacteria 571
72 Ga0070664_100098228 3300005564 Bacteria 2543
73 Ga0070664_101364633 3300005564 Bacteria 670
74 Ga0068857_100229120 3300005577 Bacteria 1699
75 Ga0068857_101566000 3300005577 Bacteria 643
76 Ga0068859_100002275 3300005617 Bacteria 19488
77 Ga0068859_100893937 3300005617 Bacteria 973
78 Ga0068864_100028989 3300005618 Bacteria 4683
79 Ga0068866_10412930 3300005718 Unclassified 874
80 Ga0068861_100000673 3300005719 Bacteria 20337
81 Ga0068861_100139764 3300005719 Bacteria 1975
82 Ga0068861_100345693 3300005719 Bacteria 1303
83 Ga0068861_101788814 3300005719 Bacteria 609
84 Ga0068870_10003704 3300005840 Bacteria 6495
85 Ga0068870_10010893 3300005840 Bacteria 4197
86 Ga0068870_10019095 3300005840 Bacteria 3320
87 Ga0068863_100040552 3300005841 Bacteria 4427
88 Ga0068863_101792452 3300005841 Unclassified 623
89 Ga0068858_100974751 3300005842 Bacteria 830
90 Ga0068858_101151114 3300005842 Bacteria 762
91 Ga0068860_100979866 3300005843 Bacteria 863
92 Ga0068862_100001595 3300005844 Bacteria 20656
93 Ga0068862_100112552 3300005844 Bacteria 2391
94 Ga0068862_100241301 3300005844 Bacteria 1643
95 Ga0081539_10000010 3300005985 Bacteria 484386
96 Ga0075432_10040252 3300006058 Bacteria 1631
97 Ga0075432_10273313 3300006058 Bacteria 693
98 Ga0068871_100578797 3300006358 Unclassified 1019
99 Ga0075428_100043155 3300006844 Bacteria 4958
100 Ga0075428_100069438 3300006844 Bacteria 3852
101 Ga0075428_100240531 3300006844 Bacteria 1953
102 Ga0075430_100015676 3300006846 Bacteria 6456
103 Ga0075430_100055071 3300006846 Bacteria 3345
104 Ga0075430_100078286 3300006846 Bacteria 2772
105 Ga0075430_100156982 3300006846 Bacteria 1894
106 Ga0075430_100189255 3300006846 Bacteria 1711
107 Ga0075430_100825389 3300006846 Bacteria 764
108 Ga0075430_101416197 3300006846 Unclassified 571
109 Ga0075430_101803690 3300006846 Unclassified 502
110 Ga0075431_100003165 3300006847 Bacteria 15923
111 Ga0075431_101313913 3300006847 Bacteria 684
112 Ga0075431_101673976 3300006847 Unclassified 593
113 Ga0075433_10002132 3300006852 Bacteria 14979
114 Ga0075433_10023509 3300006852 Bacteria 5189
115 Ga0075433_10750789 3300006852 Bacteria 853
116 Ga0075434_100002016 3300006871 Bacteria 17648
117 Ga0075434_100005936 3300006871 Bacteria 11177
118 Ga0075434_100542853 3300006871 Bacteria 1182
119 Ga0075429_100005611 3300006880 Bacteria 10810
120 Ga0075429_101392020 3300006880 Bacteria 611
121 Ga0068865_100139894 3300006881 Bacteria 1824
122 Ga0097620_100002275 3300006931 Bacteria 19488
123 Ga0097620_100893949 3300006931 Bacteria 973
124 Ga0075435_101611797 3300007076 Unclassified 569
125 Ga0075435_101843906 3300007076 Unclassified 531
126 Ga0111539_10003891 3300009094 Bacteria 19641
127 Ga0111539_10044591 3300009094 Bacteria 5312
128 Ga0111539_10071307 3300009094 Bacteria 4100
129 Ga0111539_10220963 3300009094 Bacteria 2206
130 Ga0105245_11451586 3300009098 Bacteria 736
131 Ga0114129_10008625 3300009147 Bacteria 14536
132 Ga0114129_10053101 3300009147 Bacteria 5684
133 Ga0114129_10206876 3300009147 Bacteria 2655
134 Ga0114129_10209145 3300009147 Bacteria 2638
135 Ga0114129_10269232 3300009147 Bacteria 2280
136 Ga0114129_10720736 3300009147 Bacteria 1280
137 Ga0105243_11421720 3300009148 Unclassified 715
138 Ga0105249_10054657 3300009553 Bacteria 3652
139 Ga0105249_12213835 3300009553 Bacteria 622
140 Ga0157338_1041506 3300012515 Bacteria 628
141 Ga0157371_11024337 3300013102 Unclassified 631
142 Ga0163162_10124329 3300013306 Bacteria 2685
143 Ga0157375_10001192 3300013308 Bacteria 22410
144 Ga0157375_10936454 3300013308 Bacteria 1009
145 Ga0163163_10034138 3300014325 Bacteria 4925
146 Ga0157380_10015394 3300014326 Bacteria 5621
147 Ga0157380_10141143 3300014326 Bacteria 2070
148 Ga0157380_10348147 3300014326 Bacteria 1385
149 Ga0157380_10370204 3300014326 Bacteria 1348
150 Ga0157380_11126949 3300014326 Bacteria 825
151 Ga0157377_10093316 3300014745 Bacteria 1781
152 Ga0157376_10825054 3300014969 Bacteria 941
153 Ga0207697_10081629 3300025315 Bacteria 1362
154 Ga0207697_10087895 3300025315 Bacteria 1315
155 Ga0207682_10021242 3300025893 Bacteria 2553
156 Ga0207682_10352066 3300025893 Bacteria 694
157 Ga0207642_10377645 3300025899 Unclassified 843
158 Ga0207688_10295594 3300025901 Bacteria 989
159 Ga0207647_10153060 3300025904 Bacteria 1347
160 Ga0207645_10101169 3300025907 Bacteria 1859
161 Ga0207645_10508199 3300025907 Bacteria 816
162 Ga0207643_10005804 3300025908 Bacteria 6598
163 Ga0207643_10032554 3300025908 Bacteria 2913
164 Ga0207643_10042000 3300025908 Bacteria 2577
165 Ga0207705_10286895 3300025909 Unclassified 1261
166 Ga0207660_11202921 3300025917 Unclassified 617
167 Ga0207652_10603852 3300025921 Bacteria 984
168 Ga0207646_10068955 3300025922 Bacteria 3158
169 Ga0207646_10672788 3300025922 Bacteria 927
170 Ga0207681_10005522 3300025923 Bacteria 7767
171 Ga0207681_10055207 3300025923 Bacteria 2704
172 Ga0207650_10127722 3300025925 Bacteria 1986
173 Ga0207659_10088474 3300025926 Bacteria 2307
174 Ga0207659_10091215 3300025926 Bacteria 2276
175 Ga0207644_10074514 3300025931 Bacteria 2491
176 Ga0207644_10497807 3300025931 Unclassified 1005
177 Ga0207706_10157957 3300025933 Bacteria 1994
178 Ga0207706_10318926 3300025933 Bacteria 1353
179 Ga0207706_11557330 3300025933 Bacteria 537
180 Ga0207709_11257104 3300025935 Unclassified 611
181 Ga0207670_10406269 3300025936 Bacteria 1090
182 Ga0207669_10001027 3300025937 Bacteria 11920
183 Ga0207704_10083820 3300025938 Bacteria 2070
184 Ga0207704_10585539 3300025938 Bacteria 911
185 Ga0207691_10023138 3300025940 Bacteria 5850
186 Ga0207691_10078270 3300025940 Bacteria 2977
187 Ga0207691_10290217 3300025940 Bacteria 1407
188 Ga0207689_10199649 3300025942 Bacteria 1651
189 Ga0207689_10208417 3300025942 Bacteria 1614
190 Ga0207679_10052910 3300025945 Bacteria 2980
191 Ga0207679_10400083 3300025945 Bacteria 1208
192 Ga0207651_10090571 3300025960 Bacteria 2236
193 Ga0207651_10128408 3300025960 Bacteria 1936
194 Ga0207651_10820775 3300025960 Bacteria 825
195 Ga0207712_10033740 3300025961 Bacteria 3462
196 Ga0207668_10049356 3300025972 Bacteria 2893
197 Ga0207677_11009076 3300026023 Bacteria 755
198 Ga0207708_10016535 3300026075 Bacteria 5549
199 Ga0207708_10022633 3300026075 Bacteria 4746
200 Ga0207708_10361230 3300026075 Bacteria 1193
201 Ga0207708_11112207 3300026075 Unclassified 689
202 Ga0207641_10199472 3300026088 Bacteria 1844
203 Ga0207641_11439119 3300026088 Bacteria 690
204 Ga0207648_10000409 3300026089 Bacteria 47845
205 Ga0207648_10080237 3300026089 Bacteria 2846
206 Ga0207648_10225881 3300026089 Unclassified 1665
207 Ga0207676_10167458 3300026095 Bacteria 1911
208 Ga0207676_10579486 3300026095 Bacteria 1075
209 Ga0207674_10050819 3300026116 Bacteria 4234
210 Ga0207674_10180760 3300026116 Bacteria 2061
211 Ga0207674_11492498 3300026116 Bacteria 645
212 Ga0207675_100001233 3300026118 Bacteria 25530
213 Ga0207675_100098269 3300026118 Bacteria 2757
214 Ga0207675_100416225 3300026118 Bacteria 1327
215 Ga0207675_101317016 3300026118 Bacteria 743
216 Ga0207675_101408760 3300026118 Bacteria 718
217 Ga0207428_10000885 3300027907 Bacteria 33608
218 Ga0207428_10040800 3300027907 Bacteria 3760
219 Ga0207428_10079761 3300027907 Bacteria 2559
220 Ga0207428_10905912 3300027907 Bacteria 623
221 Ga0268265_10000725 3300028380 Bacteria 32189
222 Ga0268265_10335618 3300028380 Bacteria 1374
223 Ga0268265_10374047 3300028380 Bacteria 1308
224 Ga0268265_11169748 3300028380 Unclassified 766
225 Ga0268264_10545801 3300028381 Bacteria 1136
226 Ga0307405_11925010 3300031731 Bacteria 528
227 Ga0307412_10039573 3300031911 Bacteria 3045
228 Ga0307409_100490615 3300031995 Bacteria 1194
229 Ga0307416_100315274 3300032002 Bacteria 1563
230 Ga0307416_100797947 3300032002 Bacteria 1040
231 Ga0307416_101253924 3300032002 Bacteria 847
232 Ga0307416_101572983 3300032002 Bacteria 763
233 Ga0307416_101741967 3300032002 Unclassified 727
234 Ga0307411_11211968 3300032005 Bacteria 685
235 Ga0373948_0032752 3300034817 Bacteria 1055
236 Ga0373958_0020677 3300034819 Bacteria 1215
237 Ga0373951_0035085 3300035091 Bacteria 1193
238 Ga0373939_0024714 3300035114 Bacteria 1676
239 Ga0373931_0038652 3300035691 Bacteria 2498
240 Ga0373931_1302938 3300035691 Unclassified 500
241 Ga0439462_0118061 3300042015 Unclassified 737
242 Ga0439464_0217510 3300042439 Bacteria 612
243 Ga0453683_0190388 3300044673 Bacteria 1302
244 Ga0453684_1435016 3300044712 Unclassified 714
245 Ga0451576_0295569 3300045051 Bacteria 1693
246 Ga0451576_0411635 3300045051 Bacteria 1418
247 Ga0451576_0685672 3300045051 Bacteria 1076
248 Ga0495663_0150501 3300046525 Bacteria 794
249 Ga0495621_0090918 3300046539 Bacteria 1150
250 Ga0495621_0186810 3300046539 Bacteria 829
251 Ga0495656_0048528 3300046615 Bacteria 1805
252 Ga0495659_0204061 3300046664 Bacteria 812
253 Ga0495670_0175515 3300046691 Bacteria 1130
254 Ga0495677_0027264 3300047445 Bacteria 2073
255 Ga0496110_0687058 3300048913 Bacteria 924
256 Ga0501305_121898 3300049161 Unclassified 501
257 Ga0501297_053981 3300049520 Unclassified 598
258 Ga0501300_008552 3300049523 Bacteria 1501
259 Ga0501036_0085309 3300049572 Bacteria 2669
260 Ga0501037_0079825 3300049573 Bacteria 2375
261 Ga0501038_0148010 3300049574 Bacteria 1916
262 Ga0501038_0257199 3300049574 Bacteria 1381
263 Ga0501039_0084346 3300049575 Bacteria 2474
264 Ga0501040_0012211 3300049576 Bacteria 5625
265 Ga0501040_0020610 3300049576 Bacteria 4395
266 Ga0501041_0140425 3300049577 Bacteria 1506
267 Ga0501041_0199736 3300049577 Bacteria 1253
268 Ga0501042_0005378 3300049578 Bacteria 8241
269 Ga0501046_0109458 3300049580 Bacteria 2112
270 Ga0501048_0018387 3300049582 Bacteria 5141
271 Ga0501048_1277368 3300049582 Unclassified 528
272 Ga0501072_0002809 3300049588 Bacteria 13066
273 Ga0501072_0219614 3300049588 Bacteria 1515
274 Ga0501072_0262791 3300049588 Bacteria 1374
275 Ga0501073_0199495 3300049589 Bacteria 1384
276 Ga0501073_0696357 3300049589 Bacteria 701
277 Ga0501074_0254335 3300049590 Bacteria 1249
278 Ga0501075_0172772 3300049591 Bacteria 1649
279 Ga0501075_0187766 3300049591 Bacteria 1576
280 Ga0501075_0507757 3300049591 Bacteria 920
281 Ga0501075_0680944 3300049591 Unclassified 784
282 Ga0501076_0054272 3300049592 Bacteria 3176
283 Ga0501202_093239 3300049652 Unclassified 723
284 Ga0501217_332335 3300049661 Unclassified 508
285 Ga0501249_025723 3300049679 Bacteria 1299
286 Ga0501251_084628 3300049681 Unclassified 561
287 Ga0501225_0024752 3300049705 Bacteria 1652
288 Ga0501245_011191 3300049708 Archaea 1302
289 Ga0501079_0006944 3300049741 Bacteria 8534
290 Ga0501081_0018285 3300049743 Bacteria 4652
291 Ga0501081_0117470 3300049743 Bacteria 1892
292 Ga0501271_048939 3300049768 Bacteria 569
293 Ga0501283_002557 3300049779 Bacteria 2367
294 Ga0501045_0005647 3300049824 Bacteria 8655
295 nmdc:mga03n38_569168_c1 3300050490 Bacteria 642
296 nmdc:mga05p37_136269_c1 3300050507 Bacteria 3010
297 nmdc:mga05p37_198703_c1 3300050507 Bacteria 2430
298 nmdc:mga05p37_2264833_c1 3300050507 Bacteria 502
299 nmdc:mga05p37_5795_c2 3300050507 Bacteria 8848
300 nmdc:mga05p37_691074_c1 3300050507 Bacteria 1135
301 nmdc:mga09592_121831_c1 3300050508 Bacteria 2240
302 nmdc:mga09592_1494111_c1 3300050508 Unclassified 550
303 nmdc:mga0qj67_1205101_c1 3300050509 Unclassified 589
304 nmdc:mga0qj67_161132_c1 3300050509 Bacteria 1821
305 nmdc:mga0qj67_56827_c1 3300050509 Bacteria 3103
306 nmdc:mga06r32_1585696_c1 3300050510 Unclassified 593
307 nmdc:mga06r32_24059_c1 3300050510 Bacteria 5647
308 nmdc:mga06r32_59168_c1 3300050510 Bacteria 3684
309 nmdc:mga08y16_1180_c1 3300050511 Bacteria 25807
310 nmdc:mga08y16_233106_c1 3300050511 Bacteria 1904
311 nmdc:mga08y16_3795_c1 3300050511 Bacteria 15733
312 nmdc:mga08y16_39885_c1 3300050511 Bacteria 4925
313 nmdc:mga08y16_797097_c1 3300050511 Bacteria 938
314 nmdc:mga0n895_15850_c1 3300050512 Bacteria 6892
315 nmdc:mga0n895_1855017_c1 3300050512 Unclassified 563
316 nmdc:mga0n895_6806_c1 3300050512 Bacteria 9761
317 nmdc:mga0rr50_314869_c1 3300050513 Bacteria 1311
318 nmdc:mga0a205_1054573_c1 3300050515 Bacteria 660
319 nmdc:mga0a205_106165_c1 3300050515 Bacteria 2707
320 nmdc:mga0a205_1245_c1 3300050515 Bacteria 21353
321 nmdc:mga0a205_161643_c1 3300050515 Bacteria 2136
322 nmdc:mga0a205_7305_c1 3300050515 Bacteria 9995
323 Ga0501084_0085441 3300054114 Bacteria 2649
324 Ga0501084_0170470 3300054114 Bacteria 1837
325 Ga0501084_0205340 3300054114 Bacteria 1663
326 Ga0590071_000137 3300059421 Bacteria 20647
327 Ga0590074_000156 3300059423 Bacteria 8246
328 Ga0590075_000802 3300059424 Bacteria 8289
329 Ga0590077_003240 3300059426 Bacteria 3387
330 Ga0501082_0116057 3300060353 Bacteria 2319
331 Ga0530510_0003724 3300061734 Bacteria 10495
332 Ga0530510_0100782 3300061734 Bacteria 2112
333 Ga0070698_100459100
334 Ga0065714_10149002
335 Ga0065704_10278482
336 Ga0065704_10405009
337 Ga0065712_10003674
338 Ga0065715_10009288
339 Ga0065715_10093008
340 Ga0065707_10005510
341 Ga0065707_10156870
342 Ga0070658_10351649
343 Ga0070676_10279258
344 Ga0070676_11046799
345 Ga0070670_100015730
346 Ga0070677_10017993
347 Ga0068869_100190580
348 Ga0070666_10012376
349 Ga0070680_100943755
350 Ga0070680_101024717
351 Ga0068868_100391481
352 Ga0070689_100256672
353 Ga0070687_100025735
354 Ga0070661_100209981
355 Ga0070668_100049093
356 Ga0070668_100513667
357 Ga0070669_100002535
358 Ga0070669_100432650
359 Ga0070675_100105481
360 Ga0070675_100416751
361 Ga0070675_100581302
362 Ga0070675_101061776
363 Ga0070671_100065332
364 Ga0070671_100542698
365 Ga0070674_100000057
366 Ga0070673_100004882
367 Ga0070673_100589707
368 Ga0070673_101776777
369 Ga0070673_102348347
370 Ga0070688_100023862
371 Ga0070701_10067539
372 Ga0070701_10426476
373 Ga0070700_100028167
374 Ga0070700_100574779
375 Ga0070694_100017424
376 Ga0070678_100318464
377 Ga0070662_100551213
378 Ga0068867_100001312
379 Ga0068867_100165735
380 Ga0070685_10346585
381 Ga0070685_10370432
382 Ga0070707_100772160
383 Ga0070698_100111027
384 Ga0070698_100856411
385 Ga0070698_102147429
386 Ga0070699_100059073
387 Ga0070699_101187293
388 Ga0070679_100385450
389 Ga0070697_100053041
390 Ga0070697_100339003
391 Ga0070672_100035528
392 Ga0070672_100130946
393 Ga0070672_100143706
394 Ga0070686_100120230
395 Ga0070695_100127737
396 Ga0070695_101461398
397 Ga0070696_100026091
398 Ga0070696_101266242
399 Ga0070693_100324922
400 Ga0070693_100401629
401 Ga0070665_101108537
402 Ga0070704_100002059
403 Ga0070704_101773589
404 Ga0070664_100098228
405 Ga0070664_101364633
406 Ga0068857_100229120
407 Ga0068857_101566000
408 Ga0068859_100002275
409 Ga0068859_100893937
410 Ga0068864_100028989
411 Ga0068866_10412930
412 Ga0068861_100000673
413 Ga0068861_100139764
414 Ga0068861_100345693
415 Ga0068861_101788814
416 Ga0068870_10003704
417 Ga0068870_10010893
418 Ga0068870_10019095
419 Ga0068863_100040552
420 Ga0068863_101792452
421 Ga0068858_100974751
422 Ga0068858_101151114
423 Ga0068860_100979866
424 Ga0068862_100001595
425 Ga0068862_100112552
426 Ga0068862_100241301
427 Ga0081539_10000010
428 Ga0075432_10040252
429 Ga0075432_10273313
430 Ga0068871_100578797
431 Ga0075428_100043155
432 Ga0075428_100069438
433 Ga0075428_100240531
434 Ga0075430_100015676
435 Ga0075430_100055071
436 Ga0075430_100078286
437 Ga0075430_100156982
438 Ga0075430_100189255
439 Ga0075430_100825389
440 Ga0075430_101416197
441 Ga0075430_101803690
442 Ga0075431_100003165
443 Ga0075431_101313913
444 Ga0075431_101673976
445 Ga0075433_10002132
446 Ga0075433_10023509
447 Ga0075433_10750789
448 Ga0075434_100002016
449 Ga0075434_100005936
450 Ga0075434_100542853
451 Ga0075429_100005611
452 Ga0075429_101392020
453 Ga0068865_100139894
454 Ga0097620_100002275
455 Ga0097620_100893949
456 Ga0075435_101611797
457 Ga0075435_101843906
458 Ga0111539_10003891
459 Ga0111539_10044591
460 Ga0111539_10071307
461 Ga0111539_10220963
462 Ga0105245_11451586
463 Ga0114129_10008625
464 Ga0114129_10053101
465 Ga0114129_10206876
466 Ga0114129_10209145
467 Ga0114129_10269232
468 Ga0114129_10720736
469 Ga0105243_11421720
470 Ga0105249_10054657
471 Ga0105249_12213835
472 Ga0157338_1041506
473 Ga0157371_11024337
474 Ga0163162_10124329
475 Ga0157375_10001192
476 Ga0157375_10936454
477 Ga0163163_10034138
478 Ga0157380_10015394
479 Ga0157380_10141143
480 Ga0157380_10348147
481 Ga0157380_10370204
482 Ga0157380_11126949
483 Ga0157377_10093316
484 Ga0157376_10825054
485 Ga0207697_10081629
486 Ga0207697_10087895
487 Ga0207682_10021242
488 Ga0207682_10352066
489 Ga0207642_10377645
490 Ga0207688_10295594
491 Ga0207647_10153060
492 Ga0207645_10101169
493 Ga0207645_10508199
494 Ga0207643_10005804
495 Ga0207643_10032554
496 Ga0207643_10042000
497 Ga0207705_10286895
498 Ga0207660_11202921
499 Ga0207652_10603852
500 Ga0207646_10068955
501 Ga0207646_10672788
502 Ga0207681_10005522
503 Ga0207681_10055207
504 Ga0207650_10127722
505 Ga0207659_10088474
506 Ga0207659_10091215
507 Ga0207644_10074514
508 Ga0207644_10497807
509 Ga0207706_10157957
510 Ga0207706_10318926
511 Ga0207706_11557330
512 Ga0207709_11257104
513 Ga0207670_10406269
514 Ga0207669_10001027
515 Ga0207704_10083820
516 Ga0207704_10585539
517 Ga0207691_10023138
518 Ga0207691_10078270
519 Ga0207691_10290217
520 Ga0207689_10199649
521 Ga0207689_10208417
522 Ga0207679_10052910
523 Ga0207679_10400083
524 Ga0207651_10090571
525 Ga0207651_10128408
526 Ga0207651_10820775
527 Ga0207712_10033740
528 Ga0207668_10049356
529 Ga0207677_11009076
530 Ga0207708_10016535
531 Ga0207708_10022633
532 Ga0207708_10361230
533 Ga0207708_11112207
534 Ga0207641_10199472
535 Ga0207641_11439119
536 Ga0207648_10000409
537 Ga0207648_10080237
538 Ga0207648_10225881
539 Ga0207676_10167458
540 Ga0207676_10579486
541 Ga0207674_10050819
542 Ga0207674_10180760
543 Ga0207674_11492498
544 Ga0207675_100001233
545 Ga0207675_100098269
546 Ga0207675_100416225
547 Ga0207675_101317016
548 Ga0207675_101408760
549 Ga0207428_10000885
550 Ga0207428_10040800
551 Ga0207428_10079761
552 Ga0207428_10905912
553 Ga0268265_10000725
554 Ga0268265_10335618
555 Ga0268265_10374047
556 Ga0268265_11169748
557 Ga0268264_10545801
558 Ga0307405_11925010
559 Ga0307412_10039573
560 Ga0307409_100490615
561 Ga0307416_100315274
562 Ga0307416_100797947
563 Ga0307416_101253924
564 Ga0307416_101572983
565 Ga0307416_101741967
566 Ga0307411_11211968
567 Ga0373948_0032752
568 Ga0373958_0020677
569 Ga0373951_0035085
570 Ga0373939_0024714
571 Ga0373931_0038652
572 Ga0373931_1302938
573 Ga0439462_0118061
574 Ga0439464_0217510
575 Ga0453683_0190388
576 Ga0453684_1435016
577 Ga0451576_0295569
578 Ga0451576_0411635
579 Ga0451576_0685672
580 Ga0495663_0150501
581 Ga0495621_0090918
582 Ga0495621_0186810
583 Ga0495656_0048528
584 Ga0495659_0204061
585 Ga0495670_0175515
586 Ga0495677_0027264
587 Ga0496110_0687058
588 Ga0501305_121898
589 Ga0501297_053981
590 Ga0501300_008552
591 Ga0501036_0085309
592 Ga0501037_0079825
593 Ga0501038_0148010
594 Ga0501038_0257199
595 Ga0501039_0084346
596 Ga0501040_0012211
597 Ga0501040_0020610
598 Ga0501041_0140425
599 Ga0501041_0199736
600 Ga0501042_0005378
601 Ga0501046_0109458
602 Ga0501048_0018387
603 Ga0501048_1277368
604 Ga0501072_0002809
605 Ga0501072_0219614
606 Ga0501072_0262791
607 Ga0501073_0199495
608 Ga0501073_0696357
609 Ga0501074_0254335
610 Ga0501075_0172772
611 Ga0501075_0187766
612 Ga0501075_0507757
613 Ga0501075_0680944
614 Ga0501076_0054272
615 Ga0501202_093239
616 Ga0501217_332335
617 Ga0501249_025723
618 Ga0501251_084628
619 Ga0501225_0024752
620 Ga0501245_011191
621 Ga0501079_0006944
622 Ga0501081_0018285
623 Ga0501081_0117470
624 Ga0501271_048939
625 Ga0501283_002557
626 Ga0501045_0005647
627 nmdc:mga03n38_569168_c1
628 nmdc:mga05p37_136269_c1
629 nmdc:mga05p37_198703_c1
630 nmdc:mga05p37_2264833_c1
631 nmdc:mga05p37_5795_c2
632 nmdc:mga05p37_691074_c1
633 nmdc:mga09592_121831_c1
634 nmdc:mga09592_1494111_c1
635 nmdc:mga0qj67_1205101_c1
636 nmdc:mga0qj67_161132_c1
637 nmdc:mga0qj67_56827_c1
638 nmdc:mga06r32_1585696_c1
639 nmdc:mga06r32_24059_c1
640 nmdc:mga06r32_59168_c1
641 nmdc:mga08y16_1180_c1
642 nmdc:mga08y16_233106_c1
643 nmdc:mga08y16_3795_c1
644 nmdc:mga08y16_39885_c1
645 nmdc:mga08y16_797097_c1
646 nmdc:mga0n895_15850_c1
647 nmdc:mga0n895_1855017_c1
648 nmdc:mga0n895_6806_c1
649 nmdc:mga0rr50_314869_c1
650 nmdc:mga0a205_1054573_c1
651 nmdc:mga0a205_106165_c1
652 nmdc:mga0a205_1245_c1
653 nmdc:mga0a205_161643_c1
654 nmdc:mga0a205_7305_c1
655 Ga0501084_0085441
656 Ga0501084_0170470
657 Ga0501084_0205340
658 Ga0590071_000137
659 Ga0590074_000156
660 Ga0590075_000802
661 Ga0590077_003240
662 Ga0501082_0116057
663 Ga0530510_0003724
664 Ga0530510_0100782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kko-assembly1.cif.gz_B the crystal structure of siab-siac complex from pseudomonas aeruginosa 0.5119 65 94
5uxb-assembly2.cif.gz_B crystal structure of macrolide 2'-phosphotransferase mphh from brachybacterium faecium, apoenzyme 0.4401 64 134
5dzt-assembly1.cif.gz_A crystal structure of class ii lanthipeptide synthetase cylm in complex with amp 0.4244 62 114
8agy-assembly1.cif.gz_A the corramycin phosphotransferase in complex with corramycin 0.3834 58 114
4otp-assembly1.cif.gz_A crystal structure of the catalytic domain of the human riok1 atypical protein kinase in complex with adp/mg2+ 0.3812 58 109
ID Description Score Start End Superfamily
af_K7M2R2_462_572_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5926 62 79 3.30.200.20
af_Q9C9E4_320_432_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5139 65 114 3.30.200.20
af_Q54RZ1_342_468_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4812 64 116 1.10.510.10
af_Q9ZVR7_695_809_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4652 58 114 3.30.200.20
af_C0LGF5_734_853_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4603 64 116 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3M1W7Q0-F1-model_v4 Uncharacterized protein 0.9583 11 141 GO:0016020
AF-A0A7C2RQK3-F1-model_v4 Uncharacterized protein 0.956 14 139
AF-A0A7C2MXD3-F1-model_v4 DUF3592 domain-containing protein 0.9545 11 141 GO:0016020
AF-A0A7C2TM39-F1-model_v4 Uncharacterized protein 0.9503 11 140
AF-A0A7Y4TN40-F1-model_v4 Uncharacterized protein 0.9473 1 141

Map