F410840

General Info

Members Datasets Scaffolds Average Seq Length
332 160 664 205

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100046606|Ga0070708_1000466062
Length 230
Sequence VGVHRCAIDDQVSAQTRPALSIVLAILASYLLGATPTSYIAGRVGRGIDLREHGSKNLGATNVYRILGWKYAIPVALVDIAKGAIPVLFFAKWAGAAEHPWLPVVLGGAAVLGHMFSPYVGFKGGKGVATAAGMFLALAPVAVLLAIVAWGLCLWLTGYVSLSSIVAVLTVPVWVSLLQPGSPYTFWASVALVALIVFAHRRNIRRLVDGTENRFRTRPSGRPTVRPSDQ

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
102 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
143 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
144 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
145 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
146 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
149 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
150 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
151 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.43
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100046606 3300005445 Bacteria 3825
2 rootL2_10082818 3300003322 Bacteria 2321
3 Ga0070690_100092514 3300005330 Bacteria 1994
4 Ga0070680_100048993 3300005336 Bacteria 3443
5 Ga0070691_10073250 3300005341 Bacteria 1665
6 Ga0070687_100032289 3300005343 Bacteria 2575
7 Ga0070692_10166414 3300005345 Bacteria 1267
8 Ga0070668_100010255 3300005347 Bacteria 6953
9 Ga0070671_100001564 3300005355 Bacteria 17217
10 Ga0070674_100326422 3300005356 Bacteria 1232
11 Ga0070673_100136202 3300005364 Bacteria 2067
12 Ga0070673_100315756 3300005364 Bacteria 1379
13 Ga0070703_10002195 3300005406 Bacteria 5681
14 Ga0070703_10161046 3300005406 Bacteria 851
15 Ga0070709_10008413 3300005434 Bacteria 5668
16 Ga0070709_10039567 3300005434 Bacteria 2894
17 Ga0070713_100067384 3300005436 Bacteria 3014
18 Ga0070710_10202614 3300005437 Unclassified 1254
19 Ga0070710_10303193 3300005437 Bacteria 1043
20 Ga0070701_10012891 3300005438 Bacteria 3786
21 Ga0070711_100000239 3300005439 Bacteria 28182
22 Ga0070711_100510449 3300005439 Unclassified 992
23 Ga0070711_100571318 3300005439 Bacteria 940
24 Ga0070705_100741666 3300005440 Bacteria 775
25 Ga0070700_100132884 3300005441 Bacteria 1681
26 Ga0070694_100012674 3300005444 Bacteria 5248
27 Ga0070694_100017626 3300005444 Bacteria 4515
28 Ga0070694_100066236 3300005444 Bacteria 2477
29 Ga0070694_100081335 3300005444 Bacteria 2253
30 Ga0070694_100252142 3300005444 Bacteria 1335
31 Ga0070694_100259109 3300005444 Bacteria 1318
32 Ga0070708_100016285 3300005445 Bacteria 6164
33 Ga0070708_100066036 3300005445 Bacteria 3246
34 Ga0070708_100076091 3300005445 Bacteria 3030
35 Ga0070708_100104792 3300005445 Bacteria 2594
36 Ga0070708_100118414 3300005445 Bacteria 2440
37 Ga0070708_100704177 3300005445 Unclassified 950
38 Ga0070663_100553924 3300005455 Unclassified 961
39 Ga0070706_100253334 3300005467 Bacteria 1643
40 Ga0070706_100258541 3300005467 Bacteria 1625
41 Ga0070706_100311031 3300005467 Bacteria 1470
42 Ga0070706_100920394 3300005467 Unclassified 807
43 Ga0070707_100018022 3300005468 Bacteria 6642
44 Ga0070707_100020148 3300005468 Bacteria 6289
45 Ga0070707_100023968 3300005468 Bacteria 5774
46 Ga0070707_100051348 3300005468 Bacteria 3954
47 Ga0070707_100109021 3300005468 Bacteria 2685
48 Ga0070707_100117123 3300005468 Bacteria 2586
49 Ga0070698_100000037 3300005471 Bacteria 92307
50 Ga0070698_100058135 3300005471 Bacteria 3910
51 Ga0070698_100174600 3300005471 Bacteria 2089
52 Ga0070698_100206048 3300005471 Bacteria 1902
53 Ga0070698_100775796 3300005471 Bacteria 902
54 Ga0070699_100000719 3300005518 Bacteria 30756
55 Ga0070699_100001113 3300005518 Bacteria 25024
56 Ga0070699_100019554 3300005518 Bacteria 5834
57 Ga0070699_100022813 3300005518 Bacteria 5394
58 Ga0070699_100052119 3300005518 Bacteria 3542
59 Ga0070699_100188809 3300005518 Bacteria 1830
60 Ga0070699_100261812 3300005518 Unclassified 1547
61 Ga0070699_100350655 3300005518 Bacteria 1329
62 Ga0070699_100461049 3300005518 Bacteria 1152
63 Ga0070697_100013672 3300005536 Bacteria 6369
64 Ga0070697_100015734 3300005536 Bacteria 5940
65 Ga0070697_100017320 3300005536 Bacteria 5668
66 Ga0070697_100076643 3300005536 Bacteria 2750
67 Ga0070697_100091275 3300005536 Bacteria 2518
68 Ga0070697_100095091 3300005536 Bacteria 2470
69 Ga0070697_100110098 3300005536 Bacteria 2294
70 Ga0070697_100132822 3300005536 Bacteria 2088
71 Ga0070697_100151362 3300005536 Bacteria 1955
72 Ga0070697_100426619 3300005536 Bacteria 1153
73 Ga0070672_100054720 3300005543 Bacteria 3125
74 Ga0070695_100002535 3300005545 Bacteria 10547
75 Ga0070695_100041833 3300005545 Bacteria 2906
76 Ga0070695_100092058 3300005545 Bacteria 2026
77 Ga0070695_100095855 3300005545 Bacteria 1989
78 Ga0070696_100771113 3300005546 Bacteria 789
79 Ga0070696_100794505 3300005546 Unclassified 778
80 Ga0070704_100002333 3300005549 Bacteria 10638
81 Ga0070704_100005461 3300005549 Bacteria 7405
82 Ga0070704_100019448 3300005549 Bacteria 4363
83 Ga0070704_100071573 3300005549 Bacteria 2520
84 Ga0070704_100102069 3300005549 Bacteria 2163
85 Ga0070702_100008046 3300005615 Bacteria 5088
86 Ga0068859_100120840 3300005617 Bacteria 2686
87 Ga0068864_100049199 3300005618 Bacteria 3627
88 Ga0068861_100475579 3300005719 Bacteria 1125
89 Ga0068860_100568185 3300005843 Bacteria 1137
90 Ga0068862_100195860 3300005844 Bacteria 1820
91 Ga0068862_101152128 3300005844 Bacteria 772
92 Ga0070715_10267154 3300006163 Bacteria 901
93 Ga0070716_100004394 3300006173 Bacteria 6738
94 Ga0070716_100077448 3300006173 Bacteria 1974
95 Ga0075428_100147884 3300006844 Bacteria 2553
96 Ga0075428_100312722 3300006844 Bacteria 1688
97 Ga0075428_100387022 3300006844 Bacteria 1499
98 Ga0075430_100924017 3300006846 Bacteria 719
99 Ga0075431_100019714 3300006847 Bacteria 6883
100 Ga0075431_100044571 3300006847 Bacteria 4575
101 Ga0075431_100224789 3300006847 Bacteria 1914
102 Ga0075431_100549714 3300006847 Bacteria 1142
103 Ga0075433_10021691 3300006852 Bacteria 5387
104 Ga0075433_10045489 3300006852 Bacteria 3816
105 Ga0075433_10137645 3300006852 Bacteria 2170
106 Ga0075433_10962555 3300006852 Bacteria 744
107 Ga0075434_100002527 3300006871 Bacteria 16141
108 Ga0075434_100003715 3300006871 Bacteria 13630
109 Ga0075434_100018158 3300006871 Bacteria 6789
110 Ga0075434_100096401 3300006871 Bacteria 2963
111 Ga0075434_100327124 3300006871 Bacteria 1553
112 Ga0075434_100391574 3300006871 Bacteria 1410
113 Ga0075429_100001523 3300006880 Bacteria 19059
114 Ga0075436_100031092 3300006914 Bacteria 3675
115 Ga0075436_100031336 3300006914 Bacteria 3661
116 Ga0075436_100037007 3300006914 Bacteria 3369
117 Ga0075436_100208887 3300006914 Bacteria 1384
118 Ga0075436_100714211 3300006914 Unclassified 743
119 Ga0097620_100120840 3300006931 Bacteria 2686
120 Ga0075435_100135540 3300007076 Bacteria 2062
121 Ga0075435_100172448 3300007076 Bacteria 1825
122 Ga0099794_10061516 3300007265 Bacteria 1825
123 Ga0099794_10098797 3300007265 Bacteria 1455
124 Ga0114129_10057578 3300009147 Bacteria 5438
125 Ga0114129_10125723 3300009147 Bacteria 3525
126 Ga0114129_10535754 3300009147 Bacteria 1525
127 Ga0105248_10045262 3300009177 Bacteria 4935
128 Ga0105248_10337895 3300009177 Bacteria 1696
129 Ga0105248_10553019 3300009177 Bacteria 1298
130 Ga0105238_10367590 3300009551 Bacteria 1428
131 Ga0105249_10895789 3300009553 Unclassified 954
132 Ga0157378_10501431 3300013297 Bacteria 1213
133 Ga0157375_10175777 3300013308 Bacteria 2290
134 Ga0157375_10343437 3300013308 Bacteria 1658
135 Ga0163163_10296672 3300014325 Bacteria 1669
136 Ga0157379_10047330 3300014968 Bacteria 3837
137 Ga0157376_10923988 3300014969 Bacteria 892
138 Ga0207653_10015519 3300025885 Bacteria 2390
139 Ga0207653_10053330 3300025885 Bacteria 1351
140 Ga0207692_10091597 3300025898 Bacteria 1650
141 Ga0207699_10066020 3300025906 Bacteria 2195
142 Ga0207684_10000781 3300025910 Bacteria 36974
143 Ga0207684_10018361 3300025910 Bacteria 5987
144 Ga0207663_10000256 3300025916 Bacteria 23155
145 Ga0207662_10047819 3300025918 Bacteria 2534
146 Ga0207646_10001100 3300025922 Bacteria 34422
147 Ga0207646_10010434 3300025922 Bacteria 9082
148 Ga0207646_10032023 3300025922 Bacteria 4758
149 Ga0207646_10089235 3300025922 Bacteria 2759
150 Ga0207646_10098441 3300025922 Bacteria 2621
151 Ga0207646_10212360 3300025922 Bacteria 1748
152 Ga0207646_10228492 3300025922 Bacteria 1681
153 Ga0207646_10608763 3300025922 Bacteria 980
154 Ga0207659_10171083 3300025926 Bacteria 1714
155 Ga0207644_10007287 3300025931 Bacteria 7200
156 Ga0207669_10193701 3300025937 Bacteria 1469
157 Ga0207665_10060594 3300025939 Bacteria 2563
158 Ga0207665_10069886 3300025939 Bacteria 2395
159 Ga0207665_10166119 3300025939 Bacteria 1591
160 Ga0207691_10098418 3300025940 Bacteria 2613
161 Ga0207711_10273873 3300025941 Bacteria 1553
162 Ga0207661_10230215 3300025944 Bacteria 1641
163 Ga0207651_10021124 3300025960 Bacteria 3948
164 Ga0207651_10169347 3300025960 Bacteria 1721
165 Ga0207658_10426204 3300025986 Bacteria 1171
166 Ga0207641_10356683 3300026088 Bacteria 1395
167 Ga0207675_100301396 3300026118 Bacteria 1561
168 Ga0209588_1085097 3300027671 Bacteria 1020
169 Ga0268265_10171640 3300028380 Bacteria 1854
170 Ga0307408_100003746 3300031548 Bacteria 10352
171 Ga0307408_100011114 3300031548 Bacteria 5948
172 Ga0307408_100086890 3300031548 Bacteria 2351
173 Ga0307408_100149796 3300031548 Unclassified 1840
174 Ga0316578_10009187 3300031728 Bacteria 5074
175 Ga0307413_10002235 3300031824 Bacteria 7805
176 Ga0307413_10002814 3300031824 Bacteria 7170
177 Ga0307413_10009326 3300031824 Unclassified 4691
178 Ga0307413_10083213 3300031824 Bacteria 2058
179 Ga0307413_10146439 3300031824 Bacteria 1640
180 Ga0307410_10002605 3300031852 Bacteria 8771
181 Ga0307410_10010055 3300031852 Bacteria 5341
182 Ga0307410_10024422 3300031852 Bacteria 3775
183 Ga0307410_10032478 3300031852 Bacteria 3360
184 Ga0307410_10071399 3300031852 Bacteria 2408
185 Ga0307410_10079275 3300031852 Bacteria 2301
186 Ga0307410_10135815 3300031852 Bacteria 1813
187 Ga0307410_10149019 3300031852 Bacteria 1740
188 Ga0307406_10015327 3300031901 Bacteria 4433
189 Ga0307406_10019461 3300031901 Bacteria 3984
190 Ga0307406_10025363 3300031901 Bacteria 3549
191 Ga0307406_10172845 3300031901 Bacteria 1565
192 Ga0307407_10006601 3300031903 Bacteria 5178
193 Ga0307407_10016027 3300031903 Bacteria 3722
194 Ga0307407_10056677 3300031903 Bacteria 2270
195 Ga0307407_10119351 3300031903 Bacteria 1669
196 Ga0307412_10038147 3300031911 Bacteria 3092
197 Ga0307412_10384690 3300031911 Unclassified 1137
198 Ga0307409_100000308 3300031995 Bacteria 19988
199 Ga0307409_100002174 3300031995 Bacteria 10114
200 Ga0307409_100010633 3300031995 Bacteria 5739
201 Ga0307409_100564783 3300031995 Unclassified 1119
202 Ga0307416_100001186 3300032002 Bacteria 13997
203 Ga0307416_100002892 3300032002 Bacteria 10004
204 Ga0307416_100012945 3300032002 Bacteria 5647
205 Ga0307416_100027550 3300032002 Unclassified 4210
206 Ga0307416_100054193 3300032002 Bacteria 3223
207 Ga0307416_100154060 3300032002 Bacteria 2113
208 Ga0307416_100519411 3300032002 Bacteria 1259
209 Ga0307416_101261406 3300032002 Bacteria 845
210 Ga0307414_10007376 3300032004 Bacteria 6179
211 Ga0307414_10286706 3300032004 Bacteria 1386
212 Ga0307411_10007316 3300032005 Bacteria 5609
213 Ga0307411_10037531 3300032005 Bacteria 3047
214 Ga0307411_10181133 3300032005 Bacteria 1599
215 Ga0307411_10349750 3300032005 Bacteria 1204
216 Ga0307415_100000203 3300032126 Bacteria 26255
217 Ga0307415_100002691 3300032126 Bacteria 8876
218 Ga0307415_100024157 3300032126 Bacteria 3789
219 Ga0307415_100060900 3300032126 Bacteria 2611
220 Ga0307415_100107093 3300032126 Bacteria 2065
221 Ga0307415_100641044 3300032126 Bacteria 951
222 Ga0373940_0023352 3300035088 Bacteria 1595
223 Ga0373944_0031182 3300035089 Bacteria 1603
224 Ga0373951_0041048 3300035091 Bacteria 1116
225 Ga0373932_0007087 3300035112 Bacteria 2666
226 Ga0373941_0018339 3300035115 Bacteria 1932
227 Ga0373960_0038430 3300035121 Bacteria 1372
228 Ga0373946_0148296 3300035171 Unclassified 1093
229 Ga0373961_0011722 3300035241 Bacteria 2180
230 Ga0373931_0036472 3300035691 Bacteria 2563
231 Ga0373927_0317736 3300035695 Bacteria 1025
232 Ga0373937_0115291 3300036401 Bacteria 2502
233 Ga0242420_003183 3300038996 Bacteria 2416
234 Ga0400489_43584 3300039093 Bacteria 7607
235 Ga0451577_0420433 3300042876 Bacteria 1214
236 Ga0466964_0166545 3300044706 Bacteria 1034
237 Ga0451576_0001721 3300045051 Bacteria 36069
238 Ga0451576_0009633 3300045051 Bacteria 11176
239 Ga0451576_0025189 3300045051 Bacteria 6413
240 Ga0451576_0068147 3300045051 Bacteria 3703
241 Ga0451576_0229993 3300045051 Bacteria 1936
242 Ga0451576_0794870 3300045051 Bacteria 993
243 Ga0466967_0747185 3300045976 Bacteria 970
244 Ga0495592_0285515 3300046454 Bacteria 1078
245 Ga0495603_0162729 3300046455 Bacteria 1294
246 Ga0495582_0006916 3300046473 Bacteria 6308
247 Ga0495664_0074218 3300046477 Bacteria 2035
248 Ga0495594_0020307 3300046499 Bacteria 3538
249 Ga0495618_0013147 3300046514 Bacteria 5036
250 Ga0495630_0022080 3300046517 Bacteria 4702
251 Ga0495666_0002485 3300046526 Bacteria 9162
252 Ga0495640_0021377 3300046533 Bacteria 4750
253 Ga0495586_0025114 3300046535 Bacteria 3187
254 Ga0495586_0119823 3300046535 Bacteria 1470
255 Ga0495587_0310535 3300046536 Bacteria 881
256 Ga0495634_0021941 3300046642 Bacteria 4504
257 Ga0495647_0329113 3300046681 Bacteria 692
258 Ga0495613_0223687 3300046689 Bacteria 1320
259 Ga0495674_0083079 3300047319 Bacteria 2746
260 Ga0495680_0021515 3300047322 Bacteria 5397
261 Ga0495614_0044799 3300048089 Bacteria 1898
262 Ga0496100_0884696 3300048903 Bacteria 701
263 Ga0496101_0277216 3300048904 Bacteria 1310
264 Ga0496102_0597984 3300048905 Bacteria 1026
265 Ga0496102_0714233 3300048905 Unclassified 925
266 Ga0496103_0330922 3300048906 Bacteria 980
267 Ga0496104_0064085 3300048907 Bacteria 3487
268 Ga0496104_0232769 3300048907 Bacteria 1754
269 Ga0496105_0206923 3300048908 Bacteria 1600
270 Ga0496106_0125989 3300048909 Bacteria 2005
271 Ga0496106_0424038 3300048909 Bacteria 1069
272 Ga0496107_0116038 3300048910 Bacteria 1971
273 Ga0496107_0390379 3300048910 Bacteria 1035
274 Ga0496108_0001782 3300048911 Bacteria 17164
275 Ga0496108_0002171 3300048911 Bacteria 15736
276 Ga0496108_0014418 3300048911 Bacteria 6454
277 Ga0496109_0001037 3300048912 Bacteria 22996
278 Ga0496109_0013514 3300048912 Bacteria 7085
279 Ga0496109_0043387 3300048912 Bacteria 4076
280 Ga0496110_0003421 3300048913 Bacteria 12142
281 Ga0496110_0044734 3300048913 Bacteria 3867
282 Ga0496111_0026985 3300048914 Bacteria 4059
283 Ga0496111_0101562 3300048914 Bacteria 2113
284 Ga0496111_0147065 3300048914 Bacteria 1747
285 Ga0496112_0000129 3300048915 Bacteria 47173
286 Ga0496112_0023489 3300048915 Bacteria 5892
287 Ga0496112_0041646 3300048915 Bacteria 4493
288 Ga0496113_0000062 3300048916 Bacteria 46801
289 Ga0496113_0110351 3300048916 Bacteria 2140
290 Ga0501067_0005771 3300049583 Bacteria 6869
291 Ga0501067_0139488 3300049583 Bacteria 1350
292 Ga0501068_0238590 3300049584 Unclassified 1157
293 Ga0501069_0015453 3300049585 Bacteria 4092
294 Ga0501069_0061300 3300049585 Bacteria 2100
295 Ga0501069_0061548 3300049585 Bacteria 2096
296 Ga0501070_0042845 3300049586 Bacteria 3769
297 Ga0501199_015475 3300049650 Bacteria 854
298 Ga0501209_000564 3300049656 Bacteria 4564
299 Ga0501247_001888 3300049677 Unclassified 2111
300 Ga0501247_009254 3300049677 Unclassified 1160
301 Ga0501253_000390 3300049683 Bacteria 3680
302 Ga0501245_026259 3300049708 Unclassified 940
303 Ga0501080_0130459 3300049742 Bacteria 2327
304 Ga0501262_027060 3300049759 Unclassified 812
305 Ga0501268_011139 3300049765 Bacteria 1414
306 Ga0501270_029120 3300049767 Bacteria 899
307 Ga0501283_002601 3300049779 Bacteria 2350
308 nmdc:mga05p37_107281_c1 3300050507 Bacteria 3436
309 nmdc:mga05p37_63536_c1 3300050507 Bacteria 4543
310 nmdc:mga09592_1219_c1 3300050508 Bacteria 20601
311 nmdc:mga09592_126101_c1 3300050508 Bacteria 2200
312 nmdc:mga09592_317920_c1 3300050508 Bacteria 1349
313 nmdc:mga06r32_1094951_c1 3300050510 Bacteria 746
314 nmdc:mga06r32_3480_c1 3300050510 Bacteria 14060
315 nmdc:mga0n895_383_c1 3300050512 Bacteria 29938
316 nmdc:mga0n895_43514_c1 3300050512 Bacteria 4376
317 nmdc:mga0n895_616_c1 3300050512 Bacteria 24731
318 nmdc:mga0n895_9577_c1 3300050512 Bacteria 8484
319 nmdc:mga0rr50_249399_c1 3300050513 Bacteria 1474
320 nmdc:mga08x19_13591_c1 3300050514 Bacteria 4923
321 nmdc:mga08x19_24476_c1 3300050514 Bacteria 3753
322 nmdc:mga08x19_31806_c1 3300050514 Bacteria 3323
323 nmdc:mga08x19_525220_c1 3300050514 Bacteria 837
324 nmdc:mga08x19_7632_c1 3300050514 Bacteria 6426
325 nmdc:mga0a205_106179_c1 3300050515 Bacteria 2706
326 nmdc:mga0a205_181056_c1 3300050515 Bacteria 2002
327 nmdc:mga0a205_23106_c1 3300050515 Bacteria 5897
328 nmdc:mga0a205_301727_c1 3300050515 Bacteria 1475
329 nmdc:mga0a205_44464_c1 3300050515 Bacteria 4281
330 nmdc:mga0a205_659_c1 3300050515 Bacteria 27518
331 Ga0590075_029390 3300059424 Unclassified 1389
332 Ga0590077_016952 3300059426 Bacteria 1530
333 Ga0070708_100046606
334 rootL2_10082818
335 Ga0070690_100092514
336 Ga0070680_100048993
337 Ga0070691_10073250
338 Ga0070687_100032289
339 Ga0070692_10166414
340 Ga0070668_100010255
341 Ga0070671_100001564
342 Ga0070674_100326422
343 Ga0070673_100136202
344 Ga0070673_100315756
345 Ga0070703_10002195
346 Ga0070703_10161046
347 Ga0070709_10008413
348 Ga0070709_10039567
349 Ga0070713_100067384
350 Ga0070710_10202614
351 Ga0070710_10303193
352 Ga0070701_10012891
353 Ga0070711_100000239
354 Ga0070711_100510449
355 Ga0070711_100571318
356 Ga0070705_100741666
357 Ga0070700_100132884
358 Ga0070694_100012674
359 Ga0070694_100017626
360 Ga0070694_100066236
361 Ga0070694_100081335
362 Ga0070694_100252142
363 Ga0070694_100259109
364 Ga0070708_100016285
365 Ga0070708_100066036
366 Ga0070708_100076091
367 Ga0070708_100104792
368 Ga0070708_100118414
369 Ga0070708_100704177
370 Ga0070663_100553924
371 Ga0070706_100253334
372 Ga0070706_100258541
373 Ga0070706_100311031
374 Ga0070706_100920394
375 Ga0070707_100018022
376 Ga0070707_100020148
377 Ga0070707_100023968
378 Ga0070707_100051348
379 Ga0070707_100109021
380 Ga0070707_100117123
381 Ga0070698_100000037
382 Ga0070698_100058135
383 Ga0070698_100174600
384 Ga0070698_100206048
385 Ga0070698_100775796
386 Ga0070699_100000719
387 Ga0070699_100001113
388 Ga0070699_100019554
389 Ga0070699_100022813
390 Ga0070699_100052119
391 Ga0070699_100188809
392 Ga0070699_100261812
393 Ga0070699_100350655
394 Ga0070699_100461049
395 Ga0070697_100013672
396 Ga0070697_100015734
397 Ga0070697_100017320
398 Ga0070697_100076643
399 Ga0070697_100091275
400 Ga0070697_100095091
401 Ga0070697_100110098
402 Ga0070697_100132822
403 Ga0070697_100151362
404 Ga0070697_100426619
405 Ga0070672_100054720
406 Ga0070695_100002535
407 Ga0070695_100041833
408 Ga0070695_100092058
409 Ga0070695_100095855
410 Ga0070696_100771113
411 Ga0070696_100794505
412 Ga0070704_100002333
413 Ga0070704_100005461
414 Ga0070704_100019448
415 Ga0070704_100071573
416 Ga0070704_100102069
417 Ga0070702_100008046
418 Ga0068859_100120840
419 Ga0068864_100049199
420 Ga0068861_100475579
421 Ga0068860_100568185
422 Ga0068862_100195860
423 Ga0068862_101152128
424 Ga0070715_10267154
425 Ga0070716_100004394
426 Ga0070716_100077448
427 Ga0075428_100147884
428 Ga0075428_100312722
429 Ga0075428_100387022
430 Ga0075430_100924017
431 Ga0075431_100019714
432 Ga0075431_100044571
433 Ga0075431_100224789
434 Ga0075431_100549714
435 Ga0075433_10021691
436 Ga0075433_10045489
437 Ga0075433_10137645
438 Ga0075433_10962555
439 Ga0075434_100002527
440 Ga0075434_100003715
441 Ga0075434_100018158
442 Ga0075434_100096401
443 Ga0075434_100327124
444 Ga0075434_100391574
445 Ga0075429_100001523
446 Ga0075436_100031092
447 Ga0075436_100031336
448 Ga0075436_100037007
449 Ga0075436_100208887
450 Ga0075436_100714211
451 Ga0097620_100120840
452 Ga0075435_100135540
453 Ga0075435_100172448
454 Ga0099794_10061516
455 Ga0099794_10098797
456 Ga0114129_10057578
457 Ga0114129_10125723
458 Ga0114129_10535754
459 Ga0105248_10045262
460 Ga0105248_10337895
461 Ga0105248_10553019
462 Ga0105238_10367590
463 Ga0105249_10895789
464 Ga0157378_10501431
465 Ga0157375_10175777
466 Ga0157375_10343437
467 Ga0163163_10296672
468 Ga0157379_10047330
469 Ga0157376_10923988
470 Ga0207653_10015519
471 Ga0207653_10053330
472 Ga0207692_10091597
473 Ga0207699_10066020
474 Ga0207684_10000781
475 Ga0207684_10018361
476 Ga0207663_10000256
477 Ga0207662_10047819
478 Ga0207646_10001100
479 Ga0207646_10010434
480 Ga0207646_10032023
481 Ga0207646_10089235
482 Ga0207646_10098441
483 Ga0207646_10212360
484 Ga0207646_10228492
485 Ga0207646_10608763
486 Ga0207659_10171083
487 Ga0207644_10007287
488 Ga0207669_10193701
489 Ga0207665_10060594
490 Ga0207665_10069886
491 Ga0207665_10166119
492 Ga0207691_10098418
493 Ga0207711_10273873
494 Ga0207661_10230215
495 Ga0207651_10021124
496 Ga0207651_10169347
497 Ga0207658_10426204
498 Ga0207641_10356683
499 Ga0207675_100301396
500 Ga0209588_1085097
501 Ga0268265_10171640
502 Ga0307408_100003746
503 Ga0307408_100011114
504 Ga0307408_100086890
505 Ga0307408_100149796
506 Ga0316578_10009187
507 Ga0307413_10002235
508 Ga0307413_10002814
509 Ga0307413_10009326
510 Ga0307413_10083213
511 Ga0307413_10146439
512 Ga0307410_10002605
513 Ga0307410_10010055
514 Ga0307410_10024422
515 Ga0307410_10032478
516 Ga0307410_10071399
517 Ga0307410_10079275
518 Ga0307410_10135815
519 Ga0307410_10149019
520 Ga0307406_10015327
521 Ga0307406_10019461
522 Ga0307406_10025363
523 Ga0307406_10172845
524 Ga0307407_10006601
525 Ga0307407_10016027
526 Ga0307407_10056677
527 Ga0307407_10119351
528 Ga0307412_10038147
529 Ga0307412_10384690
530 Ga0307409_100000308
531 Ga0307409_100002174
532 Ga0307409_100010633
533 Ga0307409_100564783
534 Ga0307416_100001186
535 Ga0307416_100002892
536 Ga0307416_100012945
537 Ga0307416_100027550
538 Ga0307416_100054193
539 Ga0307416_100154060
540 Ga0307416_100519411
541 Ga0307416_101261406
542 Ga0307414_10007376
543 Ga0307414_10286706
544 Ga0307411_10007316
545 Ga0307411_10037531
546 Ga0307411_10181133
547 Ga0307411_10349750
548 Ga0307415_100000203
549 Ga0307415_100002691
550 Ga0307415_100024157
551 Ga0307415_100060900
552 Ga0307415_100107093
553 Ga0307415_100641044
554 Ga0373940_0023352
555 Ga0373944_0031182
556 Ga0373951_0041048
557 Ga0373932_0007087
558 Ga0373941_0018339
559 Ga0373960_0038430
560 Ga0373946_0148296
561 Ga0373961_0011722
562 Ga0373931_0036472
563 Ga0373927_0317736
564 Ga0373937_0115291
565 Ga0242420_003183
566 Ga0400489_43584
567 Ga0451577_0420433
568 Ga0466964_0166545
569 Ga0451576_0001721
570 Ga0451576_0009633
571 Ga0451576_0025189
572 Ga0451576_0068147
573 Ga0451576_0229993
574 Ga0451576_0794870
575 Ga0466967_0747185
576 Ga0495592_0285515
577 Ga0495603_0162729
578 Ga0495582_0006916
579 Ga0495664_0074218
580 Ga0495594_0020307
581 Ga0495618_0013147
582 Ga0495630_0022080
583 Ga0495666_0002485
584 Ga0495640_0021377
585 Ga0495586_0025114
586 Ga0495586_0119823
587 Ga0495587_0310535
588 Ga0495634_0021941
589 Ga0495647_0329113
590 Ga0495613_0223687
591 Ga0495674_0083079
592 Ga0495680_0021515
593 Ga0495614_0044799
594 Ga0496100_0884696
595 Ga0496101_0277216
596 Ga0496102_0597984
597 Ga0496102_0714233
598 Ga0496103_0330922
599 Ga0496104_0064085
600 Ga0496104_0232769
601 Ga0496105_0206923
602 Ga0496106_0125989
603 Ga0496106_0424038
604 Ga0496107_0116038
605 Ga0496107_0390379
606 Ga0496108_0001782
607 Ga0496108_0002171
608 Ga0496108_0014418
609 Ga0496109_0001037
610 Ga0496109_0013514
611 Ga0496109_0043387
612 Ga0496110_0003421
613 Ga0496110_0044734
614 Ga0496111_0026985
615 Ga0496111_0101562
616 Ga0496111_0147065
617 Ga0496112_0000129
618 Ga0496112_0023489
619 Ga0496112_0041646
620 Ga0496113_0000062
621 Ga0496113_0110351
622 Ga0501067_0005771
623 Ga0501067_0139488
624 Ga0501068_0238590
625 Ga0501069_0015453
626 Ga0501069_0061300
627 Ga0501069_0061548
628 Ga0501070_0042845
629 Ga0501199_015475
630 Ga0501209_000564
631 Ga0501247_001888
632 Ga0501247_009254
633 Ga0501253_000390
634 Ga0501245_026259
635 Ga0501080_0130459
636 Ga0501262_027060
637 Ga0501268_011139
638 Ga0501270_029120
639 Ga0501283_002601
640 nmdc:mga05p37_107281_c1
641 nmdc:mga05p37_63536_c1
642 nmdc:mga09592_1219_c1
643 nmdc:mga09592_126101_c1
644 nmdc:mga09592_317920_c1
645 nmdc:mga06r32_1094951_c1
646 nmdc:mga06r32_3480_c1
647 nmdc:mga0n895_383_c1
648 nmdc:mga0n895_43514_c1
649 nmdc:mga0n895_616_c1
650 nmdc:mga0n895_9577_c1
651 nmdc:mga0rr50_249399_c1
652 nmdc:mga08x19_13591_c1
653 nmdc:mga08x19_24476_c1
654 nmdc:mga08x19_31806_c1
655 nmdc:mga08x19_525220_c1
656 nmdc:mga08x19_7632_c1
657 nmdc:mga0a205_106179_c1
658 nmdc:mga0a205_181056_c1
659 nmdc:mga0a205_23106_c1
660 nmdc:mga0a205_301727_c1
661 nmdc:mga0a205_44464_c1
662 nmdc:mga0a205_659_c1
663 Ga0590075_029390
664 Ga0590077_016952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

28

207

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.7777 4 201
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.7611 4 201
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7602 6 199
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7269 6 199
2crb-assembly1.cif.gz_A solution structure of mit domain from mouse nrbf-2 0.4145 124 196
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7871 13 189 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7752 13 189 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7583 13 189 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7329 13 189 1.10.1760.20
af_P81309_1_82_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4527 118 193 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A7W1SLM1-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9861 4 106 GO:0005886
GO:0008654
GO:0043772
AF-A0A3D1AVH2-F1-model_v4 Acyl-phosphate glycerol-3-phosphate acyltransferase 0.9684 6 114 GO:0005886
GO:0008654
GO:0043772
AF-X1I955-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9628 7 120 GO:0005886
GO:0008654
GO:0043772
AF-A0A7W1SLM1-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9585 4 106 GO:0005886
GO:0008654
GO:0043772
AF-A0A3C1WJ64-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.956 5 124 GO:0005886
GO:0008654
GO:0043772

Map