F410834

General Info

Members Datasets Scaffolds Average Seq Length
332 187 664 288

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100257186|Ga0070711_1002571862
Length 347
Sequence VVQAARRPTCRANAEILGTDPFFSAGSVLRGEIGVVLLKPALTAAVARLTDDQVPSPRLNAELLLRFILKCDRAYLFAHPERELSVEEQAGYATALNERARGVPTQYITGHQEFWGMDLIVTPAVLIPRPETEHVIEAVIALQSTGGGRQASVLEPRPSDIRRDPPTEVGRVTSGVRIIDVGTGSGCIALALAKELPQAAIYASDISAGALEIARANAARHQLENRIHFHQADLLEGLNLVDLDFVVSNPPYVGESEADQVQLEVRKFEPRHAVFAGPTGLEVITRLIAQAHAALRPGGWLVMEISGTISSAVKDLLTEWRNVVILPDLQSIPRVVQAQKTLDCTGE

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
70 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.61
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100257186 3300005439 Bacteria 1372
2 JGI25406J46586_10003224 3300003203 Bacteria 7675
3 Ga0058863_11939149 3300004799 Bacteria 4384
4 Ga0070658_10003432 3300005327 Bacteria 13027
5 Ga0068869_100062524 3300005334 Bacteria 2733
6 Ga0070680_100102398 3300005336 Bacteria 2378
7 Ga0070680_100108723 3300005336 Bacteria 2307
8 Ga0070680_100204736 3300005336 Unclassified 1664
9 Ga0070682_100166107 3300005337 Bacteria 1529
10 Ga0070660_100079420 3300005339 Bacteria 2574
11 Ga0070660_100092544 3300005339 Bacteria 2386
12 Ga0070661_100008120 3300005344 Bacteria 7240
13 Ga0070671_100431316 3300005355 Unclassified 1129
14 Ga0070659_100008806 3300005366 Bacteria 7392
15 Ga0070709_10001196 3300005434 Bacteria 14238
16 Ga0070709_10005038 3300005434 Bacteria 7143
17 Ga0070714_100003270 3300005435 Bacteria 12067
18 Ga0070714_100008118 3300005435 Bacteria 8182
19 Ga0070714_100039136 3300005435 Bacteria 3990
20 Ga0070714_100072400 3300005435 Bacteria 2983
21 Ga0070713_100002223 3300005436 Bacteria 12580
22 Ga0070713_100008385 3300005436 Bacteria 7326
23 Ga0070713_100012410 3300005436 Bacteria 6248
24 Ga0070713_100016085 3300005436 Bacteria 5616
25 Ga0070713_100154013 3300005436 Unclassified 2047
26 Ga0070713_100218110 3300005436 Unclassified 1730
27 Ga0070713_100384116 3300005436 Bacteria 1309
28 Ga0070710_10006182 3300005437 Bacteria 5732
29 Ga0070710_10014836 3300005437 Bacteria 3928
30 Ga0070710_10016516 3300005437 Bacteria 3759
31 Ga0070710_10077390 3300005437 Bacteria 1933
32 Ga0070711_100053576 3300005439 Bacteria 2781
33 Ga0070711_100378341 3300005439 Unclassified 1144
34 Ga0070705_100000075 3300005440 Bacteria 54228
35 Ga0070705_100016590 3300005440 Bacteria 3828
36 Ga0070705_100089215 3300005440 Bacteria 1916
37 Ga0070700_100354895 3300005441 Unclassified 1088
38 Ga0070694_100006003 3300005444 Bacteria 7367
39 Ga0070694_100015364 3300005444 Bacteria 4808
40 Ga0070694_100027060 3300005444 Bacteria 3722
41 Ga0070708_100000564 3300005445 Bacteria 27744
42 Ga0070708_100018590 3300005445 Bacteria 5818
43 Ga0070681_10009579 3300005458 Bacteria 9524
44 Ga0070681_10460159 3300005458 Unclassified 1184
45 Ga0070706_100000882 3300005467 Bacteria 32908
46 Ga0070706_100107139 3300005467 Bacteria 2600
47 Ga0070706_100258536 3300005467 Bacteria 1625
48 Ga0070707_100018783 3300005468 Bacteria 6509
49 Ga0070707_100036646 3300005468 Bacteria 4680
50 Ga0070707_100080154 3300005468 Unclassified 3151
51 Ga0070707_100118727 3300005468 Bacteria 2567
52 Ga0070707_100294946 3300005468 Bacteria 1575
53 Ga0070707_100381180 3300005468 Bacteria 1370
54 Ga0070707_100589568 3300005468 Bacteria 1074
55 Ga0070698_100000377 3300005471 Bacteria 46568
56 Ga0070698_100017147 3300005471 Bacteria 7635
57 Ga0070698_100059086 3300005471 Bacteria 3874
58 Ga0070698_100080968 3300005471 Bacteria 3242
59 Ga0070698_100133307 3300005471 Bacteria 2439
60 Ga0070699_100003197 3300005518 Bacteria 14487
61 Ga0070699_100012166 3300005518 Bacteria 7426
62 Ga0070699_100012833 3300005518 Bacteria 7223
63 Ga0070699_100019606 3300005518 Bacteria 5827
64 Ga0070699_100023354 3300005518 Bacteria 5326
65 Ga0070679_100001651 3300005530 Bacteria 20100
66 Ga0070679_100013352 3300005530 Bacteria 7865
67 Ga0070684_100146558 3300005535 Bacteria 2137
68 Ga0070697_100001923 3300005536 Bacteria 15901
69 Ga0070697_100052850 3300005536 Bacteria 3302
70 Ga0070697_100067371 3300005536 Bacteria 2928
71 Ga0068853_100015086 3300005539 Bacteria 6352
72 Ga0070695_100000970 3300005545 Bacteria 15578
73 Ga0070695_100213764 3300005545 Bacteria 1386
74 Ga0070696_100018491 3300005546 Bacteria 4710
75 Ga0070696_100025990 3300005546 Bacteria 3982
76 Ga0070696_100029370 3300005546 Bacteria 3757
77 Ga0070696_100130022 3300005546 Bacteria 1831
78 Ga0070704_100004236 3300005549 Bacteria 8286
79 Ga0068855_100082617 3300005563 Bacteria 3723
80 Ga0068855_100666097 3300005563 Bacteria 1116
81 Ga0070664_100003299 3300005564 Bacteria 13035
82 Ga0068857_100001011 3300005577 Bacteria 21657
83 Ga0068857_100202886 3300005577 Unclassified 1808
84 Ga0068856_100178662 3300005614 Unclassified 2135
85 Ga0070702_100281117 3300005615 Bacteria 1143
86 Ga0068852_100131811 3300005616 Bacteria 2302
87 Ga0068864_100016208 3300005618 Bacteria 6204
88 Ga0068862_100300210 3300005844 Bacteria 1477
89 Ga0081539_10000024 3300005985 Bacteria 354702
90 Ga0081539_10003877 3300005985 Bacteria 17471
91 Ga0081539_10004972 3300005985 Bacteria 14088
92 Ga0070717_10006525 3300006028 Bacteria 8587
93 Ga0070717_10008394 3300006028 Bacteria 7714
94 Ga0070717_10019932 3300006028 Bacteria 5266
95 Ga0070717_10069866 3300006028 Bacteria 2926
96 Ga0070717_10433627 3300006028 Bacteria 1183
97 Ga0070716_100000050 3300006173 Bacteria 45407
98 Ga0070716_100010042 3300006173 Bacteria 4736
99 Ga0070716_100010694 3300006173 Bacteria 4609
100 Ga0070716_100209625 3300006173 Bacteria 1301
101 Ga0070712_100000179 3300006175 Bacteria 35191
102 Ga0070712_100000418 3300006175 Bacteria 24299
103 Ga0070712_100002600 3300006175 Bacteria 11154
104 Ga0070712_100153366 3300006175 Bacteria 1771
105 Ga0097621_100374072 3300006237 Unclassified 1271
106 Ga0075428_100031760 3300006844 Bacteria 5833
107 Ga0075428_100051148 3300006844 Bacteria 4530
108 Ga0075430_100075341 3300006846 Bacteria 2829
109 Ga0075431_100002696 3300006847 Bacteria 17210
110 Ga0075433_10002390 3300006852 Bacteria 14276
111 Ga0075433_10015847 3300006852 Bacteria 6196
112 Ga0075434_100000473 3300006871 Bacteria 30035
113 Ga0075434_100026639 3300006871 Bacteria 5666
114 Ga0075429_100073479 3300006880 Bacteria 2978
115 Ga0068865_100259711 3300006881 Bacteria 1375
116 Ga0075436_100001853 3300006914 Bacteria 14504
117 Ga0075436_100009820 3300006914 Bacteria 6545
118 Ga0075436_100130953 3300006914 Bacteria 1759
119 Ga0075435_100000401 3300007076 Bacteria 26494
120 Ga0075435_100407257 3300007076 Unclassified 1170
121 Ga0105240_10029673 3300009093 Bacteria 7118
122 Ga0111539_10003150 3300009094 Bacteria 21825
123 Ga0111539_10013649 3300009094 Bacteria 10147
124 Ga0105245_10183623 3300009098 Bacteria 2000
125 Ga0114129_10031591 3300009147 Bacteria 7484
126 Ga0114129_10504687 3300009147 Bacteria 1579
127 Ga0105248_10324976 3300009177 Bacteria 1733
128 Ga0105238_10042247 3300009551 Bacteria 4617
129 Ga0105239_10011333 3300010375 Bacteria 9951
130 Ga0105239_10106186 3300010375 Bacteria 3111
131 Ga0105239_10567811 3300010375 Bacteria 1293
132 Ga0157373_10002766 3300013100 Bacteria 13268
133 Ga0157374_10646812 3300013296 Unclassified 1069
134 Ga0157378_10122147 3300013297 Bacteria 2402
135 Ga0157372_10017868 3300013307 Bacteria 7618
136 Ga0163163_10038017 3300014325 Bacteria 4686
137 Ga0157379_10132722 3300014968 Bacteria 2242
138 Ga0157379_10190361 3300014968 Bacteria 1854
139 Ga0157376_10117040 3300014969 Bacteria 2356
140 Ga0157376_10583494 3300014969 Bacteria 1110
141 Ga0224712_10115921 3300022467 Bacteria 1154
142 Ga0224570_100677 3300022730 Bacteria 2701
143 Ga0224569_103310 3300022732 Bacteria 1266
144 Ga0207692_10011525 3300025898 Bacteria 3767
145 Ga0207692_10017171 3300025898 Bacteria 3222
146 Ga0207692_10148969 3300025898 Unclassified 1338
147 Ga0207699_10001731 3300025906 Bacteria 10315
148 Ga0207699_10025524 3300025906 Bacteria 3245
149 Ga0207699_10049796 3300025906 Bacteria 2467
150 Ga0207705_10202233 3300025909 Bacteria 1505
151 Ga0207684_10000419 3300025910 Bacteria 56628
152 Ga0207684_10090320 3300025910 Bacteria 2610
153 Ga0207707_10001781 3300025912 Bacteria 19763
154 Ga0207707_10019911 3300025912 Bacteria 5858
155 Ga0207707_10233217 3300025912 Bacteria 1601
156 Ga0207695_10045774 3300025913 Bacteria 4642
157 Ga0207671_10087937 3300025914 Bacteria 2337
158 Ga0207693_10000042 3300025915 Bacteria 104665
159 Ga0207693_10001269 3300025915 Bacteria 22512
160 Ga0207693_10024851 3300025915 Bacteria 4751
161 Ga0207693_10028877 3300025915 Bacteria 4383
162 Ga0207693_10091641 3300025915 Bacteria 2383
163 Ga0207693_10200232 3300025915 Bacteria 1570
164 Ga0207663_10003932 3300025916 Bacteria 7351
165 Ga0207663_10027911 3300025916 Bacteria 3296
166 Ga0207663_10091724 3300025916 Unclassified 2018
167 Ga0207660_10222682 3300025917 Unclassified 1481
168 Ga0207662_10195899 3300025918 Bacteria 1306
169 Ga0207657_10088270 3300025919 Bacteria 2592
170 Ga0207657_10312622 3300025919 Bacteria 1243
171 Ga0207652_10021093 3300025921 Bacteria 5374
172 Ga0207652_10063447 3300025921 Bacteria 3195
173 Ga0207652_10080564 3300025921 Bacteria 2846
174 Ga0207646_10001253 3300025922 Bacteria 31821
175 Ga0207646_10069428 3300025922 Unclassified 3147
176 Ga0207646_10100107 3300025922 Bacteria 2598
177 Ga0207646_10122186 3300025922 Bacteria 2340
178 Ga0207646_10365832 3300025922 Bacteria 1303
179 Ga0207646_10444811 3300025922 Bacteria 1169
180 Ga0207687_10069756 3300025927 Bacteria 2508
181 Ga0207700_10000543 3300025928 Bacteria 22096
182 Ga0207700_10001622 3300025928 Bacteria 12784
183 Ga0207700_10007772 3300025928 Bacteria 6587
184 Ga0207700_10072191 3300025928 Bacteria 2660
185 Ga0207700_10132025 3300025928 Bacteria 2040
186 Ga0207700_10592165 3300025928 Unclassified 986
187 Ga0207664_10040038 3300025929 Bacteria 3641
188 Ga0207664_10254449 3300025929 Bacteria 1534
189 Ga0207664_10257375 3300025929 Bacteria 1525
190 Ga0207644_10034212 3300025931 Bacteria 3555
191 Ga0207690_10011000 3300025932 Bacteria 5396
192 Ga0207690_10014241 3300025932 Bacteria 4800
193 Ga0207665_10000152 3300025939 Bacteria 46840
194 Ga0207665_10016246 3300025939 Bacteria 4887
195 Ga0207665_10159679 3300025939 Bacteria 1621
196 Ga0207665_10215752 3300025939 Bacteria 1404
197 Ga0207711_10052670 3300025941 Bacteria 3489
198 Ga0207679_10041174 3300025945 Bacteria 3311
199 Ga0207667_10331339 3300025949 Bacteria 1554
200 Ga0207703_10264634 3300026035 Unclassified 1555
201 Ga0207708_10415054 3300026075 Unclassified 1115
202 Ga0207702_10209611 3300026078 Unclassified 1811
203 Ga0207641_10375423 3300026088 Bacteria 1360
204 Ga0207674_10000079 3300026116 Bacteria 102085
205 Ga0207674_10359205 3300026116 Unclassified 1408
206 Ga0207698_10396544 3300026142 Bacteria 1317
207 Ga0207428_10001713 3300027907 Bacteria 22495
208 Ga0268264_10565400 3300028381 Unclassified 1117
209 Ga0265338_10004473 3300028800 Bacteria 18861
210 Ga0265338_10015727 3300028800 Bacteria 8291
211 Ga0265762_1000079 3300030760 Bacteria 13189
212 Ga0265762_1000768 3300030760 Bacteria 5728
213 Ga0265760_10012635 3300031090 Bacteria 2415
214 Ga0265325_10036684 3300031241 Bacteria 2596
215 Ga0265339_10007545 3300031249 Bacteria 7013
216 Ga0265339_10026055 3300031249 Bacteria 3351
217 Ga0307408_100062160 3300031548 Bacteria 2728
218 Ga0265313_10007602 3300031595 Bacteria 7357
219 Ga0265313_10063127 3300031595 Bacteria 1728
220 Ga0307405_10049903 3300031731 Bacteria 2589
221 Ga0307406_10037175 3300031901 Bacteria 3005
222 Ga0307406_10108404 3300031901 Bacteria 1907
223 Ga0307412_10312833 3300031911 Bacteria 1246
224 Ga0307416_100008005 3300032002 Bacteria 6770
225 Ga0307414_10119436 3300032004 Bacteria 2024
226 Ga0373929_0050933 3300035085 Unclassified 946
227 Ga0373923_0013300 3300035111 Bacteria 3065
228 Ga0373945_0046885 3300035116 Bacteria 1578
229 Ga0373943_0029337 3300035170 Bacteria 2599
230 Ga0373943_0071094 3300035170 Bacteria 1762
231 Ga0373924_0047613 3300035410 Bacteria 1769
232 Ga0373935_0002910 3300035692 Bacteria 9859
233 Ga0373927_0132371 3300035695 Bacteria 1630
234 Ga0373947_0030667 3300035725 Bacteria 3161
235 Ga0373937_0114160 3300036401 Bacteria 2514
236 Ga0373937_0151793 3300036401 Bacteria 2170
237 Ga0373937_0159881 3300036401 Bacteria 2112
238 Ga0373925_0001633 3300037068 Bacteria 18907
239 Ga0373925_0003643 3300037068 Bacteria 11874
240 Ga0373925_0037079 3300037068 Bacteria 3597
241 Ga0373925_0122457 3300037068 Bacteria 2020
242 Ga0395898_0036539 3300037466 Bacteria 4877
243 Ga0436364_1317604 3300037853 Bacteria 3057
244 Ga0395901_0209656 3300038443 Bacteria 2040
245 Ga0436363_0153694 3300039450 Unclassified 1541
246 Ga0436363_1273201 3300039450 Bacteria 9906
247 Ga0439464_0021294 3300042439 Bacteria 1780
248 Ga0451577_0000259 3300042876 Bacteria 104325
249 Ga0466963_0000251 3300044694 Bacteria 23541
250 Ga0453684_0001058 3300044712 Bacteria 87559
251 Ga0453684_0035936 3300044712 Bacteria 6837
252 Ga0453684_0053902 3300044712 Bacteria 5245
253 Ga0466959_0112024 3300045049 Bacteria 1947
254 Ga0466958_0082324 3300045836 Bacteria 1982
255 Ga0466967_0199560 3300045976 Bacteria 1894
256 Ga0466967_0228727 3300045976 Bacteria 1770
257 Ga0495629_0015972 3300046459 Bacteria 5395
258 Ga0495650_0067608 3300046471 Bacteria 1411
259 Ga0495580_0001290 3300046472 Bacteria 22102
260 Ga0495580_0007424 3300046472 Bacteria 8813
261 Ga0495580_0009784 3300046472 Bacteria 7520
262 Ga0495580_0037437 3300046472 Bacteria 3481
263 Ga0495580_0098324 3300046472 Bacteria 2035
264 Ga0495580_0224794 3300046472 Bacteria 1289
265 Ga0495582_0004588 3300046473 Bacteria 7760
266 Ga0495584_0104655 3300046491 Unclassified 1431
267 Ga0495594_0234365 3300046499 Bacteria 1046
268 Ga0495630_0075384 3300046517 Bacteria 2542
269 Ga0495642_0004233 3300046528 Bacteria 5586
270 Ga0495642_0039707 3300046528 Bacteria 1910
271 Ga0495640_0303300 3300046533 Unclassified 992
272 Ga0495621_0014101 3300046539 Bacteria 2523
273 Ga0495645_0020537 3300046543 Bacteria 4768
274 Ga0495667_0104831 3300046559 Unclassified 1828
275 Ga0495659_0006106 3300046664 Bacteria 3807
276 Ga0495659_0055357 3300046664 Bacteria 1453
277 Ga0495658_0018449 3300046683 Bacteria 3628
278 Ga0495669_0001925 3300046684 Bacteria 8523
279 Ga0495636_0014844 3300047318 Bacteria 3099
280 Ga0495674_0026535 3300047319 Bacteria 5300
281 Ga0496100_0349874 3300048903 Bacteria 1116
282 Ga0496102_0000204 3300048905 Bacteria 79793
283 Ga0496102_0011843 3300048905 Bacteria 7528
284 Ga0496103_0000957 3300048906 Bacteria 20491
285 Ga0496104_0013830 3300048907 Bacteria 7281
286 Ga0496104_0226771 3300048907 Unclassified 1780
287 Ga0496105_0114926 3300048908 Bacteria 2220
288 Ga0496107_0037122 3300048910 Bacteria 3496
289 Ga0496108_0498979 3300048911 Bacteria 1063
290 Ga0496110_0335023 3300048913 Bacteria 1378
291 Ga0496112_0056591 3300048915 Bacteria 3860
292 Ga0496115_0033877 3300048918 Bacteria 4035
293 Ga0501031_0002929 3300049568 Bacteria 10916
294 Ga0501032_0051039 3300049569 Bacteria 2789
295 Ga0501036_0006087 3300049572 Bacteria 9789
296 Ga0501037_0007309 3300049573 Bacteria 8077
297 Ga0501038_0039494 3300049574 Bacteria 4128
298 Ga0501039_0002457 3300049575 Bacteria 13799
299 Ga0501039_0057859 3300049575 Bacteria 3002
300 Ga0501041_0000945 3300049577 Bacteria 15764
301 Ga0501042_0004670 3300049578 Bacteria 8738
302 Ga0501046_0011774 3300049580 Bacteria 7468
303 Ga0501046_0152000 3300049580 Bacteria 1746
304 Ga0501047_0079038 3300049581 Bacteria 3163
305 Ga0501048_0000214 3300049582 Bacteria 37952
306 Ga0501074_0163560 3300049590 Bacteria 1589
307 Ga0501076_0015069 3300049592 Bacteria 5837
308 Ga0501079_0486353 3300049741 Bacteria 970
309 Ga0501035_0023690 3300049822 Bacteria 5633
310 nmdc:mga05p37_94207_c1 3300050507 Bacteria 3690
311 nmdc:mga09592_73344_c1 3300050508 Bacteria 2908
312 nmdc:mga0qj67_20183_c1 3300050509 Bacteria 5100
313 nmdc:mga06r32_8678_c1 3300050510 Bacteria 9161
314 nmdc:mga08y16_2360_c1 3300050511 Bacteria 19370
315 nmdc:mga08y16_493150_c1 3300050511 Bacteria 1245
316 nmdc:mga0n895_138_c1 3300050512 Bacteria 43911
317 nmdc:mga0n895_245784_c1 3300050512 Unclassified 1816
318 nmdc:mga0n895_339589_c1 3300050512 Bacteria 1521
319 nmdc:mga0rr50_221616_c1 3300050513 Bacteria 1562
320 nmdc:mga0rr50_340736_c1 3300050513 Bacteria 1260
321 nmdc:mga0rr50_432762_c1 3300050513 Unclassified 1114
322 nmdc:mga0rr50_568_c1 3300050513 Bacteria 19822
323 nmdc:mga08x19_1384_c1 3300050514 Bacteria 15009
324 nmdc:mga08x19_288081_c1 3300050514 Unclassified 1139
325 nmdc:mga08x19_32457_c1 3300050514 Bacteria 3291
326 nmdc:mga08x19_60030_c1 3300050514 Bacteria 2463
327 nmdc:mga0a205_144179_c1 3300050515 Bacteria 2282
328 nmdc:mga0a205_42735_c1 3300050515 Bacteria 4367
329 nmdc:mga0a205_5447_c1 3300050515 Bacteria 11468
330 Ga0495601_0293268 3300053077 Unclassified 1060
331 Ga0501082_0037646 3300060353 Bacteria 4172
332 Ga0501082_0190996 3300060353 Bacteria 1782
333 Ga0070711_100257186
334 JGI25406J46586_10003224
335 Ga0058863_11939149
336 Ga0070658_10003432
337 Ga0068869_100062524
338 Ga0070680_100102398
339 Ga0070680_100108723
340 Ga0070680_100204736
341 Ga0070682_100166107
342 Ga0070660_100079420
343 Ga0070660_100092544
344 Ga0070661_100008120
345 Ga0070671_100431316
346 Ga0070659_100008806
347 Ga0070709_10001196
348 Ga0070709_10005038
349 Ga0070714_100003270
350 Ga0070714_100008118
351 Ga0070714_100039136
352 Ga0070714_100072400
353 Ga0070713_100002223
354 Ga0070713_100008385
355 Ga0070713_100012410
356 Ga0070713_100016085
357 Ga0070713_100154013
358 Ga0070713_100218110
359 Ga0070713_100384116
360 Ga0070710_10006182
361 Ga0070710_10014836
362 Ga0070710_10016516
363 Ga0070710_10077390
364 Ga0070711_100053576
365 Ga0070711_100378341
366 Ga0070705_100000075
367 Ga0070705_100016590
368 Ga0070705_100089215
369 Ga0070700_100354895
370 Ga0070694_100006003
371 Ga0070694_100015364
372 Ga0070694_100027060
373 Ga0070708_100000564
374 Ga0070708_100018590
375 Ga0070681_10009579
376 Ga0070681_10460159
377 Ga0070706_100000882
378 Ga0070706_100107139
379 Ga0070706_100258536
380 Ga0070707_100018783
381 Ga0070707_100036646
382 Ga0070707_100080154
383 Ga0070707_100118727
384 Ga0070707_100294946
385 Ga0070707_100381180
386 Ga0070707_100589568
387 Ga0070698_100000377
388 Ga0070698_100017147
389 Ga0070698_100059086
390 Ga0070698_100080968
391 Ga0070698_100133307
392 Ga0070699_100003197
393 Ga0070699_100012166
394 Ga0070699_100012833
395 Ga0070699_100019606
396 Ga0070699_100023354
397 Ga0070679_100001651
398 Ga0070679_100013352
399 Ga0070684_100146558
400 Ga0070697_100001923
401 Ga0070697_100052850
402 Ga0070697_100067371
403 Ga0068853_100015086
404 Ga0070695_100000970
405 Ga0070695_100213764
406 Ga0070696_100018491
407 Ga0070696_100025990
408 Ga0070696_100029370
409 Ga0070696_100130022
410 Ga0070704_100004236
411 Ga0068855_100082617
412 Ga0068855_100666097
413 Ga0070664_100003299
414 Ga0068857_100001011
415 Ga0068857_100202886
416 Ga0068856_100178662
417 Ga0070702_100281117
418 Ga0068852_100131811
419 Ga0068864_100016208
420 Ga0068862_100300210
421 Ga0081539_10000024
422 Ga0081539_10003877
423 Ga0081539_10004972
424 Ga0070717_10006525
425 Ga0070717_10008394
426 Ga0070717_10019932
427 Ga0070717_10069866
428 Ga0070717_10433627
429 Ga0070716_100000050
430 Ga0070716_100010042
431 Ga0070716_100010694
432 Ga0070716_100209625
433 Ga0070712_100000179
434 Ga0070712_100000418
435 Ga0070712_100002600
436 Ga0070712_100153366
437 Ga0097621_100374072
438 Ga0075428_100031760
439 Ga0075428_100051148
440 Ga0075430_100075341
441 Ga0075431_100002696
442 Ga0075433_10002390
443 Ga0075433_10015847
444 Ga0075434_100000473
445 Ga0075434_100026639
446 Ga0075429_100073479
447 Ga0068865_100259711
448 Ga0075436_100001853
449 Ga0075436_100009820
450 Ga0075436_100130953
451 Ga0075435_100000401
452 Ga0075435_100407257
453 Ga0105240_10029673
454 Ga0111539_10003150
455 Ga0111539_10013649
456 Ga0105245_10183623
457 Ga0114129_10031591
458 Ga0114129_10504687
459 Ga0105248_10324976
460 Ga0105238_10042247
461 Ga0105239_10011333
462 Ga0105239_10106186
463 Ga0105239_10567811
464 Ga0157373_10002766
465 Ga0157374_10646812
466 Ga0157378_10122147
467 Ga0157372_10017868
468 Ga0163163_10038017
469 Ga0157379_10132722
470 Ga0157379_10190361
471 Ga0157376_10117040
472 Ga0157376_10583494
473 Ga0224712_10115921
474 Ga0224570_100677
475 Ga0224569_103310
476 Ga0207692_10011525
477 Ga0207692_10017171
478 Ga0207692_10148969
479 Ga0207699_10001731
480 Ga0207699_10025524
481 Ga0207699_10049796
482 Ga0207705_10202233
483 Ga0207684_10000419
484 Ga0207684_10090320
485 Ga0207707_10001781
486 Ga0207707_10019911
487 Ga0207707_10233217
488 Ga0207695_10045774
489 Ga0207671_10087937
490 Ga0207693_10000042
491 Ga0207693_10001269
492 Ga0207693_10024851
493 Ga0207693_10028877
494 Ga0207693_10091641
495 Ga0207693_10200232
496 Ga0207663_10003932
497 Ga0207663_10027911
498 Ga0207663_10091724
499 Ga0207660_10222682
500 Ga0207662_10195899
501 Ga0207657_10088270
502 Ga0207657_10312622
503 Ga0207652_10021093
504 Ga0207652_10063447
505 Ga0207652_10080564
506 Ga0207646_10001253
507 Ga0207646_10069428
508 Ga0207646_10100107
509 Ga0207646_10122186
510 Ga0207646_10365832
511 Ga0207646_10444811
512 Ga0207687_10069756
513 Ga0207700_10000543
514 Ga0207700_10001622
515 Ga0207700_10007772
516 Ga0207700_10072191
517 Ga0207700_10132025
518 Ga0207700_10592165
519 Ga0207664_10040038
520 Ga0207664_10254449
521 Ga0207664_10257375
522 Ga0207644_10034212
523 Ga0207690_10011000
524 Ga0207690_10014241
525 Ga0207665_10000152
526 Ga0207665_10016246
527 Ga0207665_10159679
528 Ga0207665_10215752
529 Ga0207711_10052670
530 Ga0207679_10041174
531 Ga0207667_10331339
532 Ga0207703_10264634
533 Ga0207708_10415054
534 Ga0207702_10209611
535 Ga0207641_10375423
536 Ga0207674_10000079
537 Ga0207674_10359205
538 Ga0207698_10396544
539 Ga0207428_10001713
540 Ga0268264_10565400
541 Ga0265338_10004473
542 Ga0265338_10015727
543 Ga0265762_1000079
544 Ga0265762_1000768
545 Ga0265760_10012635
546 Ga0265325_10036684
547 Ga0265339_10007545
548 Ga0265339_10026055
549 Ga0307408_100062160
550 Ga0265313_10007602
551 Ga0265313_10063127
552 Ga0307405_10049903
553 Ga0307406_10037175
554 Ga0307406_10108404
555 Ga0307412_10312833
556 Ga0307416_100008005
557 Ga0307414_10119436
558 Ga0373929_0050933
559 Ga0373923_0013300
560 Ga0373945_0046885
561 Ga0373943_0029337
562 Ga0373943_0071094
563 Ga0373924_0047613
564 Ga0373935_0002910
565 Ga0373927_0132371
566 Ga0373947_0030667
567 Ga0373937_0114160
568 Ga0373937_0151793
569 Ga0373937_0159881
570 Ga0373925_0001633
571 Ga0373925_0003643
572 Ga0373925_0037079
573 Ga0373925_0122457
574 Ga0395898_0036539
575 Ga0436364_1317604
576 Ga0395901_0209656
577 Ga0436363_0153694
578 Ga0436363_1273201
579 Ga0439464_0021294
580 Ga0451577_0000259
581 Ga0466963_0000251
582 Ga0453684_0001058
583 Ga0453684_0035936
584 Ga0453684_0053902
585 Ga0466959_0112024
586 Ga0466958_0082324
587 Ga0466967_0199560
588 Ga0466967_0228727
589 Ga0495629_0015972
590 Ga0495650_0067608
591 Ga0495580_0001290
592 Ga0495580_0007424
593 Ga0495580_0009784
594 Ga0495580_0037437
595 Ga0495580_0098324
596 Ga0495580_0224794
597 Ga0495582_0004588
598 Ga0495584_0104655
599 Ga0495594_0234365
600 Ga0495630_0075384
601 Ga0495642_0004233
602 Ga0495642_0039707
603 Ga0495640_0303300
604 Ga0495621_0014101
605 Ga0495645_0020537
606 Ga0495667_0104831
607 Ga0495659_0006106
608 Ga0495659_0055357
609 Ga0495658_0018449
610 Ga0495669_0001925
611 Ga0495636_0014844
612 Ga0495674_0026535
613 Ga0496100_0349874
614 Ga0496102_0000204
615 Ga0496102_0011843
616 Ga0496103_0000957
617 Ga0496104_0013830
618 Ga0496104_0226771
619 Ga0496105_0114926
620 Ga0496107_0037122
621 Ga0496108_0498979
622 Ga0496110_0335023
623 Ga0496112_0056591
624 Ga0496115_0033877
625 Ga0501031_0002929
626 Ga0501032_0051039
627 Ga0501036_0006087
628 Ga0501037_0007309
629 Ga0501038_0039494
630 Ga0501039_0002457
631 Ga0501039_0057859
632 Ga0501041_0000945
633 Ga0501042_0004670
634 Ga0501046_0011774
635 Ga0501046_0152000
636 Ga0501047_0079038
637 Ga0501048_0000214
638 Ga0501074_0163560
639 Ga0501076_0015069
640 Ga0501079_0486353
641 Ga0501035_0023690
642 nmdc:mga05p37_94207_c1
643 nmdc:mga09592_73344_c1
644 nmdc:mga0qj67_20183_c1
645 nmdc:mga06r32_8678_c1
646 nmdc:mga08y16_2360_c1
647 nmdc:mga08y16_493150_c1
648 nmdc:mga0n895_138_c1
649 nmdc:mga0n895_245784_c1
650 nmdc:mga0n895_339589_c1
651 nmdc:mga0rr50_221616_c1
652 nmdc:mga0rr50_340736_c1
653 nmdc:mga0rr50_432762_c1
654 nmdc:mga0rr50_568_c1
655 nmdc:mga08x19_1384_c1
656 nmdc:mga08x19_288081_c1
657 nmdc:mga08x19_32457_c1
658 nmdc:mga08x19_60030_c1
659 nmdc:mga0a205_144179_c1
660 nmdc:mga0a205_42735_c1
661 nmdc:mga0a205_5447_c1
662 Ga0495601_0293268
663 Ga0501082_0037646
664 Ga0501082_0190996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17827

PrmC_N

PrmC N-terminal domain

40

110

0.99

PF12847

Methyltransf_18

Methyltransferase domain

168

249

0.94

PF05175

MTS

Methyltransferase small domain

170

267

0.93

PF08241

Methyltransf_11

Methyltransferase domain

179

250

0.9

PF08242

Methyltransf_12

Methyltransferase domain

179

251

0.9

PF10294

Methyltransf_16

Lysine methyltransferase

162

248

0.89

PF09445

Methyltransf_15

RNA cap guanine-N2 methyltransferase

175

275

0.87

PF13649

Methyltransf_25

Methyltransferase domain

178

268

0.86

PF01170

UPF0020

RMKL-like, methyltransferase domain

172

265

0.83

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

169

250

0.82

PF13847

Methyltransf_31

Methyltransferase domain

172

341

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8976 3 281
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8884 3 281
1vq1-assembly2.cif.gz_B crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.8838 1 278
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.8815 1 278
1nv8-assembly2.cif.gz_B n5-glutamine methyltransferase, hemk 0.875 7 283
ID Description Score Start End Superfamily
af_F1QJH5_134_342_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9656 88 282 3.40.50.150
af_Q9VMD3_119_323_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9524 88 282 3.40.50.150
af_Q9FMI5_170_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9487 88 281 3.40.50.150
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.939 89 281 3.40.50.150
af_Q9Y5R4_126_337_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9329 91 283 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3N5NIX9-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9736 62 280 GO:0008276
GO:0032259
GO:0102559
AF-A0A349LGV5-F1-model_v4 Peptide chain release factor N(5)-glutamine methyltransferase 0.9698 59 282 GO:0003676
GO:0008276
GO:0032259
GO:0102559
AF-A0A537J1K4-F1-model_v4 Peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9644 79 283 GO:0003676
GO:0008276
GO:0032259
GO:0102559
AF-A0A7Z9IXY2-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9641 58 283 GO:0003676
GO:0008170
GO:0008276
GO:0008757
GO:0032259
GO:0102559
AF-A0A2T7NTP1-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9623 64 283 GO:0003676
GO:0005739
GO:0008276
GO:0032259

Map