F410813

General Info

Members Datasets Scaffolds Average Seq Length
332 140 664 148

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101016843|Ga0070669_1010168431
Length 183
Sequence MHRELHENRPNILDRARDFGKNPHPVQRSTRKEITMGSILNENDRAEITRRMKSLSEASSRQWGSMDVASMLKHLRLSAEMTLGDLPVTDSKKRAFQVFPLKHLILYVLPFPKGAPTADELKPRAAASFDEERAAVLQLLERIGTGPQTGAGPAHPLFGPMTWREWGVVTYKHANHHLKQFGA

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
116 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
131 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
132 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
133 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
134 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
135 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
136 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.7
Stem 0
Stem Tuber 0
Unclassified 35.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_101016843 3300005353 Unclassified 712
2 rootL2_10122102 3300003322 Bacteria 4180
3 Ga0065704_10566877 3300005289 Bacteria 626
4 Ga0065715_10015010 3300005293 Bacteria 2614
5 Ga0065715_10026865 3300005293 Unclassified 2218
6 Ga0065715_10101226 3300005293 Bacteria 3226
7 Ga0065715_10244357 3300005293 Bacteria 1178
8 Ga0065715_10390263 3300005293 Bacteria 895
9 Ga0065715_10508547 3300005293 Unclassified 773
10 Ga0065707_10028647 3300005295 Bacteria 2007
11 Ga0065707_10089624 3300005295 Bacteria 4317
12 Ga0065707_10180752 3300005295 Bacteria 1420
13 Ga0070676_10606417 3300005328 Unclassified 790
14 Ga0070690_100544079 3300005330 Bacteria 874
15 Ga0070690_100897568 3300005330 Unclassified 693
16 Ga0070670_100117942 3300005331 Bacteria 2289
17 Ga0070670_100909170 3300005331 Bacteria 798
18 Ga0070670_101028902 3300005331 Bacteria 750
19 Ga0070670_101052837 3300005331 Unclassified 741
20 Ga0068869_100005136 3300005334 Bacteria 8208
21 Ga0068869_100118157 3300005334 Unclassified 2025
22 Ga0068869_100802759 3300005334 Unclassified 809
23 Ga0070666_10086757 3300005335 Bacteria 2145
24 Ga0070680_100008331 3300005336 Bacteria 7934
25 Ga0070680_100289827 3300005336 Bacteria 1387
26 Ga0070682_100003984 3300005337 Bacteria 8204
27 Ga0068868_100023828 3300005338 Bacteria 4636
28 Ga0068868_101834412 3300005338 Bacteria 573
29 Ga0070689_100000094 3300005340 Bacteria 51583
30 Ga0070689_100125646 3300005340 Bacteria 2052
31 Ga0070689_100139655 3300005340 Bacteria 1948
32 Ga0070689_100194872 3300005340 Bacteria 1651
33 Ga0070689_101186413 3300005340 Unclassified 685
34 Ga0070689_102137066 3300005340 Unclassified 513
35 Ga0070687_100039585 3300005343 Bacteria 2370
36 Ga0070687_100043022 3300005343 Bacteria 2292
37 Ga0070687_100468991 3300005343 Unclassified 841
38 Ga0070661_100528347 3300005344 Bacteria 947
39 Ga0070669_101309149 3300005353 Bacteria 627
40 Ga0070671_100027076 3300005355 Bacteria 4716
41 Ga0070673_100239655 3300005364 Bacteria 1576
42 Ga0070673_100272641 3300005364 Unclassified 1482
43 Ga0070673_100803677 3300005364 Bacteria 868
44 Ga0070673_100907543 3300005364 Unclassified 817
45 Ga0070688_100071705 3300005365 Bacteria 2218
46 Ga0070667_100054403 3300005367 Bacteria 3379
47 Ga0070701_10093923 3300005438 Bacteria 1649
48 Ga0070701_10866494 3300005438 Unclassified 621
49 Ga0070705_100120234 3300005440 Unclassified 1695
50 Ga0070700_100000043 3300005441 Bacteria 98943
51 Ga0070700_100011263 3300005441 Unclassified 4951
52 Ga0070700_100065938 3300005441 Bacteria 2297
53 Ga0070700_100776185 3300005441 Unclassified 769
54 Ga0070694_100064044 3300005444 Unclassified 2516
55 Ga0070694_100217052 3300005444 Unclassified 1433
56 Ga0070694_100304479 3300005444 Unclassified 1222
57 Ga0070694_100467390 3300005444 Bacteria 999
58 Ga0070694_100820623 3300005444 Unclassified 764
59 Ga0070678_101074726 3300005456 Unclassified 742
60 Ga0070678_101776253 3300005456 Unclassified 581
61 Ga0068867_100162186 3300005459 Bacteria 1764
62 Ga0068867_100318507 3300005459 Bacteria 1288
63 Ga0068867_101052504 3300005459 Bacteria 740
64 Ga0068867_101119587 3300005459 Unclassified 720
65 Ga0070685_10051651 3300005466 Bacteria 2377
66 Ga0070685_10132673 3300005466 Bacteria 1559
67 Ga0070699_100015986 3300005518 Bacteria 6443
68 Ga0070697_100204977 3300005536 Bacteria 1677
69 Ga0068853_100030132 3300005539 Bacteria 4581
70 Ga0070686_100003286 3300005544 Bacteria 8847
71 Ga0070686_100283618 3300005544 Bacteria 1222
72 Ga0070695_100559745 3300005545 Unclassified 892
73 Ga0070696_100007226 3300005546 Bacteria 7415
74 Ga0070696_100057217 3300005546 Unclassified 2720
75 Ga0070696_101159789 3300005546 Bacteria 651
76 Ga0070693_100009681 3300005547 Unclassified 4799
77 Ga0070693_100353220 3300005547 Bacteria 1007
78 Ga0070693_100388626 3300005547 Bacteria 964
79 Ga0070665_101148120 3300005548 Bacteria 788
80 Ga0070704_100023543 3300005549 Bacteria 4026
81 Ga0070704_100334129 3300005549 Unclassified 1274
82 Ga0070704_100389761 3300005549 Unclassified 1186
83 Ga0070704_100572147 3300005549 Bacteria 990
84 Ga0070704_101345665 3300005549 Unclassified 654
85 Ga0070664_100799483 3300005564 Unclassified 882
86 Ga0068857_100178043 3300005577 Bacteria 1935
87 Ga0068857_100875396 3300005577 Unclassified 860
88 Ga0068854_100049790 3300005578 Bacteria 2995
89 Ga0068854_100066421 3300005578 Unclassified 2625
90 Ga0068854_100097458 3300005578 Bacteria 2199
91 Ga0068854_101715405 3300005578 Unclassified 574
92 Ga0070702_100012181 3300005615 Bacteria 4301
93 Ga0070702_100019150 3300005615 Bacteria 3563
94 Ga0070702_100236741 3300005615 Unclassified 1230
95 Ga0068852_101243999 3300005616 Unclassified 766
96 Ga0068859_100005034 3300005617 Bacteria 13408
97 Ga0068859_100062525 3300005617 Bacteria 3753
98 Ga0068859_100091834 3300005617 Unclassified 3087
99 Ga0068859_100097866 3300005617 Bacteria 2987
100 Ga0068859_100102554 3300005617 Bacteria 2918
101 Ga0068859_100269453 3300005617 Bacteria 1795
102 Ga0068859_100391484 3300005617 Bacteria 1485
103 Ga0068859_100625141 3300005617 Unclassified 1169
104 Ga0068859_100661322 3300005617 Unclassified 1136
105 Ga0068859_101179911 3300005617 Unclassified 843
106 Ga0068864_100020964 3300005618 Bacteria 5473
107 Ga0068864_100022166 3300005618 Bacteria 5325
108 Ga0068864_100084861 3300005618 Bacteria 2783
109 Ga0068864_100163291 3300005618 Bacteria 2026
110 Ga0068864_100258043 3300005618 Unclassified 1620
111 Ga0068864_100516999 3300005618 Bacteria 1150
112 Ga0068866_10101979 3300005718 Bacteria 1585
113 Ga0068866_10673496 3300005718 Bacteria 707
114 Ga0068861_100040143 3300005719 Bacteria 3498
115 Ga0068861_100207139 3300005719 Bacteria 1650
116 Ga0068861_100267117 3300005719 Bacteria 1467
117 Ga0068861_100521716 3300005719 Bacteria 1077
118 Ga0068861_101055653 3300005719 Unclassified 778
119 Ga0068861_101810327 3300005719 Unclassified 606
120 Ga0068870_10129622 3300005840 Unclassified 1463
121 Ga0068870_10141802 3300005840 Bacteria 1407
122 Ga0068870_10146887 3300005840 Bacteria 1385
123 Ga0068870_10348005 3300005840 Bacteria 950
124 Ga0068863_100016139 3300005841 Bacteria 7164
125 Ga0068863_100142940 3300005841 Bacteria 2287
126 Ga0068863_100245557 3300005841 Bacteria 1728
127 Ga0068858_100062325 3300005842 Bacteria 3447
128 Ga0068858_101221740 3300005842 Bacteria 739
129 Ga0068860_100010319 3300005843 Bacteria 9236
130 Ga0068860_100013707 3300005843 Bacteria 7949
131 Ga0068860_100217310 3300005843 Unclassified 1855
132 Ga0068860_100321671 3300005843 Unclassified 1518
133 Ga0068860_100584298 3300005843 Unclassified 1121
134 Ga0068860_100673495 3300005843 Bacteria 1043
135 Ga0068860_100863680 3300005843 Bacteria 920
136 Ga0068862_100046276 3300005844 Bacteria 3712
137 Ga0068862_100056451 3300005844 Bacteria 3365
138 Ga0068862_100079390 3300005844 Bacteria 2844
139 Ga0068862_100340913 3300005844 Unclassified 1388
140 Ga0081539_10001281 3300005985 Bacteria 44259
141 Ga0097621_100005628 3300006237 Bacteria 8836
142 Ga0097621_100030336 3300006237 Bacteria 4279
143 Ga0068871_100032389 3300006358 Bacteria 4129
144 Ga0068871_100035289 3300006358 Bacteria 3972
145 Ga0068871_101304707 3300006358 Bacteria 683
146 Ga0075428_100012313 3300006844 Bacteria 9515
147 Ga0075428_100189428 3300006844 Bacteria 2225
148 Ga0075434_101399596 3300006871 Unclassified 709
149 Ga0075429_100347133 3300006880 Bacteria 1299
150 Ga0075429_100975198 3300006880 Unclassified 741
151 Ga0068865_100030103 3300006881 Bacteria 3608
152 Ga0068865_100882502 3300006881 Bacteria 777
153 Ga0097620_100005034 3300006931 Bacteria 13408
154 Ga0097620_100062526 3300006931 Bacteria 3753
155 Ga0097620_100091823 3300006931 Unclassified 3087
156 Ga0097620_100097862 3300006931 Bacteria 2987
157 Ga0097620_100102559 3300006931 Bacteria 2918
158 Ga0097620_100269439 3300006931 Bacteria 1795
159 Ga0097620_100391449 3300006931 Bacteria 1485
160 Ga0097620_100625152 3300006931 Unclassified 1169
161 Ga0097620_100661363 3300006931 Unclassified 1136
162 Ga0097620_101179900 3300006931 Unclassified 843
163 Ga0105245_10771135 3300009098 Bacteria 998
164 Ga0105245_11956417 3300009098 Unclassified 640
165 Ga0105247_10047359 3300009101 Bacteria 2639
166 Ga0114129_11060957 3300009147 Bacteria 1017
167 Ga0114129_11093695 3300009147 Unclassified 998
168 Ga0105243_10030218 3300009148 Bacteria 4169
169 Ga0105243_10081336 3300009148 Bacteria 2644
170 Ga0105243_10723556 3300009148 Unclassified 973
171 Ga0105243_11494822 3300009148 Bacteria 699
172 Ga0105242_10000515 3300009176 Bacteria 30355
173 Ga0105242_10012478 3300009176 Bacteria 6543
174 Ga0105242_10122119 3300009176 Unclassified 2237
175 Ga0105248_10026575 3300009177 Bacteria 6438
176 Ga0105248_10358392 3300009177 Unclassified 1642
177 Ga0105248_12959062 3300009177 Unclassified 541
178 Ga0105238_10025620 3300009551 Bacteria 6012
179 Ga0105249_10284888 3300009553 Unclassified 1651
180 Ga0105249_10380388 3300009553 Bacteria 1437
181 Ga0105249_10486813 3300009553 Unclassified 1277
182 Ga0105239_10123217 3300010375 Bacteria 2880
183 Ga0105239_10324222 3300010375 Unclassified 1737
184 Ga0105246_10007264 3300011119 Bacteria 6787
185 Ga0105246_10184443 3300011119 Bacteria 1610
186 Ga0105246_10299127 3300011119 Bacteria 1298
187 Ga0157371_10471198 3300013102 Unclassified 925
188 Ga0157378_10043905 3300013297 Unclassified 3968
189 Ga0157378_10389080 3300013297 Bacteria 1371
190 Ga0157378_10975615 3300013297 Bacteria 881
191 Ga0163162_10307528 3300013306 Bacteria 1717
192 Ga0163162_10379962 3300013306 Bacteria 1546
193 Ga0163162_12030728 3300013306 Unclassified 659
194 Ga0157375_13441994 3300013308 Unclassified 527
195 Ga0163163_10008944 3300014325 Bacteria 8921
196 Ga0157380_10014503 3300014326 Bacteria 5766
197 Ga0157380_10018031 3300014326 Bacteria 5235
198 Ga0157380_10141287 3300014326 Unclassified 2069
199 Ga0157380_10376762 3300014326 Bacteria 1338
200 Ga0157380_10556720 3300014326 Bacteria 1126
201 Ga0157379_10003296 3300014968 Bacteria 13660
202 Ga0157379_11910427 3300014968 Unclassified 585
203 Ga0157376_10014995 3300014969 Bacteria 5842
204 Ga0163161_10010833 3300017792 Bacteria 6320
205 Ga0163161_10722637 3300017792 Unclassified 831
206 Ga0207642_10084045 3300025899 Bacteria 1554
207 Ga0207642_10169212 3300025899 Unclassified 1181
208 Ga0207710_10057344 3300025900 Bacteria 1759
209 Ga0207680_10178472 3300025903 Bacteria 1435
210 Ga0207647_10005457 3300025904 Bacteria 9318
211 Ga0207685_10399069 3300025905 Bacteria 704
212 Ga0207645_10711617 3300025907 Unclassified 683
213 Ga0207643_10001761 3300025908 Bacteria 12089
214 Ga0207643_10332929 3300025908 Bacteria 950
215 Ga0207643_10378549 3300025908 Bacteria 892
216 Ga0207654_10242703 3300025911 Unclassified 1205
217 Ga0207660_10424430 3300025917 Unclassified 1073
218 Ga0207662_10002960 3300025918 Bacteria 8642
219 Ga0207662_10099037 3300025918 Bacteria 1804
220 Ga0207662_10220725 3300025918 Bacteria 1234
221 Ga0207662_10413851 3300025918 Unclassified 916
222 Ga0207681_10863672 3300025923 Unclassified 757
223 Ga0207650_10509869 3300025925 Unclassified 1006
224 Ga0207644_10449291 3300025931 Bacteria 1059
225 Ga0207686_10000030 3300025934 Bacteria 159065
226 Ga0207686_10037962 3300025934 Unclassified 2910
227 Ga0207686_10189584 3300025934 Unclassified 1465
228 Ga0207709_10019103 3300025935 Bacteria 3846
229 Ga0207709_10893707 3300025935 Unclassified 722
230 Ga0207709_11278330 3300025935 Unclassified 606
231 Ga0207709_11495890 3300025935 Unclassified 560
232 Ga0207670_10323041 3300025936 Unclassified 1215
233 Ga0207670_10330291 3300025936 Bacteria 1202
234 Ga0207669_11115248 3300025937 Unclassified 666
235 Ga0207704_10132538 3300025938 Bacteria 1729
236 Ga0207691_10008343 3300025940 Bacteria 9950
237 Ga0207691_10071697 3300025940 Bacteria 3125
238 Ga0207711_10006429 3300025941 Bacteria 9894
239 Ga0207711_10247027 3300025941 Bacteria 1637
240 Ga0207711_10284721 3300025941 Unclassified 1522
241 Ga0207689_10022463 3300025942 Bacteria 5304
242 Ga0207689_10052593 3300025942 Unclassified 3355
243 Ga0207689_10185220 3300025942 Bacteria 1717
244 Ga0207689_10318422 3300025942 Unclassified 1291
245 Ga0207689_10627476 3300025942 Bacteria 905
246 Ga0207689_11008494 3300025942 Bacteria 702
247 Ga0207651_10467595 3300025960 Bacteria 1085
248 Ga0207651_10586160 3300025960 Unclassified 973
249 Ga0207651_10942593 3300025960 Unclassified 770
250 Ga0207712_10002858 3300025961 Bacteria 11064
251 Ga0207712_10137703 3300025961 Unclassified 1869
252 Ga0207712_10468100 3300025961 Unclassified 1072
253 Ga0207640_10024124 3300025981 Unclassified 3665
254 Ga0207640_10079967 3300025981 Bacteria 2230
255 Ga0207677_10081949 3300026023 Bacteria 2317
256 Ga0207677_10198736 3300026023 Bacteria 1592
257 Ga0207703_10092368 3300026035 Bacteria 2547
258 Ga0207703_10137401 3300026035 Bacteria 2117
259 Ga0207703_10379001 3300026035 Unclassified 1308
260 Ga0207639_10035253 3300026041 Bacteria 3702
261 Ga0207708_10000060 3300026075 Bacteria 93846
262 Ga0207708_10017610 3300026075 Bacteria 5379
263 Ga0207708_10030591 3300026075 Bacteria 4082
264 Ga0207708_10283980 3300026075 Bacteria 1342
265 Ga0207641_10100671 3300026088 Bacteria 2545
266 Ga0207641_10124384 3300026088 Unclassified 2307
267 Ga0207641_10700976 3300026088 Unclassified 997
268 Ga0207641_10748013 3300026088 Unclassified 965
269 Ga0207648_10024215 3300026089 Bacteria 5423
270 Ga0207648_10076550 3300026089 Unclassified 2916
271 Ga0207648_10100150 3300026089 Bacteria 2538
272 Ga0207648_10136906 3300026089 Bacteria 2157
273 Ga0207648_10503712 3300026089 Unclassified 1108
274 Ga0207676_10001399 3300026095 Bacteria 17943
275 Ga0207676_10023959 3300026095 Bacteria 4511
276 Ga0207676_10299821 3300026095 Bacteria 1467
277 Ga0207676_10924068 3300026095 Bacteria 857
278 Ga0207674_10338699 3300026116 Bacteria 1454
279 Ga0207674_10813047 3300026116 Unclassified 902
280 Ga0207674_11345680 3300026116 Bacteria 684
281 Ga0207675_100011138 3300026118 Bacteria 8421
282 Ga0207675_100025565 3300026118 Bacteria 5495
283 Ga0207675_100063918 3300026118 Unclassified 3439
284 Ga0207675_100105774 3300026118 Unclassified 2652
285 Ga0207675_100256658 3300026118 Bacteria 1693
286 Ga0207675_100323734 3300026118 Bacteria 1505
287 Ga0207675_101069592 3300026118 Bacteria 826
288 Ga0207675_101919254 3300026118 Unclassified 610
289 Ga0207683_10041410 3300026121 Bacteria 4022
290 Ga0207698_10911406 3300026142 Bacteria 886
291 Ga0207698_11362692 3300026142 Unclassified 724
292 Ga0268265_10061489 3300028380 Unclassified 2882
293 Ga0268265_10180746 3300028380 Bacteria 1812
294 Ga0268265_10248971 3300028380 Bacteria 1573
295 Ga0268265_11481095 3300028380 Unclassified 682
296 Ga0268265_12040104 3300028380 Unclassified 581
297 Ga0268264_10023101 3300028381 Bacteria 5073
298 Ga0268264_10100626 3300028381 Bacteria 2511
299 Ga0268264_10139861 3300028381 Bacteria 2157
300 Ga0268264_10155426 3300028381 Unclassified 2055
301 Ga0268264_10188017 3300028381 Bacteria 1880
302 Ga0268264_10389107 3300028381 Bacteria 1337
303 Ga0268264_10522701 3300028381 Bacteria 1160
304 Ga0268264_10996276 3300028381 Unclassified 844
305 Ga0268264_11307220 3300028381 Bacteria 735
306 Ga0314311_1242495 3300030733 Unclassified 767
307 Ga0316182_1230593 3300030745 Unclassified 592
308 Ga0307412_11269487 3300031911 Unclassified 662
309 Ga0307416_100325088 3300032002 Bacteria 1542
310 Ga0307411_10534641 3300032005 Bacteria 997
311 Ga0307415_101787392 3300032126 Bacteria 594
312 Ga0373951_0000572 3300035091 Bacteria 10201
313 Ga0373962_0347040 3300035242 Unclassified 536
314 Ga0395901_0178095 3300038443 Unclassified 2230
315 Ga0439458_0005583 3300042157 Bacteria 2827
316 Ga0495610_0090872 3300046512 Bacteria 1384
317 Ga0495613_0129366 3300046689 Bacteria 1809
318 Ga0495674_0522350 3300047319 Unclassified 948
319 Ga0495684_0419847 3300047471 Unclassified 935
320 Ga0501298_012856 3300049521 Bacteria 1473
321 Ga0501217_072789 3300049661 Bacteria 938
322 Ga0501228_034174 3300049666 Bacteria 637
323 Ga0501249_015263 3300049679 Bacteria 1642
324 Ga0501261_023451 3300049690 Bacteria 898
325 Ga0501263_016332 3300049760 Bacteria 966
326 Ga0501268_014448 3300049765 Bacteria 1287
327 Ga0501212_012904 3300049851 Bacteria 1221
328 nmdc:mga05p37_1465259_c1 3300050507 Bacteria 682
329 nmdc:mga09592_997390_c1 3300050508 Bacteria 700
330 nmdc:mga08y16_26415_c1 3300050511 Bacteria 6123
331 nmdc:mga0n895_1147668_c1 3300050512 Unclassified 753
332 nmdc:mga0n895_427520_c1 3300050512 Unclassified 1338
333 Ga0070669_101016843
334 rootL2_10122102
335 Ga0065704_10566877
336 Ga0065715_10015010
337 Ga0065715_10026865
338 Ga0065715_10101226
339 Ga0065715_10244357
340 Ga0065715_10390263
341 Ga0065715_10508547
342 Ga0065707_10028647
343 Ga0065707_10089624
344 Ga0065707_10180752
345 Ga0070676_10606417
346 Ga0070690_100544079
347 Ga0070690_100897568
348 Ga0070670_100117942
349 Ga0070670_100909170
350 Ga0070670_101028902
351 Ga0070670_101052837
352 Ga0068869_100005136
353 Ga0068869_100118157
354 Ga0068869_100802759
355 Ga0070666_10086757
356 Ga0070680_100008331
357 Ga0070680_100289827
358 Ga0070682_100003984
359 Ga0068868_100023828
360 Ga0068868_101834412
361 Ga0070689_100000094
362 Ga0070689_100125646
363 Ga0070689_100139655
364 Ga0070689_100194872
365 Ga0070689_101186413
366 Ga0070689_102137066
367 Ga0070687_100039585
368 Ga0070687_100043022
369 Ga0070687_100468991
370 Ga0070661_100528347
371 Ga0070669_101309149
372 Ga0070671_100027076
373 Ga0070673_100239655
374 Ga0070673_100272641
375 Ga0070673_100803677
376 Ga0070673_100907543
377 Ga0070688_100071705
378 Ga0070667_100054403
379 Ga0070701_10093923
380 Ga0070701_10866494
381 Ga0070705_100120234
382 Ga0070700_100000043
383 Ga0070700_100011263
384 Ga0070700_100065938
385 Ga0070700_100776185
386 Ga0070694_100064044
387 Ga0070694_100217052
388 Ga0070694_100304479
389 Ga0070694_100467390
390 Ga0070694_100820623
391 Ga0070678_101074726
392 Ga0070678_101776253
393 Ga0068867_100162186
394 Ga0068867_100318507
395 Ga0068867_101052504
396 Ga0068867_101119587
397 Ga0070685_10051651
398 Ga0070685_10132673
399 Ga0070699_100015986
400 Ga0070697_100204977
401 Ga0068853_100030132
402 Ga0070686_100003286
403 Ga0070686_100283618
404 Ga0070695_100559745
405 Ga0070696_100007226
406 Ga0070696_100057217
407 Ga0070696_101159789
408 Ga0070693_100009681
409 Ga0070693_100353220
410 Ga0070693_100388626
411 Ga0070665_101148120
412 Ga0070704_100023543
413 Ga0070704_100334129
414 Ga0070704_100389761
415 Ga0070704_100572147
416 Ga0070704_101345665
417 Ga0070664_100799483
418 Ga0068857_100178043
419 Ga0068857_100875396
420 Ga0068854_100049790
421 Ga0068854_100066421
422 Ga0068854_100097458
423 Ga0068854_101715405
424 Ga0070702_100012181
425 Ga0070702_100019150
426 Ga0070702_100236741
427 Ga0068852_101243999
428 Ga0068859_100005034
429 Ga0068859_100062525
430 Ga0068859_100091834
431 Ga0068859_100097866
432 Ga0068859_100102554
433 Ga0068859_100269453
434 Ga0068859_100391484
435 Ga0068859_100625141
436 Ga0068859_100661322
437 Ga0068859_101179911
438 Ga0068864_100020964
439 Ga0068864_100022166
440 Ga0068864_100084861
441 Ga0068864_100163291
442 Ga0068864_100258043
443 Ga0068864_100516999
444 Ga0068866_10101979
445 Ga0068866_10673496
446 Ga0068861_100040143
447 Ga0068861_100207139
448 Ga0068861_100267117
449 Ga0068861_100521716
450 Ga0068861_101055653
451 Ga0068861_101810327
452 Ga0068870_10129622
453 Ga0068870_10141802
454 Ga0068870_10146887
455 Ga0068870_10348005
456 Ga0068863_100016139
457 Ga0068863_100142940
458 Ga0068863_100245557
459 Ga0068858_100062325
460 Ga0068858_101221740
461 Ga0068860_100010319
462 Ga0068860_100013707
463 Ga0068860_100217310
464 Ga0068860_100321671
465 Ga0068860_100584298
466 Ga0068860_100673495
467 Ga0068860_100863680
468 Ga0068862_100046276
469 Ga0068862_100056451
470 Ga0068862_100079390
471 Ga0068862_100340913
472 Ga0081539_10001281
473 Ga0097621_100005628
474 Ga0097621_100030336
475 Ga0068871_100032389
476 Ga0068871_100035289
477 Ga0068871_101304707
478 Ga0075428_100012313
479 Ga0075428_100189428
480 Ga0075434_101399596
481 Ga0075429_100347133
482 Ga0075429_100975198
483 Ga0068865_100030103
484 Ga0068865_100882502
485 Ga0097620_100005034
486 Ga0097620_100062526
487 Ga0097620_100091823
488 Ga0097620_100097862
489 Ga0097620_100102559
490 Ga0097620_100269439
491 Ga0097620_100391449
492 Ga0097620_100625152
493 Ga0097620_100661363
494 Ga0097620_101179900
495 Ga0105245_10771135
496 Ga0105245_11956417
497 Ga0105247_10047359
498 Ga0114129_11060957
499 Ga0114129_11093695
500 Ga0105243_10030218
501 Ga0105243_10081336
502 Ga0105243_10723556
503 Ga0105243_11494822
504 Ga0105242_10000515
505 Ga0105242_10012478
506 Ga0105242_10122119
507 Ga0105248_10026575
508 Ga0105248_10358392
509 Ga0105248_12959062
510 Ga0105238_10025620
511 Ga0105249_10284888
512 Ga0105249_10380388
513 Ga0105249_10486813
514 Ga0105239_10123217
515 Ga0105239_10324222
516 Ga0105246_10007264
517 Ga0105246_10184443
518 Ga0105246_10299127
519 Ga0157371_10471198
520 Ga0157378_10043905
521 Ga0157378_10389080
522 Ga0157378_10975615
523 Ga0163162_10307528
524 Ga0163162_10379962
525 Ga0163162_12030728
526 Ga0157375_13441994
527 Ga0163163_10008944
528 Ga0157380_10014503
529 Ga0157380_10018031
530 Ga0157380_10141287
531 Ga0157380_10376762
532 Ga0157380_10556720
533 Ga0157379_10003296
534 Ga0157379_11910427
535 Ga0157376_10014995
536 Ga0163161_10010833
537 Ga0163161_10722637
538 Ga0207642_10084045
539 Ga0207642_10169212
540 Ga0207710_10057344
541 Ga0207680_10178472
542 Ga0207647_10005457
543 Ga0207685_10399069
544 Ga0207645_10711617
545 Ga0207643_10001761
546 Ga0207643_10332929
547 Ga0207643_10378549
548 Ga0207654_10242703
549 Ga0207660_10424430
550 Ga0207662_10002960
551 Ga0207662_10099037
552 Ga0207662_10220725
553 Ga0207662_10413851
554 Ga0207681_10863672
555 Ga0207650_10509869
556 Ga0207644_10449291
557 Ga0207686_10000030
558 Ga0207686_10037962
559 Ga0207686_10189584
560 Ga0207709_10019103
561 Ga0207709_10893707
562 Ga0207709_11278330
563 Ga0207709_11495890
564 Ga0207670_10323041
565 Ga0207670_10330291
566 Ga0207669_11115248
567 Ga0207704_10132538
568 Ga0207691_10008343
569 Ga0207691_10071697
570 Ga0207711_10006429
571 Ga0207711_10247027
572 Ga0207711_10284721
573 Ga0207689_10022463
574 Ga0207689_10052593
575 Ga0207689_10185220
576 Ga0207689_10318422
577 Ga0207689_10627476
578 Ga0207689_11008494
579 Ga0207651_10467595
580 Ga0207651_10586160
581 Ga0207651_10942593
582 Ga0207712_10002858
583 Ga0207712_10137703
584 Ga0207712_10468100
585 Ga0207640_10024124
586 Ga0207640_10079967
587 Ga0207677_10081949
588 Ga0207677_10198736
589 Ga0207703_10092368
590 Ga0207703_10137401
591 Ga0207703_10379001
592 Ga0207639_10035253
593 Ga0207708_10000060
594 Ga0207708_10017610
595 Ga0207708_10030591
596 Ga0207708_10283980
597 Ga0207641_10100671
598 Ga0207641_10124384
599 Ga0207641_10700976
600 Ga0207641_10748013
601 Ga0207648_10024215
602 Ga0207648_10076550
603 Ga0207648_10100150
604 Ga0207648_10136906
605 Ga0207648_10503712
606 Ga0207676_10001399
607 Ga0207676_10023959
608 Ga0207676_10299821
609 Ga0207676_10924068
610 Ga0207674_10338699
611 Ga0207674_10813047
612 Ga0207674_11345680
613 Ga0207675_100011138
614 Ga0207675_100025565
615 Ga0207675_100063918
616 Ga0207675_100105774
617 Ga0207675_100256658
618 Ga0207675_100323734
619 Ga0207675_101069592
620 Ga0207675_101919254
621 Ga0207683_10041410
622 Ga0207698_10911406
623 Ga0207698_11362692
624 Ga0268265_10061489
625 Ga0268265_10180746
626 Ga0268265_10248971
627 Ga0268265_11481095
628 Ga0268265_12040104
629 Ga0268264_10023101
630 Ga0268264_10100626
631 Ga0268264_10139861
632 Ga0268264_10155426
633 Ga0268264_10188017
634 Ga0268264_10389107
635 Ga0268264_10522701
636 Ga0268264_10996276
637 Ga0268264_11307220
638 Ga0314311_1242495
639 Ga0316182_1230593
640 Ga0307412_11269487
641 Ga0307416_100325088
642 Ga0307411_10534641
643 Ga0307415_101787392
644 Ga0373951_0000572
645 Ga0373962_0347040
646 Ga0395901_0178095
647 Ga0439458_0005583
648 Ga0495610_0090872
649 Ga0495613_0129366
650 Ga0495674_0522350
651 Ga0495684_0419847
652 Ga0501298_012856
653 Ga0501217_072789
654 Ga0501228_034174
655 Ga0501249_015263
656 Ga0501261_023451
657 Ga0501263_016332
658 Ga0501268_014448
659 Ga0501212_012904
660 nmdc:mga05p37_1465259_c1
661 nmdc:mga09592_997390_c1
662 nmdc:mga08y16_26415_c1
663 nmdc:mga0n895_1147668_c1
664 nmdc:mga0n895_427520_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07606

DUF1569

Protein of unknown function (DUF1569)

38

183

0.75

PF12867

DinB_2

DinB superfamily

40

181

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.4975 1 146
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.4895 5 148
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.4648 11 147
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.4623 5 148
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.435 11 147
ID Description Score Start End Superfamily
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6103 3 146 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5878 11 146 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5873 3 146 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5603 11 147 1.20.120.450
af_O07256_17_140_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5492 11 146 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V7YYC4-F1-model_v4 DUF1569 domain-containing protein 0.9407 1 148
AF-A0A7W1ELI6-F1-model_v4 DUF1569 domain-containing protein 0.9382 1 148
AF-A0A2V8QVR3-F1-model_v4 DUF1569 domain-containing protein 0.9359 1 148
AF-A0A838NSX0-F1-model_v4 DinB family protein 0.9322 2 148
AF-A0A7W1ELI6-F1-model_v4 DUF1569 domain-containing protein 0.9322 1 148

Map