F410806

General Info

Members Datasets Scaffolds Average Seq Length
332 253 289 132

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100826364|Ga0070661_1008263642
Length 137
Sequence VVTSDACRYNVLLDLVTDDPVWADWSIQQLELASVSGPLCINDVVYAELSVRYERIEALDAFVDLAGLKLIPFPRAALFLAGKAFTRYRRGGGTRSGVLPDFFIGAHAAIQNLPLLTRDVARYRSYFPTVTLISPEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
4 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
5 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
6 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
7 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
8 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
9 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
10 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
11 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
12 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
13 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
14 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
15 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
16 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
17 2643221718 Rhizobium sp. Root268 Isolate Unclassified
18 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
19 2784132063 Pseudomonas sp. 424 Isolate Unclassified
20 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
21 2791355261 Rhizobium sp. J15 Isolate Nodule
22 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
23 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
24 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
25 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
26 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
27 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
28 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
29 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
30 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
31 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
32 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
33 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
34 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
35 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
36 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
37 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
38 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
39 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
40 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
41 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
42 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
147 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
148 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
149 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
150 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
244 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
247 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
253 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.45
Metatranscriptomes 0.6
Isolates 12.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.9
Bulb 0
Endosphere 11.75
Nodule 5.12
Rhizoplane 5.12
Rhizosphere 60.24
Stem 0
Stem Tuber 0
Unclassified 16.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3922674 2162886007 Bacteria 841
2 JGI25152J39213_1000966 3300002773 Bacteria 14034
3 rootH2_10122943 3300003320 Bacteria 3473
4 rootH1_10351475 3300003323 Bacteria 1210
5 JGI25160J50197_1033506 3300003354 Bacteria 1290
6 Ga0055524_1053669 3300003775 Unclassified 890
7 Ga0055528_1001600 3300003790 Bacteria 13383
8 Ga0058692_1009356 3300003856 Bacteria 2475
9 Ga0065704_10328940 3300005289 Bacteria 841
10 Ga0070661_100826364 3300005344 Bacteria 761
11 Ga0070671_100758832 3300005355 Unclassified 843
12 Ga0070659_100184851 3300005366 Bacteria 1711
13 Ga0070667_100161268 3300005367 Bacteria 1975
14 Ga0070709_10000379 3300005434 Bacteria 27481
15 Ga0070714_100082948 3300005435 Bacteria 2794
16 Ga0070713_100000086 3300005436 Bacteria 58784
17 Ga0070710_10366935 3300005437 Unclassified 957
18 Ga0070705_101507818 3300005440 Unclassified 563
19 Ga0070663_100430431 3300005455 Bacteria 1084
20 Ga0070662_100052650 3300005457 Bacteria 2944
21 Ga0070681_10000068 3300005458 Bacteria 75693
22 Ga0070699_100481621 3300005518 Bacteria 1126
23 Ga0070679_100004992 3300005530 Bacteria 12242
24 Ga0070695_100438449 3300005545 Bacteria 998
25 Ga0070696_100226424 3300005546 Bacteria 1405
26 Ga0070693_100397273 3300005547 Bacteria 955
27 Ga0068856_100000156 3300005614 Bacteria 70385
28 Ga0070702_101501007 3300005615 Unclassified 554
29 Ga0068864_100178701 3300005618 Bacteria 1939
30 Ga0068860_100172713 3300005843 Bacteria 2088
31 Ga0075365_10005772 3300006038 Bacteria 6720
32 Ga0075363_100474172 3300006048 Bacteria 741
33 Ga0075364_10006533 3300006051 Bacteria 6857
34 Ga0070716_100017717 3300006173 Bacteria 3698
35 Ga0070712_100000221 3300006175 Bacteria 32209
36 Ga0075369_10006780 3300006186 Bacteria 4343
37 Ga0075369_10157514 3300006186 Bacteria 1040
38 Ga0075366_10054099 3300006195 Bacteria 2384
39 Ga0097621_101628205 3300006237 Unclassified 614
40 Ga0075370_10004071 3300006353 Bacteria 7034
41 Ga0075370_10536354 3300006353 Bacteria 707
42 Ga0068871_100175618 3300006358 Bacteria 1839
43 Ga0075434_100120107 3300006871 Bacteria 2643
44 Ga0075434_100160567 3300006871 Bacteria 2267
45 Ga0075436_100000365 3300006914 Bacteria 28906
46 Ga0075436_100132089 3300006914 Bacteria 1751
47 Ga0099826_10000146 3300006948 Bacteria 30119
48 Ga0105251_10054152 3300009011 Bacteria 1906
49 Ga0105244_10011992 3300009036 Bacteria 5154
50 Ga0105244_10344174 3300009036 Bacteria 687
51 Ga0105250_10586078 3300009092 Unclassified 515
52 Ga0105247_10149522 3300009101 Bacteria 1538
53 Ga0105241_10145665 3300009174 Bacteria 1932
54 Ga0105241_11366845 3300009174 Bacteria 677
55 Ga0105239_10165506 3300010375 Bacteria 2472
56 Ga0105239_10545667 3300010375 Bacteria 1320
57 Ga0105246_11215421 3300011119 Bacteria 694
58 Ga0157373_10001975 3300013100 Bacteria 15547
59 Ga0157371_10000409 3300013102 Bacteria 53288
60 Ga0157371_10256953 3300013102 Bacteria 1259
61 Ga0157370_10264213 3300013104 Bacteria 1590
62 Ga0157369_10007099 3300013105 Bacteria 12916
63 Ga0157369_10355198 3300013105 Bacteria 1522
64 Ga0157374_11122971 3300013296 Bacteria 807
65 Ga0157378_10378731 3300013297 Bacteria 1389
66 Ga0157372_10009011 3300013307 Bacteria 10606
67 Ga0163163_10737266 3300014325 Bacteria 1049
68 Ga0163163_11458871 3300014325 Unclassified 746
69 Ga0157379_10000713 3300014968 Bacteria 26943
70 Ga0157379_10065352 3300014968 Unclassified 3251
71 Ga0209129_1003664 3300025258 Bacteria 6541
72 Ga0209673_1001841 3300025273 Bacteria 17324
73 Ga0209025_1016031 3300025294 Bacteria 4461
74 Ga0209564_1002751 3300025295 Bacteria 13218
75 Ga0209050_1042906 3300025298 Bacteria 1229
76 Ga0209256_1004740 3300025299 Bacteria 8313
77 Ga0207426_1002054 3300025302 Bacteria 14010
78 Ga0207696_1000032 3300025711 Bacteria 380071
79 Ga0207655_1001218 3300025728 Bacteria 24789
80 Ga0207713_1033141 3300025735 Bacteria 2260
81 Ga0207710_10209656 3300025900 Bacteria 964
82 Ga0207699_10000392 3300025906 Bacteria 22743
83 Ga0207705_10790068 3300025909 Bacteria 737
84 Ga0207654_10083123 3300025911 Bacteria 1932
85 Ga0207654_10411287 3300025911 Bacteria 942
86 Ga0207707_10000002 3300025912 Bacteria 1142054
87 Ga0207693_10000150 3300025915 Bacteria 64061
88 Ga0207660_10002961 3300025917 Bacteria 11108
89 Ga0207652_10000240 3300025921 Bacteria 57130
90 Ga0207700_10000005 3300025928 Bacteria 394836
91 Ga0207664_10033583 3300025929 Bacteria 3943
92 Ga0207690_10274573 3300025932 Bacteria 1311
93 Ga0207706_10039662 3300025933 Bacteria 4175
94 Ga0207665_10033325 3300025939 Bacteria 3413
95 Ga0207658_10168689 3300025986 Bacteria 1801
96 Ga0207702_10000055 3300026078 Bacteria 136325
97 Ga0207676_10251196 3300026095 Bacteria 1592
98 Ga0209371_1000012 3300027312 Bacteria 748304
99 Ga0209371_1001574 3300027312 Bacteria 14958
100 Ga0209282_1000039 3300027666 Bacteria 128517
101 Ga0209282_1000154 3300027666 Bacteria 40042
102 Ga0265337_1080976 3300028556 Bacteria 888
103 Ga0268256_1000013 3300030500 Bacteria 752103
104 Ga0268256_1002243 3300030500 Bacteria 10118
105 Ga0316182_1404164 3300030745 Bacteria 3030
106 Ga0265760_10102232 3300031090 Bacteria 906
107 Ga0265320_10000214 3300031240 Bacteria 46846
108 Ga0265325_10010309 3300031241 Bacteria 5418
109 Ga0265339_10022871 3300031249 Bacteria 3616
110 Ga0265314_10399736 3300031711 Bacteria 743
111 Ga0373931_0028718 3300035691 Bacteria 2851
112 Ga0395899_0012075 3300037312 Bacteria 6616
113 Ga0395899_0056197 3300037312 Bacteria 2909
114 Ga0395900_0082075 3300037418 Bacteria 3312
115 Ga0395900_0120482 3300037418 Bacteria 2692
116 Ga0395898_0072405 3300037466 Bacteria 3329
117 Ga0395905_0288664 3300037471 Bacteria 1527
118 Ga0395905_0291432 3300037471 Bacteria 1519
119 Ga0395901_0245765 3300038443 Bacteria 1865
120 Ga0451833_0147979 3300041491 Bacteria 2195
121 Ga0451837_1783515 3300041494 Bacteria 4852
122 Ga0451841_0464076 3300041498 Bacteria 2446
123 Ga0451845_0914410 3300041501 Bacteria 14288
124 Ga0451846_49252 3300041502 Bacteria 1257
125 Ga0451847_0921096 3300041503 Bacteria 3927
126 Ga0451849_0272744 3300041505 Bacteria 5284
127 Ga0451851_1295868 3300041507 Bacteria 2353
128 Ga0451843_0072390 3300041509 Bacteria 12375
129 Ga0451843_0326286 3300041509 Bacteria 1906
130 Ga0451855_0234450 3300041511 Bacteria 1941
131 Ga0451853_1236246 3300041512 Bacteria 2963
132 Ga0453684_0348694 3300044712 Bacteria 1670
133 Ga0495617_040286 3300046452 Bacteria 1562
134 Ga0495592_0058412 3300046454 Bacteria 2845
135 Ga0495591_010975 3300046458 Bacteria 3460
136 Ga0495638_0002030 3300046460 Bacteria 17219
137 Ga0495638_0033794 3300046460 Bacteria 3268
138 Ga0495638_0231629 3300046460 Bacteria 1027
139 Ga0495653_0017928 3300046463 Bacteria 5756
140 Ga0495650_0034830 3300046471 Bacteria 2222
141 Ga0495605_0416827 3300046474 Bacteria 556
142 Ga0495584_0018183 3300046491 Bacteria 3574
143 Ga0495584_0142427 3300046491 Bacteria 1217
144 Ga0495585_0033009 3300046492 Bacteria 2932
145 Ga0495596_0414839 3300046500 Bacteria 525
146 Ga0495607_0008713 3300046501 Bacteria 6909
147 Ga0495607_0055117 3300046501 Bacteria 2288
148 Ga0495607_0079283 3300046501 Bacteria 1809
149 Ga0495607_0149082 3300046501 Bacteria 1199
150 Ga0495606_0053253 3300046507 Bacteria 2626
151 Ga0495606_0068798 3300046507 Bacteria 2239
152 Ga0495610_0001461 3300046512 Bacteria 20859
153 Ga0495610_0016478 3300046512 Bacteria 4251
154 Ga0495616_0031909 3300046513 Bacteria 2755
155 Ga0495616_0052647 3300046513 Bacteria 2026
156 Ga0495620_0010714 3300046515 Bacteria 4824
157 Ga0495620_0108679 3300046515 Bacteria 1100
158 Ga0495631_0049941 3300046518 Bacteria 1830
159 Ga0495632_0023452 3300046519 Bacteria 3295
160 Ga0495632_0041416 3300046519 Bacteria 2314
161 Ga0495637_0124820 3300046520 Bacteria 987
162 Ga0495643_0104014 3300046522 Bacteria 1452
163 Ga0495643_0186941 3300046522 Bacteria 1003
164 Ga0495644_0119124 3300046523 Bacteria 1003
165 Ga0495648_0018373 3300046524 Bacteria 4951
166 Ga0495648_0054284 3300046524 Bacteria 2421
167 Ga0495648_0060258 3300046524 Bacteria 2259
168 Ga0495666_0051788 3300046526 Bacteria 1971
169 Ga0495654_0088012 3300046530 Bacteria 1444
170 Ga0495587_0277995 3300046536 Bacteria 938
171 Ga0495598_0357422 3300046537 Bacteria 563
172 Ga0495609_0261767 3300046538 Bacteria 710
173 Ga0495597_0020290 3300046542 Bacteria 3096
174 Ga0495597_0029416 3300046542 Bacteria 2508
175 Ga0495645_0111275 3300046543 Bacteria 1937
176 Ga0495633_0057501 3300046558 Bacteria 1827
177 Ga0495668_0110235 3300046616 Bacteria 1505
178 Ga0495634_0044321 3300046642 Bacteria 3011
179 Ga0495611_0039293 3300046648 Bacteria 2106
180 Ga0495625_0079211 3300046660 Bacteria 2292
181 Ga0495625_0160658 3300046660 Bacteria 1505
182 Ga0495625_0164232 3300046660 Bacteria 1486
183 Ga0495635_0310301 3300046663 Bacteria 1057
184 Ga0495661_0051319 3300046665 Bacteria 2491
185 Ga0495661_0070002 3300046665 Bacteria 2054
186 Ga0495661_0081814 3300046665 Bacteria 1860
187 Ga0495588_0001174 3300046674 Bacteria 11271
188 Ga0495588_0002881 3300046674 Bacteria 7411
189 Ga0495588_0140597 3300046674 Bacteria 1275
190 Ga0495588_0689016 3300046674 Bacteria 534
191 Ga0495646_0034709 3300046680 Bacteria 3131
192 Ga0495613_0110818 3300046689 Bacteria 1977
193 Ga0495624_0002472 3300046690 Bacteria 14009
194 Ga0495670_0000886 3300046691 Bacteria 14510
195 Ga0495670_0100611 3300046691 Bacteria 1488
196 Ga0495671_0031680 3300046692 Bacteria 2703
197 Ga0495671_0059130 3300046692 Bacteria 1895
198 Ga0495671_0120394 3300046692 Bacteria 1281
199 Ga0495600_0086163 3300046809 Bacteria 2049
200 Ga0495660_0038671 3300046810 Bacteria 2651
201 Ga0495660_0058208 3300046810 Bacteria 2082
202 Ga0495604_0018427 3300047317 Bacteria 5590
203 Ga0495672_0003260 3300047320 Bacteria 14062
204 Ga0495676_0060391 3300047321 Bacteria 2971
205 Ga0495680_0079543 3300047322 Bacteria 2478
206 Ga0495683_0414481 3300047323 Bacteria 558
207 Ga0495677_0137697 3300047445 Bacteria 936
208 Ga0495679_016503 3300047446 Bacteria 2671
209 Ga0495673_0011498 3300047469 Bacteria 4756
210 Ga0495681_0005759 3300047470 Bacteria 8240
211 Ga0495681_0008178 3300047470 Bacteria 6584
212 Ga0495681_0029883 3300047470 Bacteria 2782
213 Ga0495681_0105076 3300047470 Bacteria 1229
214 Ga0495684_0052802 3300047471 Bacteria 3101
215 Ga0495686_0016567 3300047472 Bacteria 4996
216 Ga0495593_0152951 3300047673 Bacteria 1166
217 Ga0495602_0061032 3300048088 Bacteria 3281
218 Ga0496101_0659915 3300048904 Unclassified 826
219 Ga0496102_0102473 3300048905 Bacteria 2661
220 Ga0496103_0353296 3300048906 Bacteria 945
221 Ga0496103_0771876 3300048906 Unclassified 607
222 Ga0496104_0797515 3300048907 Bacteria 851
223 Ga0496104_1866015 3300048907 Unclassified 503
224 Ga0496106_0981968 3300048909 Unclassified 665
225 Ga0496107_0336106 3300048910 Bacteria 1124
226 Ga0496108_0852973 3300048911 Unclassified 784
227 Ga0496111_0616584 3300048914 Bacteria 793
228 Ga0496113_0306491 3300048916 Bacteria 1272
229 Ga0496114_0202939 3300048917 Bacteria 1737
230 Ga0496116_0008233 3300048919 Bacteria 9086
231 Ga0496116_0013548 3300048919 Bacteria 6562
232 Ga0496116_0041151 3300048919 Bacteria 3173
233 Ga0496116_0092349 3300048919 Bacteria 1836
234 Ga0496116_0364332 3300048919 Unclassified 655
235 Ga0496117_0067469 3300048920 Bacteria 2420
236 Ga0496117_0122802 3300048920 Bacteria 1592
237 Ga0496117_0271651 3300048920 Bacteria 913
238 Ga0496118_0067515 3300048921 Bacteria 2602
239 Ga0496119_0002307 3300048922 Bacteria 21054
240 Ga0496119_0039189 3300048922 Bacteria 3048
241 Ga0496119_0046351 3300048922 Bacteria 2715
242 Ga0496119_0156361 3300048922 Unclassified 1217
243 Ga0496120_0034700 3300048923 Bacteria 3019
244 Ga0496120_0438326 3300048923 Bacteria 571
245 Ga0496121_0001551 3300048924 Bacteria 38450
246 Ga0496121_0038476 3300048924 Bacteria 4235
247 Ga0496121_0258479 3300048924 Bacteria 1204
248 Ga0496121_0708954 3300048924 Unclassified 604
249 Ga0496124_0096431 3300048927 Bacteria 2402
250 Ga0496124_0112369 3300048927 Bacteria 2190
251 Ga0496124_0199272 3300048927 Bacteria 1524
252 Ga0496124_0269752 3300048927 Bacteria 1247
253 Ga0496125_0005217 3300048928 Bacteria 14578
254 Ga0496125_0026152 3300048928 Bacteria 5329
255 Ga0496125_0053103 3300048928 Bacteria 3326
256 Ga0496125_0279016 3300048928 Unclassified 1036
257 Ga0495678_010532 3300049459 Bacteria 4489
258 Ga0495678_052668 3300049459 Bacteria 1566
259 Ga0501033_0000380 3300049570 Bacteria 42699
260 Ga0501033_0899369 3300049570 Bacteria 595
261 Ga0501047_0000456 3300049581 Bacteria 45191
262 Ga0501047_0662263 3300049581 Bacteria 863
263 Ga0501072_0692833 3300049588 Unclassified 801
264 Ga0501035_0003046 3300049822 Bacteria 16081
265 nmdc:mga03n38_297745_c1 3300050490 Bacteria 865
266 nmdc:mga00v17_4559_c1 3300050491 Bacteria 7221
267 nmdc:mga0yw44_6433_c1 3300050492 Bacteria 5678
268 nmdc:mga0k408_18763_c1 3300050493 Bacteria 3863
269 nmdc:mga07m45_291500_c1 3300050496 Bacteria 949
270 nmdc:mga07m45_3616_c1 3300050496 Bacteria 7472
271 nmdc:mga0n895_1242437_c1 3300050512 Bacteria 718
272 nmdc:mga0n895_168974_c1 3300050512 Bacteria 2219
273 nmdc:mga08x19_111679_c1 3300050514 Bacteria 1824
274 nmdc:mga08x19_51_c1 3300050514 Bacteria 124093
275 nmdc:mga0sz30_1264_c2 3300050516 Bacteria 8677
276 nmdc:mga0sz30_25437_c2 3300050516 Bacteria 1178
277 Ga0500647_0276630 3300053091 Bacteria 727
278 Ga0500560_000014 3300053107 Bacteria 24771
279 Ga0500560_041164 3300053107 Bacteria 1449
280 Ga0500594_0012698 3300053118 Bacteria 1991
281 Ga0500568_0378855 3300053139 Bacteria 513
282 Ga0500588_0000224 3300053146 Bacteria 7996
283 Ga0500606_154302 3300053152 Bacteria 742
284 Ga0500622_0000316 3300053156 Bacteria 48869
285 Ga0500622_0009690 3300053156 Bacteria 5322
286 Ga0500627_0347211 3300053158 Bacteria 640
287 Ga0500634_0000106 3300053161 Bacteria 31561
288 Ga0500634_0183798 3300053161 Bacteria 937
289 Ga0501084_1194393 3300054114 Unclassified 638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0291432 Ga0395905_0291432_27_461 108
2 3300027666 Ga0209282_1000039 Ga0209282_1000039103 110
3 3300048928 Ga0496125_0053103 Ga0496125_0053103_2295_2633 110
4 3300005455 Ga0070663_100430431 Ga0070663_1004304312 112
5 3300046692 Ga0495671_0120394 Ga0495671_0120394_450_788 112
6 3300047470 Ga0495681_0008178 Ga0495681_0008178_3452_3790 112
7 iso_pu_bacteria 2818991461 2819684537 122
8 iso_pu_bacteria 2871495908 2871499991 128
9 iso_pu_bacteria 2878760144 2878764134 128
10 iso_pu_bacteria 2878767105 2878771182 128
11 iso_pu_bacteria 2903540706 2903544803 128
12 iso_pu_bacteria 2582581298 2585226714 129
13 iso_pu_bacteria 2585427529 2585550129 129
14 iso_pu_bacteria 2599185300 2599934105 129
15 iso_pu_bacteria 2599185317 2600029622 129
16 iso_pu_bacteria 2600254930 2600358300 129
17 iso_pu_bacteria 2667528176 2671127893 129
18 iso_pu_bacteria 2784132063 2784260416 129
19 iso_pu_bacteria 2929144301 2929145387 129
20 iso_pu_bacteria 2509276033 2509442113 130
21 iso_pu_bacteria 2510461069 2510841393 130
22 iso_pu_bacteria 2513237162 2514024760 130
23 iso_pu_bacteria 2515154113 2515639634 130
24 iso_pu_bacteria 2515154116 2515661885 130
25 iso_pu_bacteria 2582581283 2585169038 130
26 iso_pu_bacteria 2582581294 2585205817 130
27 iso_pu_bacteria 2585427594 2585843745 130
28 iso_pu_bacteria 2599185236 2599719121 130
29 iso_pu_bacteria 2643221637 2644210735 130
30 iso_pu_bacteria 2643221718 2644654269 130
31 iso_pu_bacteria 2791355259 2793315178 130
32 iso_pu_bacteria 2791355261 2793331153 130
33 iso_pu_bacteria 2818991439 2819562080 130
34 iso_pu_bacteria 2821123053 2821129851 130
35 iso_pu_bacteria 2841859092 2841864157 130
36 iso_pu_bacteria 2842515876 2842520939 130
37 iso_pu_bacteria 2857531043 2857537714 130
38 iso_pu_bacteria 2899845264 2899848464 130
39 iso_pu_bacteria 2933011516 2933016448 130
40 iso_pu_bacteria 2933594066 2933596157 130
41 iso_pu_bacteria 2979089926 2979089954 130
42 iso_pu_bacteria 2979095461 2979095490 130
43 iso_pu_bacteria 2979100975 2979100987 130
44 iso_pu_bacteria 2984509177 2984511055 130
45 iso_pu_bacteria 2984518228 2984518243 130
46 iso_pu_bacteria 2984537506 2984539407 130
47 iso_pu_bacteria 3002141150 3002142091 130
48 iso_pu_bacteria 8002285264 8002286752 130
49 iso_pu_bacteria 8054002106 8054009192 130
50 3300005367 Ga0070667_100161268 Ga0070667_1001612682 132
51 3300005434 Ga0070709_10000379 Ga0070709_1000037929 132
52 3300005435 Ga0070714_100082948 Ga0070714_1000829485 132
53 3300005436 Ga0070713_100000086 Ga0070713_10000008645 132
54 3300005437 Ga0070710_10366935 Ga0070710_103669352 132
55 3300005440 Ga0070705_101507818 Ga0070705_1015078181 132
56 3300005458 Ga0070681_10000068 Ga0070681_1000006866 132
57 3300005518 Ga0070699_100481621 Ga0070699_1004816211 132
58 3300005530 Ga0070679_100004992 Ga0070679_10000499211 132
59 3300005545 Ga0070695_100438449 Ga0070695_1004384492 132
60 3300005546 Ga0070696_100226424 Ga0070696_1002264243 132
61 3300005547 Ga0070693_100397273 Ga0070693_1003972731 132
62 3300005614 Ga0068856_100000156 Ga0068856_10000015646 132
63 3300005615 Ga0070702_101501007 Ga0070702_1015010071 132
64 3300005618 Ga0068864_100178701 Ga0068864_1001787013 132
65 3300005843 Ga0068860_100172713 Ga0068860_1001727132 132
66 3300006173 Ga0070716_100017717 Ga0070716_1000177175 132
67 3300006175 Ga0070712_100000221 Ga0070712_10000022132 132
68 3300006237 Ga0097621_101628205 Ga0097621_1016282052 132
69 3300006358 Ga0068871_100175618 Ga0068871_1001756181 132
70 3300006871 Ga0075434_100120107 Ga0075434_1001201072 132
71 3300006871 Ga0075434_100160567 Ga0075434_1001605673 132
72 3300006914 Ga0075436_100000365 Ga0075436_10000036520 132
73 3300006914 Ga0075436_100132089 Ga0075436_1001320893 132
74 3300009101 Ga0105247_10149522 Ga0105247_101495223 132
75 3300009174 Ga0105241_10145665 Ga0105241_101456652 132
76 3300009174 Ga0105241_11366845 Ga0105241_113668452 132
77 3300010375 Ga0105239_10165506 Ga0105239_101655064 132
78 3300010375 Ga0105239_10545667 Ga0105239_105456671 132
79 3300013296 Ga0157374_11122971 Ga0157374_111229711 132
80 3300013297 Ga0157378_10378731 Ga0157378_103787313 132
81 3300014325 Ga0163163_10737266 Ga0163163_107372662 132
82 3300014968 Ga0157379_10000713 Ga0157379_1000071311 132
83 3300014968 Ga0157379_10065352 Ga0157379_100653524 132
84 3300025900 Ga0207710_10209656 Ga0207710_102096562 132
85 3300025906 Ga0207699_10000392 Ga0207699_1000039231 132
86 3300025911 Ga0207654_10083123 Ga0207654_100831232 132
87 3300025911 Ga0207654_10411287 Ga0207654_104112872 132
88 3300025912 Ga0207707_10000002 Ga0207707_100000021088 132
89 3300025915 Ga0207693_10000150 Ga0207693_1000015037 132
90 3300025917 Ga0207660_10002961 Ga0207660_100029618 132
91 3300025921 Ga0207652_10000240 Ga0207652_1000024048 132
92 3300025928 Ga0207700_10000005 Ga0207700_10000005364 132
93 3300025929 Ga0207664_10033583 Ga0207664_100335835 132
94 3300025939 Ga0207665_10033325 Ga0207665_100333255 132
95 3300025986 Ga0207658_10168689 Ga0207658_101686893 132
96 3300026078 Ga0207702_10000055 Ga0207702_1000005569 132
97 3300026095 Ga0207676_10251196 Ga0207676_102511963 132
98 3300028556 Ga0265337_1080976 Ga0265337_10809762 132
99 3300031090 Ga0265760_10102232 Ga0265760_101022322 132
100 3300031240 Ga0265320_10000214 Ga0265320_1000021431 132
101 3300031241 Ga0265325_10010309 Ga0265325_100103094 132
102 3300031249 Ga0265339_10022871 Ga0265339_100228713 132
103 3300031711 Ga0265314_10399736 Ga0265314_103997362 132
104 3300035691 Ga0373931_0028718 Ga0373931_0028718_524_922 132
105 3300037312 Ga0395899_0012075 Ga0395899_0012075_4825_5223 132
106 3300037312 Ga0395899_0056197 Ga0395899_0056197_156_554 132
107 3300037418 Ga0395900_0082075 Ga0395900_0082075_2708_3106 132
108 3300037418 Ga0395900_0120482 Ga0395900_0120482_170_568 132
109 3300037466 Ga0395898_0072405 Ga0395898_0072405_679_1077 132
110 3300037471 Ga0395905_0288664 Ga0395905_0288664_859_1257 132
111 3300038443 Ga0395901_0245765 Ga0395901_0245765_1133_1531 132
112 3300048906 Ga0496103_0353296 Ga0496103_0353296_382_780 132
113 3300048914 Ga0496111_0616584 Ga0496111_0616584_17_415 132
114 3300048919 Ga0496116_0092349 Ga0496116_0092349_601_999 132
115 3300048927 Ga0496124_0269752 Ga0496124_0269752_243_641 132
116 3300048928 Ga0496125_0005217 Ga0496125_0005217_6394_6792 132
117 3300049581 Ga0501047_0000456 Ga0501047_0000456_15666_16070 132
118 3300049581 Ga0501047_0662263 Ga0501047_0662263_378_776 132
119 3300049588 Ga0501072_0692833 Ga0501072_0692833_189_596 132
120 3300050512 nmdc:mga0n895_1242437_c1 nmdc:mga0n895_1242437_c1_10_408 132
121 3300050512 nmdc:mga0n895_168974_c1 nmdc:mga0n895_168974_c1_610_1008 132
122 3300050514 nmdc:mga08x19_111679_c1 nmdc:mga08x19_111679_c1_409_807 132
123 3300050514 nmdc:mga08x19_51_c1 nmdc:mga08x19_51_c1_76681_77079 132
124 3300053146 Ga0500588_0000224 Ga0500588_0000224_572_970 132
125 3300054114 Ga0501084_1194393 Ga0501084_1194393_189_596 132
126 3300003323 rootH1_10351475 rootH1_103514752 133
127 3300005366 Ga0070659_100184851 Ga0070659_1001848512 133
128 3300005457 Ga0070662_100052650 Ga0070662_1000526502 133
129 3300009011 Ga0105251_10054152 Ga0105251_100541523 133
130 3300009036 Ga0105244_10011992 Ga0105244_100119923 133
131 3300013100 Ga0157373_10001975 Ga0157373_100019756 133
132 3300013102 Ga0157371_10256953 Ga0157371_102569532 133
133 3300013104 Ga0157370_10264213 Ga0157370_102642132 133
134 3300013105 Ga0157369_10355198 Ga0157369_103551982 133
135 3300013307 Ga0157372_10009011 Ga0157372_100090115 133
136 3300025711 Ga0207696_1000032 Ga0207696_1000032197 133
137 3300025728 Ga0207655_1001218 Ga0207655_100121810 133
138 3300025735 Ga0207713_1033141 Ga0207713_10331413 133
139 3300025932 Ga0207690_10274573 Ga0207690_102745732 133
140 3300025933 Ga0207706_10039662 Ga0207706_100396622 133
141 3300046452 Ga0495617_040286 Ga0495617_040286_789_1190 133
142 3300046454 Ga0495592_0058412 Ga0495592_0058412_2104_2505 133
143 3300046458 Ga0495591_010975 Ga0495591_010975_1634_2035 133
144 3300046460 Ga0495638_0002030 Ga0495638_0002030_473_874 133
145 3300046460 Ga0495638_0033794 Ga0495638_0033794_2363_2764 133
146 3300046460 Ga0495638_0231629 Ga0495638_0231629_148_549 133
147 3300046463 Ga0495653_0017928 Ga0495653_0017928_4755_5156 133
148 3300046471 Ga0495650_0034830 Ga0495650_0034830_534_935 133
149 3300046474 Ga0495605_0416827 Ga0495605_0416827_144_545 133
150 3300046491 Ga0495584_0018183 Ga0495584_0018183_2687_3088 133
151 3300046491 Ga0495584_0142427 Ga0495584_0142427_90_491 133
152 3300046492 Ga0495585_0033009 Ga0495585_0033009_404_805 133
153 3300046501 Ga0495607_0008713 Ga0495607_0008713_2896_3297 133
154 3300046501 Ga0495607_0079283 Ga0495607_0079283_530_931 133
155 3300046501 Ga0495607_0149082 Ga0495607_0149082_435_836 133
156 3300046507 Ga0495606_0053253 Ga0495606_0053253_394_795 133
157 3300046512 Ga0495610_0016478 Ga0495610_0016478_415_816 133
158 3300046513 Ga0495616_0031909 Ga0495616_0031909_1963_2364 133
159 3300046513 Ga0495616_0052647 Ga0495616_0052647_1211_1612 133
160 3300046515 Ga0495620_0010714 Ga0495620_0010714_3858_4259 133
161 3300046515 Ga0495620_0108679 Ga0495620_0108679_96_497 133
162 3300046519 Ga0495632_0023452 Ga0495632_0023452_2088_2489 133
163 3300046519 Ga0495632_0041416 Ga0495632_0041416_1416_1817 133
164 3300046520 Ga0495637_0124820 Ga0495637_0124820_463_864 133
165 3300046522 Ga0495643_0104014 Ga0495643_0104014_205_606 133
166 3300046522 Ga0495643_0186941 Ga0495643_0186941_127_528 133
167 3300046523 Ga0495644_0119124 Ga0495644_0119124_279_680 133
168 3300046524 Ga0495648_0054284 Ga0495648_0054284_400_801 133
169 3300046524 Ga0495648_0060258 Ga0495648_0060258_461_862 133
170 3300046526 Ga0495666_0051788 Ga0495666_0051788_1223_1624 133
171 3300046530 Ga0495654_0088012 Ga0495654_0088012_839_1240 133
172 3300046536 Ga0495587_0277995 Ga0495587_0277995_277_678 133
173 3300046537 Ga0495598_0357422 Ga0495598_0357422_149_550 133
174 3300046538 Ga0495609_0261767 Ga0495609_0261767_283_684 133
175 3300046542 Ga0495597_0020290 Ga0495597_0020290_371_772 133
176 3300046542 Ga0495597_0029416 Ga0495597_0029416_263_664 133
177 3300046543 Ga0495645_0111275 Ga0495645_0111275_1241_1642 133
178 3300046616 Ga0495668_0110235 Ga0495668_0110235_376_777 133
179 3300046642 Ga0495634_0044321 Ga0495634_0044321_2157_2558 133
180 3300046648 Ga0495611_0039293 Ga0495611_0039293_360_761 133
181 3300046660 Ga0495625_0079211 Ga0495625_0079211_514_915 133
182 3300046660 Ga0495625_0160658 Ga0495625_0160658_510_911 133
183 3300046663 Ga0495635_0310301 Ga0495635_0310301_553_954 133
184 3300046665 Ga0495661_0070002 Ga0495661_0070002_256_657 133
185 3300046665 Ga0495661_0081814 Ga0495661_0081814_1283_1684 133
186 3300046674 Ga0495588_0140597 Ga0495588_0140597_360_761 133
187 3300046680 Ga0495646_0034709 Ga0495646_0034709_2302_2703 133
188 3300046689 Ga0495613_0110818 Ga0495613_0110818_1193_1594 133
189 3300046690 Ga0495624_0002472 Ga0495624_0002472_626_1027 133
190 3300046691 Ga0495670_0000886 Ga0495670_0000886_2759_3160 133
191 3300046691 Ga0495670_0100611 Ga0495670_0100611_730_1131 133
192 3300046692 Ga0495671_0059130 Ga0495671_0059130_305_706 133
193 3300046809 Ga0495600_0086163 Ga0495600_0086163_1148_1549 133
194 3300046810 Ga0495660_0038671 Ga0495660_0038671_2073_2474 133
195 3300046810 Ga0495660_0058208 Ga0495660_0058208_1234_1635 133
196 3300047317 Ga0495604_0018427 Ga0495604_0018427_4689_5090 133
197 3300047320 Ga0495672_0003260 Ga0495672_0003260_13008_13409 133
198 3300047321 Ga0495676_0060391 Ga0495676_0060391_400_801 133
199 3300047322 Ga0495680_0079543 Ga0495680_0079543_642_1043 133
200 3300047323 Ga0495683_0414481 Ga0495683_0414481_42_443 133
201 3300047445 Ga0495677_0137697 Ga0495677_0137697_424_825 133
202 3300047446 Ga0495679_016503 Ga0495679_016503_2136_2537 133
203 3300047469 Ga0495673_0011498 Ga0495673_0011498_3822_4223 133
204 3300047470 Ga0495681_0029883 Ga0495681_0029883_1988_2389 133
205 3300047470 Ga0495681_0105076 Ga0495681_0105076_234_635 133
206 3300047471 Ga0495684_0052802 Ga0495684_0052802_2256_2657 133
207 3300047673 Ga0495593_0152951 Ga0495593_0152951_516_917 133
208 3300048088 Ga0495602_0061032 Ga0495602_0061032_516_917 133
209 3300048919 Ga0496116_0041151 Ga0496116_0041151_518_919 133
210 3300048920 Ga0496117_0067469 Ga0496117_0067469_1578_1979 133
211 3300048921 Ga0496118_0067515 Ga0496118_0067515_624_1025 133
212 3300048922 Ga0496119_0046351 Ga0496119_0046351_1865_2266 133
213 3300048923 Ga0496120_0034700 Ga0496120_0034700_2225_2626 133
214 3300048924 Ga0496121_0038476 Ga0496121_0038476_2842_3243 133
215 3300048927 Ga0496124_0096431 Ga0496124_0096431_21_422 133
216 3300048927 Ga0496124_0112369 Ga0496124_0112369_1227_1628 133
217 3300049459 Ga0495678_052668 Ga0495678_052668_296_697 133
218 3300053091 Ga0500647_0276630 Ga0500647_0276630_287_688 133
219 3300053107 Ga0500560_000014 Ga0500560_000014_8602_9003 133
220 3300053139 Ga0500568_0378855 Ga0500568_0378855_97_498 133
221 3300053156 Ga0500622_0000316 Ga0500622_0000316_43535_43936 133
222 3300053158 Ga0500627_0347211 Ga0500627_0347211_50_451 133
223 3300053161 Ga0500634_0000106 Ga0500634_0000106_20562_20963 133
224 2162886007 SwRhRL2b_contig_3922674 SwRhRL2b_0624.00006910 134
225 3300002773 JGI25152J39213_1000966 JGI25152J39213_100096614 134
226 3300003320 rootH2_10122943 rootH2_101229432 134
227 3300003354 JGI25160J50197_1033506 JGI25160J50197_10335062 134
228 3300003775 Ga0055524_1053669 Ga0055524_10536692 134
229 3300003790 Ga0055528_1001600 Ga0055528_100160016 134
230 3300003856 Ga0058692_1009356 Ga0058692_10093563 134
231 3300005289 Ga0065704_10328940 Ga0065704_103289402 134
232 3300005344 Ga0070661_100826364 Ga0070661_1008263642 134
233 3300005355 Ga0070671_100758832 Ga0070671_1007588322 134
234 3300006038 Ga0075365_10005772 Ga0075365_100057725 134
235 3300006048 Ga0075363_100474172 Ga0075363_1004741722 134
236 3300006051 Ga0075364_10006533 Ga0075364_100065335 134
237 3300006186 Ga0075369_10006780 Ga0075369_100067805 134
238 3300006186 Ga0075369_10157514 Ga0075369_101575142 134
239 3300006195 Ga0075366_10054099 Ga0075366_100540994 134
240 3300006353 Ga0075370_10004071 Ga0075370_100040719 134
241 3300006353 Ga0075370_10536354 Ga0075370_105363542 134
242 3300006948 Ga0099826_10000146 Ga0099826_1000014615 134
243 3300009036 Ga0105244_10344174 Ga0105244_103441742 134
244 3300009092 Ga0105250_10586078 Ga0105250_105860782 134
245 3300011119 Ga0105246_11215421 Ga0105246_112154212 134
246 3300013102 Ga0157371_10000409 Ga0157371_1000040914 134
247 3300013105 Ga0157369_10007099 Ga0157369_1000709914 134
248 3300014325 Ga0163163_11458871 Ga0163163_114588712 134
249 3300025258 Ga0209129_1003664 Ga0209129_10036645 134
250 3300025273 Ga0209673_1001841 Ga0209673_100184114 134
251 3300025294 Ga0209025_1016031 Ga0209025_10160313 134
252 3300025295 Ga0209564_1002751 Ga0209564_100275115 134
253 3300025298 Ga0209050_1042906 Ga0209050_10429062 134
254 3300025299 Ga0209256_1004740 Ga0209256_10047408 134
255 3300025302 Ga0207426_1002054 Ga0207426_10020546 134
256 3300025909 Ga0207705_10790068 Ga0207705_107900682 134
257 3300027312 Ga0209371_1000012 Ga0209371_1000012676 134
258 3300027312 Ga0209371_1001574 Ga0209371_100157421 134
259 3300027666 Ga0209282_1000154 Ga0209282_100015433 134
260 3300030500 Ga0268256_1000013 Ga0268256_1000013677 134
261 3300030500 Ga0268256_1002243 Ga0268256_10022435 134
262 3300030745 Ga0316182_1404164 Ga0316182_14041645 134
263 3300041491 Ga0451833_0147979 Ga0451833_0147979_657_1061 134
264 3300041494 Ga0451837_1783515 Ga0451837_1783515_1570_1974 134
265 3300041498 Ga0451841_0464076 Ga0451841_0464076_947_1351 134
266 3300041501 Ga0451845_0914410 Ga0451845_0914410_12841_13245 134
267 3300041502 Ga0451846_49252 Ga0451846_49252_498_902 134
268 3300041503 Ga0451847_0921096 Ga0451847_0921096_3507_3911 134
269 3300041505 Ga0451849_0272744 Ga0451849_0272744_4720_5124 134
270 3300041507 Ga0451851_1295868 Ga0451851_1295868_1429_1833 134
271 3300041509 Ga0451843_0072390 Ga0451843_0072390_1606_2010 134
272 3300041509 Ga0451843_0326286 Ga0451843_0326286_269_673 134
273 3300041511 Ga0451855_0234450 Ga0451855_0234450_494_898 134
274 3300041512 Ga0451853_1236246 Ga0451853_1236246_1722_2126 134
275 3300044712 Ga0453684_0348694 Ga0453684_0348694_47_451 134
276 3300046500 Ga0495596_0414839 Ga0495596_0414839_29_433 134
277 3300046501 Ga0495607_0055117 Ga0495607_0055117_628_1032 134
278 3300046507 Ga0495606_0068798 Ga0495606_0068798_258_662 134
279 3300046512 Ga0495610_0001461 Ga0495610_0001461_16635_17039 134
280 3300046518 Ga0495631_0049941 Ga0495631_0049941_197_601 134
281 3300046524 Ga0495648_0018373 Ga0495648_0018373_698_1102 134
282 3300046558 Ga0495633_0057501 Ga0495633_0057501_381_785 134
283 3300046660 Ga0495625_0164232 Ga0495625_0164232_788_1192 134
284 3300046665 Ga0495661_0051319 Ga0495661_0051319_673_1077 134
285 3300046674 Ga0495588_0001174 Ga0495588_0001174_4394_4798 134
286 3300046674 Ga0495588_0002881 Ga0495588_0002881_141_545 134
287 3300046674 Ga0495588_0689016 Ga0495588_0689016_93_497 134
288 3300046692 Ga0495671_0031680 Ga0495671_0031680_135_539 134
289 3300047470 Ga0495681_0005759 Ga0495681_0005759_3531_3935 134
290 3300047472 Ga0495686_0016567 Ga0495686_0016567_1457_1861 134
291 3300048904 Ga0496101_0659915 Ga0496101_0659915_147_551 134
292 3300048905 Ga0496102_0102473 Ga0496102_0102473_726_1130 134
293 3300048906 Ga0496103_0771876 Ga0496103_0771876_98_502 134
294 3300048907 Ga0496104_0797515 Ga0496104_0797515_308_712 134
295 3300048907 Ga0496104_1866015 Ga0496104_1866015_76_480 134
296 3300048909 Ga0496106_0981968 Ga0496106_0981968_187_591 134
297 3300048910 Ga0496107_0336106 Ga0496107_0336106_416_820 134
298 3300048911 Ga0496108_0852973 Ga0496108_0852973_167_571 134
299 3300048916 Ga0496113_0306491 Ga0496113_0306491_320_724 134
300 3300048917 Ga0496114_0202939 Ga0496114_0202939_881_1285 134
301 3300048919 Ga0496116_0008233 Ga0496116_0008233_7391_7795 134
302 3300048919 Ga0496116_0013548 Ga0496116_0013548_213_617 134
303 3300048919 Ga0496116_0364332 Ga0496116_0364332_204_608 134
304 3300048920 Ga0496117_0122802 Ga0496117_0122802_257_661 134
305 3300048920 Ga0496117_0271651 Ga0496117_0271651_107_511 134
306 3300048922 Ga0496119_0002307 Ga0496119_0002307_1317_1721 134
307 3300048922 Ga0496119_0039189 Ga0496119_0039189_853_1257 134
308 3300048922 Ga0496119_0156361 Ga0496119_0156361_539_943 134
309 3300048923 Ga0496120_0438326 Ga0496120_0438326_82_486 134
310 3300048924 Ga0496121_0001551 Ga0496121_0001551_4510_4917 134
311 3300048924 Ga0496121_0258479 Ga0496121_0258479_362_766 134
312 3300048924 Ga0496121_0708954 Ga0496121_0708954_150_554 134
313 3300048927 Ga0496124_0199272 Ga0496124_0199272_318_722 134
314 3300048928 Ga0496125_0026152 Ga0496125_0026152_3334_3738 134
315 3300048928 Ga0496125_0279016 Ga0496125_0279016_222_626 134
316 3300049459 Ga0495678_010532 Ga0495678_010532_1269_1673 134
317 3300049570 Ga0501033_0000380 Ga0501033_0000380_1325_1729 134
318 3300049570 Ga0501033_0899369 Ga0501033_0899369_110_514 134
319 3300049822 Ga0501035_0003046 Ga0501035_0003046_14235_14639 134
320 3300050490 nmdc:mga03n38_297745_c1 nmdc:mga03n38_297745_c1_239_643 134
321 3300050491 nmdc:mga00v17_4559_c1 nmdc:mga00v17_4559_c1_4870_5274 134
322 3300050492 nmdc:mga0yw44_6433_c1 nmdc:mga0yw44_6433_c1_3821_4225 134
323 3300050493 nmdc:mga0k408_18763_c1 nmdc:mga0k408_18763_c1_964_1368 134
324 3300050496 nmdc:mga07m45_291500_c1 nmdc:mga07m45_291500_c1_389_793 134
325 3300050496 nmdc:mga07m45_3616_c1 nmdc:mga07m45_3616_c1_1454_1858 134
326 3300050516 nmdc:mga0sz30_1264_c2 nmdc:mga0sz30_1264_c2_1811_2215 134
327 3300050516 nmdc:mga0sz30_25437_c2 nmdc:mga0sz30_25437_c2_511_915 134
328 3300053107 Ga0500560_041164 Ga0500560_041164_916_1320 134
329 3300053118 Ga0500594_0012698 Ga0500594_0012698_388_792 134
330 3300053152 Ga0500606_154302 Ga0500606_154302_249_653 134
331 3300053156 Ga0500622_0009690 Ga0500622_0009690_1870_2280 134
332 3300053161 Ga0500634_0183798 Ga0500634_0183798_155_565 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

10

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.782 2 129
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.7767 2 131
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7757 1 131
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.762 2 131
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.7612 2 131
ID Description Score Start End Superfamily
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7847 3 116 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.782 2 129 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7759 2 131 3.40.50.1010
af_P9WF95_1_127_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7727 36 130 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7687 1 132 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A839ES33-F1-model_v4 Putative nucleic acid-binding protein 1.001 1 69
AF-A0A1G4S2G1-F1-model_v4 PIN domain-containing protein 0.9983 2 134 GO:0004518
GO:0046872
AF-A0A420CLA6-F1-model_v4 PIN domain-containing protein 0.9863 1 114 GO:0004518
GO:0046872
AF-A0A1J5SEP1-F1-model_v4 PIN domain-containing protein 0.9838 3 80
AF-A0A1G4S2G1-F1-model_v4 PIN domain-containing protein 0.9835 2 134 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map