F410701

General Info

Members Datasets Scaffolds Average Seq Length
331 177 331 164

Family's Representative Sequence

Representative Sequence 3300049689|Ga0501260_012076|Ga0501260_012076_273_755
Length 160
Sequence MATKGKIYTHLWYSEKADEAAKFYASIFPDSRVDRVTTMQSDSPTGPGGSVKVVDFTLLGQRFQAMTAGPHHDFNDAISIVVECDDQKELDRYWDALCEGGKPMACGWVTDRYGLRWQIVPAVMDKMMNEQDPARSKRVTDAMLKMKKFDIAALEKAYRG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
158 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
159 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.6
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10475256 3300005293 Bacteria 722
2 Ga0070683_100686537 3300005329 Bacteria 980
3 Ga0070690_100368467 3300005330 Bacteria 1047
4 Ga0070690_100472400 3300005330 Bacteria 933
5 Ga0070670_100090466 3300005331 Bacteria 2630
6 Ga0070677_10415161 3300005333 Bacteria 712
7 Ga0068869_100030606 3300005334 Bacteria 3780
8 Ga0068869_100204021 3300005334 Bacteria 1560
9 Ga0068869_100216889 3300005334 Bacteria 1515
10 Ga0068869_100556365 3300005334 Bacteria 964
11 Ga0068868_100068435 3300005338 Bacteria 2827
12 Ga0068868_100248663 3300005338 Bacteria 1496
13 Ga0070689_100094593 3300005340 Bacteria 2359
14 Ga0070689_100219194 3300005340 Unclassified 1560
15 Ga0070689_100241344 3300005340 Bacteria 1488
16 Ga0070689_100585950 3300005340 Bacteria 965
17 Ga0070689_100597923 3300005340 Bacteria 955
18 Ga0070687_100045136 3300005343 Bacteria 2248
19 Ga0070687_100147979 3300005343 Bacteria 1375
20 Ga0070687_100205091 3300005343 Bacteria 1197
21 Ga0070687_100295099 3300005343 Bacteria 1026
22 Ga0070661_100739607 3300005344 Bacteria 804
23 Ga0070692_10003273 3300005345 Bacteria 6533
24 Ga0070675_100083855 3300005354 Bacteria 2661
25 Ga0070671_100610083 3300005355 Bacteria 943
26 Ga0070674_101072094 3300005356 Unclassified 710
27 Ga0070673_100114656 3300005364 Bacteria 2240
28 Ga0070673_100290306 3300005364 Bacteria 1437
29 Ga0070673_100771890 3300005364 Bacteria 886
30 Ga0070688_100051918 3300005365 Unclassified 2559
31 Ga0070688_100239514 3300005365 Bacteria 1287
32 Ga0070688_100571394 3300005365 Bacteria 862
33 Ga0070688_101202590 3300005365 Bacteria 609
34 Ga0070667_100324438 3300005367 Bacteria 1390
35 Ga0070667_100897210 3300005367 Bacteria 825
36 Ga0070703_10073858 3300005406 Bacteria 1145
37 Ga0070701_10335149 3300005438 Bacteria 940
38 Ga0070701_10892550 3300005438 Bacteria 613
39 Ga0070700_100679120 3300005441 Unclassified 816
40 Ga0070700_101305729 3300005441 Bacteria 610
41 Ga0070694_100000132 3300005444 Bacteria 37067
42 Ga0070694_100018009 3300005444 Bacteria 4475
43 Ga0070694_100271900 3300005444 Bacteria 1289
44 Ga0070708_100024284 3300005445 Bacteria 5168
45 Ga0070708_100054741 3300005445 Bacteria 3545
46 Ga0070708_100926633 3300005445 Bacteria 818
47 Ga0070685_10004309 3300005466 Bacteria 7181
48 Ga0070685_10004448 3300005466 Bacteria 7088
49 Ga0070685_10833378 3300005466 Unclassified 682
50 Ga0070707_100355799 3300005468 Bacteria 1422
51 Ga0070698_100113069 3300005471 Bacteria 2680
52 Ga0070699_100889375 3300005518 Bacteria 816
53 Ga0070699_101674632 3300005518 Bacteria 583
54 Ga0070684_100626158 3300005535 Bacteria 1001
55 Ga0068853_100006311 3300005539 Bacteria 9407
56 Ga0068853_101089665 3300005539 Bacteria 770
57 Ga0070672_100122773 3300005543 Bacteria 2128
58 Ga0070672_100613630 3300005543 Bacteria 948
59 Ga0070672_100778274 3300005543 Bacteria 841
60 Ga0070686_100076310 3300005544 Bacteria 2207
61 Ga0070686_100396447 3300005544 Bacteria 1048
62 Ga0070686_100567126 3300005544 Bacteria 890
63 Ga0070695_100335846 3300005545 Bacteria 1128
64 Ga0070696_100035215 3300005546 Bacteria 3446
65 Ga0070665_100722424 3300005548 Bacteria 1009
66 Ga0070704_100193612 3300005549 Bacteria 1636
67 Ga0070704_100221176 3300005549 Bacteria 1540
68 Ga0070704_100515366 3300005549 Bacteria 1040
69 Ga0070704_100629452 3300005549 Bacteria 945
70 Ga0068856_100851088 3300005614 Bacteria 931
71 Ga0070702_101045603 3300005615 Bacteria 649
72 Ga0068859_100005427 3300005617 Bacteria 12966
73 Ga0068859_100411947 3300005617 Bacteria 1448
74 Ga0068864_100071631 3300005618 Bacteria 3019
75 Ga0068864_101068438 3300005618 Bacteria 802
76 Ga0068864_101815355 3300005618 Bacteria 615
77 Ga0068866_10492828 3300005718 Bacteria 809
78 Ga0068861_100234633 3300005719 Bacteria 1557
79 Ga0068861_100282394 3300005719 Bacteria 1430
80 Ga0068861_100994881 3300005719 Bacteria 800
81 Ga0068851_10872923 3300005834 Unclassified 562
82 Ga0068863_100616015 3300005841 Unclassified 1075
83 Ga0068862_100223861 3300005844 Bacteria 1704
84 Ga0068862_100320474 3300005844 Bacteria 1430
85 Ga0068862_100747045 3300005844 Bacteria 951
86 Ga0081455_10067355 3300005937 Bacteria 2984
87 Ga0097621_101304902 3300006237 Bacteria 686
88 Ga0068871_100156021 3300006358 Bacteria 1949
89 Ga0075428_100003491 3300006844 Bacteria 17218
90 Ga0075428_100142987 3300006844 Unclassified 2601
91 Ga0075428_100347938 3300006844 Bacteria 1591
92 Ga0075428_101111209 3300006844 Bacteria 835
93 Ga0075428_101126210 3300006844 Bacteria 828
94 Ga0075428_102017391 3300006844 Bacteria 598
95 Ga0075428_102089812 3300006844 Bacteria 586
96 Ga0075430_100115629 3300006846 Unclassified 2235
97 Ga0075430_100134196 3300006846 Bacteria 2063
98 Ga0075430_100511312 3300006846 Bacteria 991
99 Ga0075430_101249538 3300006846 Bacteria 611
100 Ga0075431_100019662 3300006847 Bacteria 6890
101 Ga0075431_100304508 3300006847 Bacteria 1610
102 Ga0075431_100653556 3300006847 Bacteria 1032
103 Ga0075433_10212570 3300006852 Bacteria 1718
104 Ga0075433_10250434 3300006852 Bacteria 1572
105 Ga0075433_10341299 3300006852 Bacteria 1324
106 Ga0075434_100030747 3300006871 Bacteria 5290
107 Ga0075429_100032626 3300006880 Bacteria 4526
108 Ga0075429_100358855 3300006880 Bacteria 1276
109 Ga0075429_100439572 3300006880 Bacteria 1143
110 Ga0075429_100704025 3300006880 Bacteria 885
111 Ga0097620_100005427 3300006931 Bacteria 12966
112 Ga0097620_100411952 3300006931 Bacteria 1448
113 Ga0075435_100056214 3300007076 Bacteria 3180
114 Ga0099794_10061369 3300007265 Bacteria 1826
115 Ga0099794_10305486 3300007265 Bacteria 824
116 Ga0111539_10177879 3300009094 Bacteria 2485
117 Ga0111539_10178155 3300009094 Unclassified 2483
118 Ga0111539_10240579 3300009094 Bacteria 2107
119 Ga0111539_10322578 3300009094 Bacteria 1797
120 Ga0111539_10524632 3300009094 Bacteria 1380
121 Ga0111539_10714610 3300009094 Bacteria 1166
122 Ga0111539_11450483 3300009094 Bacteria 796
123 Ga0105247_10490694 3300009101 Bacteria 893
124 Ga0114129_10015076 3300009147 Bacteria 11003
125 Ga0114129_10068208 3300009147 Bacteria 4959
126 Ga0114129_10076452 3300009147 Bacteria 4661
127 Ga0114129_10093636 3300009147 Bacteria 4162
128 Ga0114129_10614341 3300009147 Bacteria 1407
129 Ga0114129_10704109 3300009147 Bacteria 1298
130 Ga0105243_11384487 3300009148 Bacteria 723
131 Ga0105248_10000978 3300009177 Bacteria 31743
132 Ga0105248_10053033 3300009177 Unclassified 4550
133 Ga0105248_10143001 3300009177 Bacteria 2699
134 Ga0105248_11158809 3300009177 Bacteria 874
135 Ga0105249_10156197 3300009553 Bacteria 2200
136 Ga0105249_11440879 3300009553 Bacteria 761
137 Ga0099796_10279875 3300010159 Bacteria 701
138 Ga0163162_10022720 3300013306 Bacteria 6184
139 Ga0157375_10076678 3300013308 Bacteria 3371
140 Ga0157375_10349024 3300013308 Bacteria 1645
141 Ga0163163_10061912 3300014325 Bacteria 3708
142 Ga0163163_10077930 3300014325 Bacteria 3310
143 Ga0163163_11917518 3300014325 Bacteria 652
144 Ga0157380_10195056 3300014326 Bacteria 1792
145 Ga0157379_10192626 3300014968 Bacteria 1842
146 Ga0157376_10180063 3300014969 Bacteria 1931
147 Ga0157376_11648094 3300014969 Bacteria 676
148 Ga0207656_10563506 3300025321 Unclassified 581
149 Ga0207642_10396124 3300025899 Bacteria 825
150 Ga0207684_10407776 3300025910 Bacteria 1168
151 Ga0207660_11059970 3300025917 Bacteria 661
152 Ga0207662_10013691 3300025918 Bacteria 4539
153 Ga0207662_10660665 3300025918 Unclassified 731
154 Ga0207646_10297772 3300025922 Bacteria 1457
155 Ga0207681_10106245 3300025923 Bacteria 2034
156 Ga0207694_10466350 3300025924 Bacteria 1055
157 Ga0207644_10093586 3300025931 Bacteria 2244
158 Ga0207644_10696655 3300025931 Bacteria 847
159 Ga0207670_10013540 3300025936 Bacteria 4815
160 Ga0207670_10097529 3300025936 Bacteria 2093
161 Ga0207670_10102476 3300025936 Unclassified 2047
162 Ga0207670_10698899 3300025936 Bacteria 839
163 Ga0207670_11709235 3300025936 Bacteria 535
164 Ga0207669_10622185 3300025937 Bacteria 880
165 Ga0207691_10016482 3300025940 Bacteria 7014
166 Ga0207691_10406624 3300025940 Unclassified 1161
167 Ga0207711_10004125 3300025941 Bacteria 12453
168 Ga0207711_10068051 3300025941 Bacteria 3084
169 Ga0207711_10549986 3300025941 Bacteria 1077
170 Ga0207689_10109991 3300025942 Bacteria 2264
171 Ga0207689_10128196 3300025942 Bacteria 2087
172 Ga0207689_10168736 3300025942 Bacteria 1803
173 Ga0207679_10311597 3300025945 Bacteria 1360
174 Ga0207651_10191368 3300025960 Bacteria 1632
175 Ga0207651_10418084 3300025960 Bacteria 1144
176 Ga0207651_10463348 3300025960 Bacteria 1089
177 Ga0207651_10623280 3300025960 Bacteria 945
178 Ga0207677_10172285 3300026023 Bacteria 1694
179 Ga0207703_10056777 3300026035 Bacteria 3190
180 Ga0207639_10002611 3300026041 Bacteria 12088
181 Ga0207639_11404969 3300026041 Unclassified 655
182 Ga0207678_10900621 3300026067 Bacteria 782
183 Ga0207708_11220812 3300026075 Unclassified 658
184 Ga0207708_11261066 3300026075 Bacteria 647
185 Ga0207702_10565809 3300026078 Bacteria 1113
186 Ga0207641_10603437 3300026088 Unclassified 1075
187 Ga0207676_10129984 3300026095 Bacteria 2140
188 Ga0207676_11415460 3300026095 Bacteria 691
189 Ga0207674_10919112 3300026116 Bacteria 843
190 Ga0207675_100063516 3300026118 Bacteria 3450
191 Ga0207675_100077242 3300026118 Bacteria 3119
192 Ga0207675_100944187 3300026118 Bacteria 880
193 Ga0207675_102008045 3300026118 Bacteria 596
194 Ga0207683_10663820 3300026121 Bacteria 966
195 Ga0207698_10244523 3300026142 Bacteria 1638
196 Ga0207698_11644582 3300026142 Unclassified 658
197 Ga0209588_1232916 3300027671 Bacteria 567
198 Ga0207428_10111177 3300027907 Bacteria 2108
199 Ga0268265_10034008 3300028380 Bacteria 3712
200 Ga0268265_10412150 3300028380 Bacteria 1252
201 Ga0268265_10859886 3300028380 Bacteria 888
202 Ga0307410_10679316 3300031852 Bacteria 866
203 Ga0307406_10035562 3300031901 Bacteria 3065
204 Ga0307407_10503408 3300031903 Bacteria 888
205 Ga0307412_10011096 3300031911 Bacteria 5210
206 Ga0307412_11156370 3300031911 Unclassified 691
207 Ga0307409_100577133 3300031995 Bacteria 1108
208 Ga0307416_100139546 3300032002 Bacteria 2200
209 Ga0307414_11958156 3300032004 Bacteria 547
210 Ga0373929_0151530 3300035085 Bacteria 622
211 Ga0373934_0155046 3300035086 Bacteria 939
212 Ga0373956_0267251 3300035119 Bacteria 813
213 Ga0373943_0020620 3300035170 Bacteria 3041
214 Ga0373961_0355349 3300035241 Unclassified 553
215 Ga0373962_0164514 3300035242 Bacteria 734
216 Ga0373933_0110779 3300035724 Bacteria 1712
217 Ga0373925_0016228 3300037068 Bacteria 5390
218 Ga0436365_0858441 3300039437 Bacteria 2639
219 Ga0436363_0436253 3300039450 Bacteria 2878
220 Ga0436363_0552972 3300039450 Bacteria 848
221 Ga0451577_0122205 3300042876 Bacteria 2333
222 Ga0451577_0267816 3300042876 Bacteria 1547
223 Ga0453683_0005042 3300044673 Bacteria 9278
224 Ga0453683_0028088 3300044673 Bacteria 3564
225 Ga0453683_0457288 3300044673 Bacteria 826
226 Ga0453684_0000159 3300044712 Bacteria 300297
227 Ga0451576_0000120 3300045051 Bacteria 199365
228 Ga0451576_0004731 3300045051 Bacteria 17495
229 Ga0451576_0183851 3300045051 Bacteria 2182
230 Ga0451576_0667258 3300045051 Bacteria 1092
231 Ga0451576_0887916 3300045051 Bacteria 935
232 Ga0451576_2246775 3300045051 Bacteria 560
233 Ga0495592_0032454 3300046454 Bacteria 3939
234 Ga0495629_0000004 3300046459 Bacteria 433516
235 Ga0495582_0045386 3300046473 Bacteria 2420
236 Ga0495639_0000964 3300046475 Bacteria 12948
237 Ga0495639_0039610 3300046475 Unclassified 2119
238 Ga0495662_0064368 3300046476 Bacteria 1772
239 Ga0495662_0300322 3300046476 Unclassified 790
240 Ga0495594_0134087 3300046499 Bacteria 1403
241 Ga0495630_0267201 3300046517 Bacteria 1307
242 Ga0495630_0404300 3300046517 Bacteria 1046
243 Ga0495666_0007646 3300046526 Bacteria 5407
244 Ga0495586_0001253 3300046535 Bacteria 14237
245 Ga0495667_0494970 3300046559 Unclassified 766
246 Ga0495656_0553759 3300046615 Bacteria 613
247 Ga0495588_0080848 3300046674 Bacteria 1696
248 Ga0495647_0034716 3300046681 Bacteria 1890
249 Ga0495658_0014081 3300046683 Bacteria 4078
250 Ga0495658_0289979 3300046683 Bacteria 1034
251 Ga0495613_0199101 3300046689 Bacteria 1413
252 Ga0495670_0460047 3300046691 Bacteria 690
253 Ga0495581_0098484 3300047315 Bacteria 1698
254 Ga0495636_0283507 3300047318 Bacteria 772
255 Ga0495676_0128145 3300047321 Unclassified 1836
256 Ga0495680_0049389 3300047322 Bacteria 3295
257 Ga0495680_0865507 3300047322 Unclassified 586
258 Ga0495593_0262046 3300047673 Bacteria 865
259 Ga0495593_0302155 3300047673 Bacteria 800
260 Ga0496108_0165183 3300048911 Bacteria 1914
261 Ga0496109_0285608 3300048912 Bacteria 1555
262 Ga0501033_0468436 3300049570 Bacteria 874
263 Ga0501034_0497964 3300049571 Bacteria 1132
264 Ga0501034_0676813 3300049571 Bacteria 932
265 Ga0501036_1446672 3300049572 Bacteria 557
266 Ga0501039_0025679 3300049575 Bacteria 4528
267 Ga0501042_0821628 3300049578 Bacteria 676
268 Ga0501048_0240968 3300049582 Bacteria 1283
269 Ga0501068_0106823 3300049584 Bacteria 1738
270 Ga0501068_0341757 3300049584 Bacteria 961
271 Ga0501069_0011241 3300049585 Bacteria 4748
272 Ga0501069_0047562 3300049585 Unclassified 2381
273 Ga0501070_0000021 3300049586 Bacteria 168438
274 Ga0501070_0013331 3300049586 Bacteria 6932
275 Ga0501070_0482989 3300049586 Bacteria 996
276 Ga0501071_0041684 3300049587 Unclassified 3288
277 Ga0501072_0180903 3300049588 Bacteria 1682
278 Ga0501072_0862626 3300049588 Bacteria 708
279 Ga0501073_0036324 3300049589 Bacteria 3501
280 Ga0501074_0019969 3300049590 Bacteria 4869
281 Ga0501074_0058740 3300049590 Bacteria 2771
282 Ga0501074_0202997 3300049590 Bacteria 1413
283 Ga0501227_061922 3300049665 Bacteria 961
284 Ga0501233_112196 3300049668 Bacteria 730
285 Ga0501260_012076 3300049689 Bacteria 879
286 Ga0501225_0132020 3300049705 Bacteria 749
287 Ga0501080_0031185 3300049742 Bacteria 4967
288 Ga0501080_0119982 3300049742 Bacteria 2437
289 Ga0501080_0151993 3300049742 Bacteria 2139
290 Ga0501081_0038486 3300049743 Bacteria 3268
291 Ga0501081_0113312 3300049743 Bacteria 1926
292 Ga0501083_0006812 3300049744 Bacteria 8111
293 Ga0501083_0099832 3300049744 Bacteria 1914
294 Ga0501083_0118324 3300049744 Bacteria 1738
295 Ga0501045_0521798 3300049824 Bacteria 882
296 nmdc:mga05p37_1753677_c1 3300050507 Bacteria 602
297 nmdc:mga05p37_281535_c1 3300050507 Bacteria 1983
298 nmdc:mga05p37_36098_c1 3300050507 Bacteria 6064
299 nmdc:mga05p37_84176_c1 3300050507 Bacteria 3918
300 nmdc:mga09592_25036_c1 3300050508 Bacteria 4937
301 nmdc:mga09592_396475_c1 3300050508 Bacteria 840
302 nmdc:mga09592_423394_c1 3300050508 Bacteria 1150
303 nmdc:mga09592_929399_c1 3300050508 Bacteria 730
304 nmdc:mga0qj67_1087674_c1 3300050509 Bacteria 625
305 nmdc:mga0qj67_122880_c1 3300050509 Bacteria 2100
306 nmdc:mga0qj67_168902_c1 3300050509 Bacteria 1776
307 nmdc:mga0qj67_248645_c1 3300050509 Bacteria 1443
308 nmdc:mga0qj67_73877_c1 3300050509 Bacteria 2724
309 nmdc:mga0qj67_763716_c1 3300050509 Bacteria 766
310 nmdc:mga06r32_1093841_c1 3300050510 Bacteria 746
311 nmdc:mga06r32_144722_c1 3300050510 Bacteria 2354
312 nmdc:mga06r32_158987_c1 3300050510 Bacteria 2241
313 nmdc:mga06r32_56800_c1 3300050510 Bacteria 3758
314 nmdc:mga08y16_1176183_c1 3300050511 Bacteria 739
315 nmdc:mga08y16_189928_c1 3300050511 Unclassified 2131
316 nmdc:mga08y16_56726_c1 3300050511 Bacteria 4093
317 nmdc:mga08y16_785213_c1 3300050511 Bacteria 946
318 nmdc:mga0n895_80531_c1 3300050512 Bacteria 3245
319 nmdc:mga0rr50_128130_c1 3300050513 Bacteria 2029
320 nmdc:mga0rr50_396742_c1 3300050513 Bacteria 1165
321 nmdc:mga0rr50_818492_c1 3300050513 Bacteria 794
322 nmdc:mga0a205_341276_c1 3300050515 Bacteria 1366
323 nmdc:mga0a205_409426_c1 3300050515 Bacteria 1219
324 Ga0495619_0509448 3300053085 Bacteria 827
325 Ga0500566_0042855 3300053094 Bacteria 2609
326 Ga0501084_0193435 3300054114 Bacteria 1716
327 Ga0501082_0023748 3300060353 Bacteria 5286
328 Ga0501082_0065250 3300060353 Bacteria 3135
329 Ga0501082_0390440 3300060353 Bacteria 1214
330 Ga0530510_0000561 3300061734 Bacteria 23933
331 Ga0530510_0540022 3300061734 Bacteria 885

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100248663 Ga0068868_1002486632 155
2 3300005340 Ga0070689_100597923 Ga0070689_1005979231 155
3 3300005344 Ga0070661_100739607 Ga0070661_1007396071 155
4 3300005364 Ga0070673_100771890 Ga0070673_1007718901 155
5 3300005543 Ga0070672_100122773 Ga0070672_1001227735 155
6 3300005548 Ga0070665_100722424 Ga0070665_1007224241 155
7 3300006237 Ga0097621_101304902 Ga0097621_1013049022 155
8 3300009177 Ga0105248_10000978 Ga0105248_100009783 155
9 3300013306 Ga0163162_10022720 Ga0163162_100227206 155
10 3300013308 Ga0157375_10076678 Ga0157375_100766782 155
11 3300014968 Ga0157379_10192626 Ga0157379_101926262 155
12 3300025940 Ga0207691_10016482 Ga0207691_100164823 155
13 3300025941 Ga0207711_10004125 Ga0207711_100041253 155
14 3300025960 Ga0207651_10623280 Ga0207651_106232802 155
15 3300026067 Ga0207678_10900621 Ga0207678_109006212 155
16 3300031852 Ga0307410_10679316 Ga0307410_106793162 155
17 3300031901 Ga0307406_10035562 Ga0307406_100355622 155
18 3300031903 Ga0307407_10503408 Ga0307407_105034081 155
19 3300031911 Ga0307412_11156370 Ga0307412_111563701 155
20 3300032002 Ga0307416_100139546 Ga0307416_1001395462 155
21 3300048911 Ga0496108_0165183 Ga0496108_0165183_695_1183 155
22 3300048912 Ga0496109_0285608 Ga0496109_0285608_1015_1503 155
23 3300009094 Ga0111539_10240579 Ga0111539_102405793 156
24 3300026116 Ga0207674_10919112 Ga0207674_109191121 156
25 3300032004 Ga0307414_11958156 Ga0307414_119581561 156
26 3300005334 Ga0068869_100204021 Ga0068869_1002040212 157
27 3300005334 Ga0068869_100216889 Ga0068869_1002168892 157
28 3300005340 Ga0070689_100094593 Ga0070689_1000945933 157
29 3300005355 Ga0070671_100610083 Ga0070671_1006100831 157
30 3300005364 Ga0070673_100290306 Ga0070673_1002903062 157
31 3300005365 Ga0070688_100239514 Ga0070688_1002395142 157
32 3300005365 Ga0070688_100571394 Ga0070688_1005713942 157
33 3300005367 Ga0070667_100897210 Ga0070667_1008972101 157
34 3300005543 Ga0070672_100778274 Ga0070672_1007782741 157
35 3300005544 Ga0070686_100076310 Ga0070686_1000763102 157
36 3300005617 Ga0068859_100005427 Ga0068859_1000054276 157
37 3300005617 Ga0068859_100411947 Ga0068859_1004119472 157
38 3300005719 Ga0068861_100234633 Ga0068861_1002346331 157
39 3300005719 Ga0068861_100282394 Ga0068861_1002823942 157
40 3300005844 Ga0068862_100747045 Ga0068862_1007470451 157
41 3300006931 Ga0097620_100005427 Ga0097620_1000054276 157
42 3300006931 Ga0097620_100411952 Ga0097620_1004119521 157
43 3300009094 Ga0111539_10322578 Ga0111539_103225782 157
44 3300009094 Ga0111539_11450483 Ga0111539_114504832 157
45 3300009148 Ga0105243_11384487 Ga0105243_113844872 157
46 3300014325 Ga0163163_11917518 Ga0163163_119175181 157
47 3300025923 Ga0207681_10106245 Ga0207681_101062451 157
48 3300025931 Ga0207644_10696655 Ga0207644_106966552 157
49 3300025936 Ga0207670_11709235 Ga0207670_117092351 157
50 3300025942 Ga0207689_10109991 Ga0207689_101099912 157
51 3300025942 Ga0207689_10168736 Ga0207689_101687363 157
52 3300025960 Ga0207651_10463348 Ga0207651_104633482 157
53 3300026078 Ga0207702_10565809 Ga0207702_105658092 157
54 3300026118 Ga0207675_100063516 Ga0207675_1000635162 157
55 3300026118 Ga0207675_100077242 Ga0207675_1000772422 157
56 3300026121 Ga0207683_10663820 Ga0207683_106638202 157
57 3300026142 Ga0207698_11644582 Ga0207698_116445821 157
58 3300028380 Ga0268265_10412150 Ga0268265_104121501 157
59 3300035086 Ga0373934_0155046 Ga0373934_0155046_418_900 157
60 3300035724 Ga0373933_0110779 Ga0373933_0110779_734_1216 157
61 3300039437 Ga0436365_0858441 Ga0436365_0858441_698_1183 157
62 3300039450 Ga0436363_0552972 Ga0436363_0552972_218_703 157
63 3300044673 Ga0453683_0028088 Ga0453683_0028088_2117_2599 157
64 3300045051 Ga0451576_0183851 Ga0451576_0183851_575_1057 157
65 3300049665 Ga0501227_061922 Ga0501227_061922_201_683 157
66 3300049689 Ga0501260_012076 Ga0501260_012076_273_755 157
67 3300050511 nmdc:mga08y16_1176183_c1 nmdc:mga08y16_1176183_c1_133_615 157
68 3300050513 nmdc:mga0rr50_818492_c1 nmdc:mga0rr50_818492_c1_159_641 157
69 3300049571 Ga0501034_0497964 Ga0501034_0497964_526_1014 158
70 3300049575 Ga0501039_0025679 Ga0501039_0025679_3430_3915 158
71 3300005330 Ga0070690_100368467 Ga0070690_1003684672 159
72 3300005334 Ga0068869_100556365 Ga0068869_1005563652 159
73 3300005343 Ga0070687_100205091 Ga0070687_1002050912 159
74 3300005365 Ga0070688_101202590 Ga0070688_1012025901 159
75 3300005438 Ga0070701_10892550 Ga0070701_108925501 159
76 3300005544 Ga0070686_100567126 Ga0070686_1005671261 159
77 3300005549 Ga0070704_100221176 Ga0070704_1002211762 159
78 3300005614 Ga0068856_100851088 Ga0068856_1008510882 159
79 3300005718 Ga0068866_10492828 Ga0068866_104928282 159
80 3300005844 Ga0068862_100320474 Ga0068862_1003204741 159
81 3300006358 Ga0068871_100156021 Ga0068871_1001560213 159
82 3300006844 Ga0075428_100003491 Ga0075428_1000034914 159
83 3300006844 Ga0075428_100142987 Ga0075428_1001429874 159
84 3300006846 Ga0075430_100134196 Ga0075430_1001341962 159
85 3300006880 Ga0075429_100704025 Ga0075429_1007040251 159
86 3300009094 Ga0111539_10714610 Ga0111539_107146102 159
87 3300009147 Ga0114129_10076452 Ga0114129_100764524 159
88 3300009177 Ga0105248_11158809 Ga0105248_111588091 159
89 3300009553 Ga0105249_11440879 Ga0105249_114408791 159
90 3300025899 Ga0207642_10396124 Ga0207642_103961241 159
91 3300025942 Ga0207689_10128196 Ga0207689_101281962 159
92 3300026035 Ga0207703_10056777 Ga0207703_100567773 159
93 3300026118 Ga0207675_100944187 Ga0207675_1009441872 159
94 3300028380 Ga0268265_10034008 Ga0268265_100340083 159
95 3300046475 Ga0495639_0039610 Ga0495639_0039610_376_864 159
96 3300046499 Ga0495594_0134087 Ga0495594_0134087_266_754 159
97 3300046683 Ga0495658_0289979 Ga0495658_0289979_420_908 159
98 3300047318 Ga0495636_0283507 Ga0495636_0283507_239_727 159
99 3300047321 Ga0495676_0128145 Ga0495676_0128145_844_1332 159
100 3300049590 Ga0501074_0058740 Ga0501074_0058740_1521_2018 159
101 3300049742 Ga0501080_0119982 Ga0501080_0119982_1695_2192 159
102 3300049743 Ga0501081_0038486 Ga0501081_0038486_2704_3192 159
103 3300050508 nmdc:mga09592_929399_c1 nmdc:mga09592_929399_c1_184_672 159
104 3300050509 nmdc:mga0qj67_122880_c1 nmdc:mga0qj67_122880_c1_592_1104 159
105 3300050511 nmdc:mga08y16_785213_c1 nmdc:mga08y16_785213_c1_109_594 159
106 3300005293 Ga0065715_10475256 Ga0065715_104752562 160
107 3300005329 Ga0070683_100686537 Ga0070683_1006865371 160
108 3300005330 Ga0070690_100472400 Ga0070690_1004724001 160
109 3300005331 Ga0070670_100090466 Ga0070670_1000904664 160
110 3300005333 Ga0070677_10415161 Ga0070677_104151612 160
111 3300005334 Ga0068869_100030606 Ga0068869_1000306061 160
112 3300005338 Ga0068868_100068435 Ga0068868_1000684352 160
113 3300005340 Ga0070689_100219194 Ga0070689_1002191942 160
114 3300005340 Ga0070689_100241344 Ga0070689_1002413443 160
115 3300005340 Ga0070689_100585950 Ga0070689_1005859502 160
116 3300005343 Ga0070687_100045136 Ga0070687_1000451362 160
117 3300005343 Ga0070687_100147979 Ga0070687_1001479792 160
118 3300005343 Ga0070687_100295099 Ga0070687_1002950991 160
119 3300005345 Ga0070692_10003273 Ga0070692_100032735 160
120 3300005354 Ga0070675_100083855 Ga0070675_1000838552 160
121 3300005356 Ga0070674_101072094 Ga0070674_1010720941 160
122 3300005364 Ga0070673_100114656 Ga0070673_1001146563 160
123 3300005365 Ga0070688_100051918 Ga0070688_1000519183 160
124 3300005367 Ga0070667_100324438 Ga0070667_1003244382 160
125 3300005406 Ga0070703_10073858 Ga0070703_100738582 160
126 3300005438 Ga0070701_10335149 Ga0070701_103351491 160
127 3300005441 Ga0070700_100679120 Ga0070700_1006791201 160
128 3300005441 Ga0070700_101305729 Ga0070700_1013057291 160
129 3300005444 Ga0070694_100000132 Ga0070694_1000001323 160
130 3300005444 Ga0070694_100018009 Ga0070694_1000180094 160
131 3300005444 Ga0070694_100271900 Ga0070694_1002719002 160
132 3300005445 Ga0070708_100024284 Ga0070708_1000242844 160
133 3300005445 Ga0070708_100054741 Ga0070708_1000547414 160
134 3300005445 Ga0070708_100926633 Ga0070708_1009266332 160
135 3300005466 Ga0070685_10004309 Ga0070685_100043097 160
136 3300005466 Ga0070685_10004448 Ga0070685_100044488 160
137 3300005466 Ga0070685_10833378 Ga0070685_108333781 160
138 3300005468 Ga0070707_100355799 Ga0070707_1003557991 160
139 3300005471 Ga0070698_100113069 Ga0070698_1001130693 160
140 3300005518 Ga0070699_100889375 Ga0070699_1008893751 160
141 3300005518 Ga0070699_101674632 Ga0070699_1016746321 160
142 3300005535 Ga0070684_100626158 Ga0070684_1006261582 160
143 3300005539 Ga0068853_100006311 Ga0068853_1000063118 160
144 3300005539 Ga0068853_101089665 Ga0068853_1010896651 160
145 3300005543 Ga0070672_100613630 Ga0070672_1006136303 160
146 3300005544 Ga0070686_100396447 Ga0070686_1003964472 160
147 3300005545 Ga0070695_100335846 Ga0070695_1003358462 160
148 3300005546 Ga0070696_100035215 Ga0070696_1000352151 160
149 3300005549 Ga0070704_100193612 Ga0070704_1001936122 160
150 3300005549 Ga0070704_100515366 Ga0070704_1005153662 160
151 3300005549 Ga0070704_100629452 Ga0070704_1006294521 160
152 3300005615 Ga0070702_101045603 Ga0070702_1010456031 160
153 3300005618 Ga0068864_100071631 Ga0068864_1000716313 160
154 3300005618 Ga0068864_101068438 Ga0068864_1010684382 160
155 3300005618 Ga0068864_101815355 Ga0068864_1018153551 160
156 3300005719 Ga0068861_100994881 Ga0068861_1009948812 160
157 3300005834 Ga0068851_10872923 Ga0068851_108729231 160
158 3300005841 Ga0068863_100616015 Ga0068863_1006160152 160
159 3300005844 Ga0068862_100223861 Ga0068862_1002238611 160
160 3300005937 Ga0081455_10067355 Ga0081455_100673552 160
161 3300006844 Ga0075428_100347938 Ga0075428_1003479382 160
162 3300006844 Ga0075428_101111209 Ga0075428_1011112092 160
163 3300006844 Ga0075428_101126210 Ga0075428_1011262101 160
164 3300006844 Ga0075428_102017391 Ga0075428_1020173911 160
165 3300006844 Ga0075428_102089812 Ga0075428_1020898121 160
166 3300006846 Ga0075430_100115629 Ga0075430_1001156292 160
167 3300006846 Ga0075430_100511312 Ga0075430_1005113121 160
168 3300006846 Ga0075430_101249538 Ga0075430_1012495381 160
169 3300006847 Ga0075431_100019662 Ga0075431_1000196622 160
170 3300006847 Ga0075431_100304508 Ga0075431_1003045082 160
171 3300006847 Ga0075431_100653556 Ga0075431_1006535562 160
172 3300006852 Ga0075433_10212570 Ga0075433_102125703 160
173 3300006852 Ga0075433_10250434 Ga0075433_102504342 160
174 3300006852 Ga0075433_10341299 Ga0075433_103412992 160
175 3300006871 Ga0075434_100030747 Ga0075434_1000307472 160
176 3300006880 Ga0075429_100032626 Ga0075429_1000326264 160
177 3300006880 Ga0075429_100358855 Ga0075429_1003588552 160
178 3300006880 Ga0075429_100439572 Ga0075429_1004395722 160
179 3300007076 Ga0075435_100056214 Ga0075435_1000562145 160
180 3300007265 Ga0099794_10061369 Ga0099794_100613692 160
181 3300007265 Ga0099794_10305486 Ga0099794_103054861 160
182 3300009094 Ga0111539_10177879 Ga0111539_101778792 160
183 3300009094 Ga0111539_10178155 Ga0111539_101781552 160
184 3300009094 Ga0111539_10524632 Ga0111539_105246322 160
185 3300009101 Ga0105247_10490694 Ga0105247_104906941 160
186 3300009147 Ga0114129_10015076 Ga0114129_100150767 160
187 3300009147 Ga0114129_10068208 Ga0114129_100682083 160
188 3300009147 Ga0114129_10093636 Ga0114129_100936363 160
189 3300009147 Ga0114129_10614341 Ga0114129_106143412 160
190 3300009147 Ga0114129_10704109 Ga0114129_107041092 160
191 3300009177 Ga0105248_10053033 Ga0105248_100530332 160
192 3300009177 Ga0105248_10143001 Ga0105248_101430011 160
193 3300009553 Ga0105249_10156197 Ga0105249_101561972 160
194 3300010159 Ga0099796_10279875 Ga0099796_102798751 160
195 3300013308 Ga0157375_10349024 Ga0157375_103490243 160
196 3300014325 Ga0163163_10061912 Ga0163163_100619124 160
197 3300014325 Ga0163163_10077930 Ga0163163_100779303 160
198 3300014326 Ga0157380_10195056 Ga0157380_101950563 160
199 3300014969 Ga0157376_10180063 Ga0157376_101800633 160
200 3300014969 Ga0157376_11648094 Ga0157376_116480941 160
201 3300025321 Ga0207656_10563506 Ga0207656_105635061 160
202 3300025910 Ga0207684_10407776 Ga0207684_104077762 160
203 3300025917 Ga0207660_11059970 Ga0207660_110599702 160
204 3300025918 Ga0207662_10013691 Ga0207662_100136914 160
205 3300025918 Ga0207662_10660665 Ga0207662_106606651 160
206 3300025922 Ga0207646_10297772 Ga0207646_102977722 160
207 3300025924 Ga0207694_10466350 Ga0207694_104663501 160
208 3300025931 Ga0207644_10093586 Ga0207644_100935863 160
209 3300025936 Ga0207670_10013540 Ga0207670_100135403 160
210 3300025936 Ga0207670_10097529 Ga0207670_100975293 160
211 3300025936 Ga0207670_10102476 Ga0207670_101024762 160
212 3300025936 Ga0207670_10698899 Ga0207670_106988992 160
213 3300025937 Ga0207669_10622185 Ga0207669_106221852 160
214 3300025940 Ga0207691_10406624 Ga0207691_104066241 160
215 3300025941 Ga0207711_10068051 Ga0207711_100680512 160
216 3300025941 Ga0207711_10549986 Ga0207711_105499862 160
217 3300025945 Ga0207679_10311597 Ga0207679_103115972 160
218 3300025960 Ga0207651_10191368 Ga0207651_101913682 160
219 3300025960 Ga0207651_10418084 Ga0207651_104180841 160
220 3300026023 Ga0207677_10172285 Ga0207677_101722852 160
221 3300026041 Ga0207639_10002611 Ga0207639_100026114 160
222 3300026041 Ga0207639_11404969 Ga0207639_114049691 160
223 3300026075 Ga0207708_11220812 Ga0207708_112208122 160
224 3300026075 Ga0207708_11261066 Ga0207708_112610661 160
225 3300026088 Ga0207641_10603437 Ga0207641_106034371 160
226 3300026095 Ga0207676_10129984 Ga0207676_101299841 160
227 3300026095 Ga0207676_11415460 Ga0207676_114154601 160
228 3300026118 Ga0207675_102008045 Ga0207675_1020080451 160
229 3300026142 Ga0207698_10244523 Ga0207698_102445232 160
230 3300027671 Ga0209588_1232916 Ga0209588_12329161 160
231 3300027907 Ga0207428_10111177 Ga0207428_101111773 160
232 3300028380 Ga0268265_10859886 Ga0268265_108598862 160
233 3300031911 Ga0307412_10011096 Ga0307412_100110962 160
234 3300031995 Ga0307409_100577133 Ga0307409_1005771332 160
235 3300035085 Ga0373929_0151530 Ga0373929_0151530_91_588 160
236 3300035119 Ga0373956_0267251 Ga0373956_0267251_249_740 160
237 3300035170 Ga0373943_0020620 Ga0373943_0020620_477_968 160
238 3300035241 Ga0373961_0355349 Ga0373961_0355349_30_527 160
239 3300035242 Ga0373962_0164514 Ga0373962_0164514_71_565 160
240 3300037068 Ga0373925_0016228 Ga0373925_0016228_3475_3966 160
241 3300039450 Ga0436363_0436253 Ga0436363_0436253_1307_1801 160
242 3300042876 Ga0451577_0122205 Ga0451577_0122205_1633_2124 160
243 3300042876 Ga0451577_0267816 Ga0451577_0267816_954_1523 160
244 3300044673 Ga0453683_0005042 Ga0453683_0005042_7370_7861 160
245 3300044673 Ga0453683_0457288 Ga0453683_0457288_254_751 160
246 3300044712 Ga0453684_0000159 Ga0453684_0000159_130325_130816 160
247 3300045051 Ga0451576_0000120 Ga0451576_0000120_130325_130816 160
248 3300045051 Ga0451576_0004731 Ga0451576_0004731_13384_13875 160
249 3300045051 Ga0451576_0667258 Ga0451576_0667258_375_872 160
250 3300045051 Ga0451576_0887916 Ga0451576_0887916_84_575 160
251 3300045051 Ga0451576_2246775 Ga0451576_2246775_23_514 160
252 3300046454 Ga0495592_0032454 Ga0495592_0032454_2965_3447 160
253 3300046459 Ga0495629_0000004 Ga0495629_0000004_214114_214605 160
254 3300046473 Ga0495582_0045386 Ga0495582_0045386_44_535 160
255 3300046475 Ga0495639_0000964 Ga0495639_0000964_4204_4695 160
256 3300046476 Ga0495662_0064368 Ga0495662_0064368_459_950 160
257 3300046476 Ga0495662_0300322 Ga0495662_0300322_79_570 160
258 3300046517 Ga0495630_0267201 Ga0495630_0267201_301_783 160
259 3300046517 Ga0495630_0404300 Ga0495630_0404300_441_932 160
260 3300046526 Ga0495666_0007646 Ga0495666_0007646_863_1354 160
261 3300046535 Ga0495586_0001253 Ga0495586_0001253_436_927 160
262 3300046559 Ga0495667_0494970 Ga0495667_0494970_247_738 160
263 3300046615 Ga0495656_0553759 Ga0495656_0553759_67_558 160
264 3300046674 Ga0495588_0080848 Ga0495588_0080848_840_1331 160
265 3300046681 Ga0495647_0034716 Ga0495647_0034716_793_1284 160
266 3300046683 Ga0495658_0014081 Ga0495658_0014081_2696_3187 160
267 3300046689 Ga0495613_0199101 Ga0495613_0199101_438_929 160
268 3300046691 Ga0495670_0460047 Ga0495670_0460047_89_583 160
269 3300047315 Ga0495581_0098484 Ga0495581_0098484_226_717 160
270 3300047322 Ga0495680_0049389 Ga0495680_0049389_2650_3141 160
271 3300047322 Ga0495680_0865507 Ga0495680_0865507_43_534 160
272 3300047673 Ga0495593_0262046 Ga0495593_0262046_200_691 160
273 3300047673 Ga0495593_0302155 Ga0495593_0302155_25_516 160
274 3300049570 Ga0501033_0468436 Ga0501033_0468436_296_811 160
275 3300049571 Ga0501034_0676813 Ga0501034_0676813_355_849 160
276 3300049572 Ga0501036_1446672 Ga0501036_1446672_30_527 160
277 3300049578 Ga0501042_0821628 Ga0501042_0821628_82_597 160
278 3300049582 Ga0501048_0240968 Ga0501048_0240968_740_1255 160
279 3300049584 Ga0501068_0106823 Ga0501068_0106823_645_1142 160
280 3300049584 Ga0501068_0341757 Ga0501068_0341757_269_766 160
281 3300049585 Ga0501069_0011241 Ga0501069_0011241_2422_2919 160
282 3300049585 Ga0501069_0047562 Ga0501069_0047562_13_507 160
283 3300049586 Ga0501070_0000021 Ga0501070_0000021_127160_127657 160
284 3300049586 Ga0501070_0013331 Ga0501070_0013331_1740_2234 160
285 3300049586 Ga0501070_0482989 Ga0501070_0482989_449_946 160
286 3300049587 Ga0501071_0041684 Ga0501071_0041684_1739_2233 160
287 3300049588 Ga0501072_0180903 Ga0501072_0180903_132_629 160
288 3300049588 Ga0501072_0862626 Ga0501072_0862626_157_654 160
289 3300049589 Ga0501073_0036324 Ga0501073_0036324_258_755 160
290 3300049590 Ga0501074_0019969 Ga0501074_0019969_1653_2150 160
291 3300049590 Ga0501074_0202997 Ga0501074_0202997_622_1125 160
292 3300049668 Ga0501233_112196 Ga0501233_112196_186_677 160
293 3300049705 Ga0501225_0132020 Ga0501225_0132020_190_681 160
294 3300049742 Ga0501080_0031185 Ga0501080_0031185_4392_4889 160
295 3300049742 Ga0501080_0151993 Ga0501080_0151993_481_978 160
296 3300049743 Ga0501081_0113312 Ga0501081_0113312_397_894 160
297 3300049744 Ga0501083_0006812 Ga0501083_0006812_7019_7516 160
298 3300049744 Ga0501083_0099832 Ga0501083_0099832_54_548 160
299 3300049744 Ga0501083_0118324 Ga0501083_0118324_814_1311 160
300 3300049824 Ga0501045_0521798 Ga0501045_0521798_352_867 160
301 3300050507 nmdc:mga05p37_1753677_c1 nmdc:mga05p37_1753677_c1_41_538 160
302 3300050507 nmdc:mga05p37_281535_c1 nmdc:mga05p37_281535_c1_1029_1571 160
303 3300050507 nmdc:mga05p37_36098_c1 nmdc:mga05p37_36098_c1_3293_3784 160
304 3300050507 nmdc:mga05p37_84176_c1 nmdc:mga05p37_84176_c1_166_675 160
305 3300050508 nmdc:mga09592_25036_c1 nmdc:mga09592_25036_c1_2230_2721 160
306 3300050508 nmdc:mga09592_396475_c1 nmdc:mga09592_396475_c1_140_631 160
307 3300050508 nmdc:mga09592_423394_c1 nmdc:mga09592_423394_c1_136_627 160
308 3300050509 nmdc:mga0qj67_1087674_c1 nmdc:mga0qj67_1087674_c1_18_509 160
309 3300050509 nmdc:mga0qj67_168902_c1 nmdc:mga0qj67_168902_c1_889_1389 160
310 3300050509 nmdc:mga0qj67_248645_c1 nmdc:mga0qj67_248645_c1_101_592 160
311 3300050509 nmdc:mga0qj67_73877_c1 nmdc:mga0qj67_73877_c1_1475_1966 160
312 3300050509 nmdc:mga0qj67_763716_c1 nmdc:mga0qj67_763716_c1_206_697 160
313 3300050510 nmdc:mga06r32_1093841_c1 nmdc:mga06r32_1093841_c1_114_605 160
314 3300050510 nmdc:mga06r32_144722_c1 nmdc:mga06r32_144722_c1_765_1265 160
315 3300050510 nmdc:mga06r32_158987_c1 nmdc:mga06r32_158987_c1_88_579 160
316 3300050510 nmdc:mga06r32_56800_c1 nmdc:mga06r32_56800_c1_1872_2363 160
317 3300050511 nmdc:mga08y16_189928_c1 nmdc:mga08y16_189928_c1_305_796 160
318 3300050511 nmdc:mga08y16_56726_c1 nmdc:mga08y16_56726_c1_2125_2619 160
319 3300050512 nmdc:mga0n895_80531_c1 nmdc:mga0n895_80531_c1_533_1030 160
320 3300050513 nmdc:mga0rr50_128130_c1 nmdc:mga0rr50_128130_c1_1183_1680 160
321 3300050513 nmdc:mga0rr50_396742_c1 nmdc:mga0rr50_396742_c1_616_1110 160
322 3300050515 nmdc:mga0a205_341276_c1 nmdc:mga0a205_341276_c1_22_516 160
323 3300050515 nmdc:mga0a205_409426_c1 nmdc:mga0a205_409426_c1_119_628 160
324 3300053085 Ga0495619_0509448 Ga0495619_0509448_233_724 160
325 3300053094 Ga0500566_0042855 Ga0500566_0042855_194_685 160
326 3300054114 Ga0501084_0193435 Ga0501084_0193435_191_682 160
327 3300060353 Ga0501082_0023748 Ga0501082_0023748_2090_2587 160
328 3300060353 Ga0501082_0065250 Ga0501082_0065250_2431_2925 160
329 3300060353 Ga0501082_0390440 Ga0501082_0390440_599_1096 160
330 3300061734 Ga0530510_0000561 Ga0530510_0000561_94_588 160
331 3300061734 Ga0530510_0540022 Ga0530510_0540022_98_595 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

5

120

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7697 7 122
7zmg-assembly1.cif.gz_G cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) 0.7238 34 71
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.721 7 122
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.7042 33 71
4qsh-assembly1.cif.gz_D crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.6939 33 75
ID Description Score Start End Superfamily
af_P9WLN7_64_211_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7741 104 125 3.50.50.60
af_Q9UM44_30_139_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.748 53 68 2.60.40.10
af_K7M4I7_93_208_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.7468 53 68 2.40.330.10
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7195 7 122 3.10.180.10
4hnvB02 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.7023 33 74 3.10.600.10
ID Description Score Start End GO Terms
AF-A0A7W0WRQ8-F1-model_v4 VOC family protein 0.9807 88 159
AF-A0A2V6CT88-F1-model_v4 PhnB-like domain-containing protein 0.9788 103 159
AF-A0A4Q3P670-F1-model_v4 deleted 0.9727 87 159
AF-A0A7U7I4I4-F1-model_v4 deleted 0.9703 83 159
AF-A0A7Y2AEA9-F1-model_v4 VOC family protein 0.9696 91 159

Feature Viewer

pLDDT pTM Quality
91.03 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map