F410701
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 177 | 331 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300049689|Ga0501260_012076|Ga0501260_012076_273_755 |
| Length | 160 |
| Sequence | MATKGKIYTHLWYSEKADEAAKFYASIFPDSRVDRVTTMQSDSPTGPGGSVKVVDFTLLGQRFQAMTAGPHHDFNDAISIVVECDDQKELDRYWDALCEGGKPMACGWVTDRYGLRWQIVPAVMDKMMNEQDPARSKRVTDAMLKMKKFDIAALEKAYRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 108 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 111 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 113 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 119 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 120 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 121 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 144 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 158 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 159 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 160 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 98.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10475256 | 3300005293 | Bacteria | 722 |
| 2 | Ga0070683_100686537 | 3300005329 | Bacteria | 980 |
| 3 | Ga0070690_100368467 | 3300005330 | Bacteria | 1047 |
| 4 | Ga0070690_100472400 | 3300005330 | Bacteria | 933 |
| 5 | Ga0070670_100090466 | 3300005331 | Bacteria | 2630 |
| 6 | Ga0070677_10415161 | 3300005333 | Bacteria | 712 |
| 7 | Ga0068869_100030606 | 3300005334 | Bacteria | 3780 |
| 8 | Ga0068869_100204021 | 3300005334 | Bacteria | 1560 |
| 9 | Ga0068869_100216889 | 3300005334 | Bacteria | 1515 |
| 10 | Ga0068869_100556365 | 3300005334 | Bacteria | 964 |
| 11 | Ga0068868_100068435 | 3300005338 | Bacteria | 2827 |
| 12 | Ga0068868_100248663 | 3300005338 | Bacteria | 1496 |
| 13 | Ga0070689_100094593 | 3300005340 | Bacteria | 2359 |
| 14 | Ga0070689_100219194 | 3300005340 | Unclassified | 1560 |
| 15 | Ga0070689_100241344 | 3300005340 | Bacteria | 1488 |
| 16 | Ga0070689_100585950 | 3300005340 | Bacteria | 965 |
| 17 | Ga0070689_100597923 | 3300005340 | Bacteria | 955 |
| 18 | Ga0070687_100045136 | 3300005343 | Bacteria | 2248 |
| 19 | Ga0070687_100147979 | 3300005343 | Bacteria | 1375 |
| 20 | Ga0070687_100205091 | 3300005343 | Bacteria | 1197 |
| 21 | Ga0070687_100295099 | 3300005343 | Bacteria | 1026 |
| 22 | Ga0070661_100739607 | 3300005344 | Bacteria | 804 |
| 23 | Ga0070692_10003273 | 3300005345 | Bacteria | 6533 |
| 24 | Ga0070675_100083855 | 3300005354 | Bacteria | 2661 |
| 25 | Ga0070671_100610083 | 3300005355 | Bacteria | 943 |
| 26 | Ga0070674_101072094 | 3300005356 | Unclassified | 710 |
| 27 | Ga0070673_100114656 | 3300005364 | Bacteria | 2240 |
| 28 | Ga0070673_100290306 | 3300005364 | Bacteria | 1437 |
| 29 | Ga0070673_100771890 | 3300005364 | Bacteria | 886 |
| 30 | Ga0070688_100051918 | 3300005365 | Unclassified | 2559 |
| 31 | Ga0070688_100239514 | 3300005365 | Bacteria | 1287 |
| 32 | Ga0070688_100571394 | 3300005365 | Bacteria | 862 |
| 33 | Ga0070688_101202590 | 3300005365 | Bacteria | 609 |
| 34 | Ga0070667_100324438 | 3300005367 | Bacteria | 1390 |
| 35 | Ga0070667_100897210 | 3300005367 | Bacteria | 825 |
| 36 | Ga0070703_10073858 | 3300005406 | Bacteria | 1145 |
| 37 | Ga0070701_10335149 | 3300005438 | Bacteria | 940 |
| 38 | Ga0070701_10892550 | 3300005438 | Bacteria | 613 |
| 39 | Ga0070700_100679120 | 3300005441 | Unclassified | 816 |
| 40 | Ga0070700_101305729 | 3300005441 | Bacteria | 610 |
| 41 | Ga0070694_100000132 | 3300005444 | Bacteria | 37067 |
| 42 | Ga0070694_100018009 | 3300005444 | Bacteria | 4475 |
| 43 | Ga0070694_100271900 | 3300005444 | Bacteria | 1289 |
| 44 | Ga0070708_100024284 | 3300005445 | Bacteria | 5168 |
| 45 | Ga0070708_100054741 | 3300005445 | Bacteria | 3545 |
| 46 | Ga0070708_100926633 | 3300005445 | Bacteria | 818 |
| 47 | Ga0070685_10004309 | 3300005466 | Bacteria | 7181 |
| 48 | Ga0070685_10004448 | 3300005466 | Bacteria | 7088 |
| 49 | Ga0070685_10833378 | 3300005466 | Unclassified | 682 |
| 50 | Ga0070707_100355799 | 3300005468 | Bacteria | 1422 |
| 51 | Ga0070698_100113069 | 3300005471 | Bacteria | 2680 |
| 52 | Ga0070699_100889375 | 3300005518 | Bacteria | 816 |
| 53 | Ga0070699_101674632 | 3300005518 | Bacteria | 583 |
| 54 | Ga0070684_100626158 | 3300005535 | Bacteria | 1001 |
| 55 | Ga0068853_100006311 | 3300005539 | Bacteria | 9407 |
| 56 | Ga0068853_101089665 | 3300005539 | Bacteria | 770 |
| 57 | Ga0070672_100122773 | 3300005543 | Bacteria | 2128 |
| 58 | Ga0070672_100613630 | 3300005543 | Bacteria | 948 |
| 59 | Ga0070672_100778274 | 3300005543 | Bacteria | 841 |
| 60 | Ga0070686_100076310 | 3300005544 | Bacteria | 2207 |
| 61 | Ga0070686_100396447 | 3300005544 | Bacteria | 1048 |
| 62 | Ga0070686_100567126 | 3300005544 | Bacteria | 890 |
| 63 | Ga0070695_100335846 | 3300005545 | Bacteria | 1128 |
| 64 | Ga0070696_100035215 | 3300005546 | Bacteria | 3446 |
| 65 | Ga0070665_100722424 | 3300005548 | Bacteria | 1009 |
| 66 | Ga0070704_100193612 | 3300005549 | Bacteria | 1636 |
| 67 | Ga0070704_100221176 | 3300005549 | Bacteria | 1540 |
| 68 | Ga0070704_100515366 | 3300005549 | Bacteria | 1040 |
| 69 | Ga0070704_100629452 | 3300005549 | Bacteria | 945 |
| 70 | Ga0068856_100851088 | 3300005614 | Bacteria | 931 |
| 71 | Ga0070702_101045603 | 3300005615 | Bacteria | 649 |
| 72 | Ga0068859_100005427 | 3300005617 | Bacteria | 12966 |
| 73 | Ga0068859_100411947 | 3300005617 | Bacteria | 1448 |
| 74 | Ga0068864_100071631 | 3300005618 | Bacteria | 3019 |
| 75 | Ga0068864_101068438 | 3300005618 | Bacteria | 802 |
| 76 | Ga0068864_101815355 | 3300005618 | Bacteria | 615 |
| 77 | Ga0068866_10492828 | 3300005718 | Bacteria | 809 |
| 78 | Ga0068861_100234633 | 3300005719 | Bacteria | 1557 |
| 79 | Ga0068861_100282394 | 3300005719 | Bacteria | 1430 |
| 80 | Ga0068861_100994881 | 3300005719 | Bacteria | 800 |
| 81 | Ga0068851_10872923 | 3300005834 | Unclassified | 562 |
| 82 | Ga0068863_100616015 | 3300005841 | Unclassified | 1075 |
| 83 | Ga0068862_100223861 | 3300005844 | Bacteria | 1704 |
| 84 | Ga0068862_100320474 | 3300005844 | Bacteria | 1430 |
| 85 | Ga0068862_100747045 | 3300005844 | Bacteria | 951 |
| 86 | Ga0081455_10067355 | 3300005937 | Bacteria | 2984 |
| 87 | Ga0097621_101304902 | 3300006237 | Bacteria | 686 |
| 88 | Ga0068871_100156021 | 3300006358 | Bacteria | 1949 |
| 89 | Ga0075428_100003491 | 3300006844 | Bacteria | 17218 |
| 90 | Ga0075428_100142987 | 3300006844 | Unclassified | 2601 |
| 91 | Ga0075428_100347938 | 3300006844 | Bacteria | 1591 |
| 92 | Ga0075428_101111209 | 3300006844 | Bacteria | 835 |
| 93 | Ga0075428_101126210 | 3300006844 | Bacteria | 828 |
| 94 | Ga0075428_102017391 | 3300006844 | Bacteria | 598 |
| 95 | Ga0075428_102089812 | 3300006844 | Bacteria | 586 |
| 96 | Ga0075430_100115629 | 3300006846 | Unclassified | 2235 |
| 97 | Ga0075430_100134196 | 3300006846 | Bacteria | 2063 |
| 98 | Ga0075430_100511312 | 3300006846 | Bacteria | 991 |
| 99 | Ga0075430_101249538 | 3300006846 | Bacteria | 611 |
| 100 | Ga0075431_100019662 | 3300006847 | Bacteria | 6890 |
| 101 | Ga0075431_100304508 | 3300006847 | Bacteria | 1610 |
| 102 | Ga0075431_100653556 | 3300006847 | Bacteria | 1032 |
| 103 | Ga0075433_10212570 | 3300006852 | Bacteria | 1718 |
| 104 | Ga0075433_10250434 | 3300006852 | Bacteria | 1572 |
| 105 | Ga0075433_10341299 | 3300006852 | Bacteria | 1324 |
| 106 | Ga0075434_100030747 | 3300006871 | Bacteria | 5290 |
| 107 | Ga0075429_100032626 | 3300006880 | Bacteria | 4526 |
| 108 | Ga0075429_100358855 | 3300006880 | Bacteria | 1276 |
| 109 | Ga0075429_100439572 | 3300006880 | Bacteria | 1143 |
| 110 | Ga0075429_100704025 | 3300006880 | Bacteria | 885 |
| 111 | Ga0097620_100005427 | 3300006931 | Bacteria | 12966 |
| 112 | Ga0097620_100411952 | 3300006931 | Bacteria | 1448 |
| 113 | Ga0075435_100056214 | 3300007076 | Bacteria | 3180 |
| 114 | Ga0099794_10061369 | 3300007265 | Bacteria | 1826 |
| 115 | Ga0099794_10305486 | 3300007265 | Bacteria | 824 |
| 116 | Ga0111539_10177879 | 3300009094 | Bacteria | 2485 |
| 117 | Ga0111539_10178155 | 3300009094 | Unclassified | 2483 |
| 118 | Ga0111539_10240579 | 3300009094 | Bacteria | 2107 |
| 119 | Ga0111539_10322578 | 3300009094 | Bacteria | 1797 |
| 120 | Ga0111539_10524632 | 3300009094 | Bacteria | 1380 |
| 121 | Ga0111539_10714610 | 3300009094 | Bacteria | 1166 |
| 122 | Ga0111539_11450483 | 3300009094 | Bacteria | 796 |
| 123 | Ga0105247_10490694 | 3300009101 | Bacteria | 893 |
| 124 | Ga0114129_10015076 | 3300009147 | Bacteria | 11003 |
| 125 | Ga0114129_10068208 | 3300009147 | Bacteria | 4959 |
| 126 | Ga0114129_10076452 | 3300009147 | Bacteria | 4661 |
| 127 | Ga0114129_10093636 | 3300009147 | Bacteria | 4162 |
| 128 | Ga0114129_10614341 | 3300009147 | Bacteria | 1407 |
| 129 | Ga0114129_10704109 | 3300009147 | Bacteria | 1298 |
| 130 | Ga0105243_11384487 | 3300009148 | Bacteria | 723 |
| 131 | Ga0105248_10000978 | 3300009177 | Bacteria | 31743 |
| 132 | Ga0105248_10053033 | 3300009177 | Unclassified | 4550 |
| 133 | Ga0105248_10143001 | 3300009177 | Bacteria | 2699 |
| 134 | Ga0105248_11158809 | 3300009177 | Bacteria | 874 |
| 135 | Ga0105249_10156197 | 3300009553 | Bacteria | 2200 |
| 136 | Ga0105249_11440879 | 3300009553 | Bacteria | 761 |
| 137 | Ga0099796_10279875 | 3300010159 | Bacteria | 701 |
| 138 | Ga0163162_10022720 | 3300013306 | Bacteria | 6184 |
| 139 | Ga0157375_10076678 | 3300013308 | Bacteria | 3371 |
| 140 | Ga0157375_10349024 | 3300013308 | Bacteria | 1645 |
| 141 | Ga0163163_10061912 | 3300014325 | Bacteria | 3708 |
| 142 | Ga0163163_10077930 | 3300014325 | Bacteria | 3310 |
| 143 | Ga0163163_11917518 | 3300014325 | Bacteria | 652 |
| 144 | Ga0157380_10195056 | 3300014326 | Bacteria | 1792 |
| 145 | Ga0157379_10192626 | 3300014968 | Bacteria | 1842 |
| 146 | Ga0157376_10180063 | 3300014969 | Bacteria | 1931 |
| 147 | Ga0157376_11648094 | 3300014969 | Bacteria | 676 |
| 148 | Ga0207656_10563506 | 3300025321 | Unclassified | 581 |
| 149 | Ga0207642_10396124 | 3300025899 | Bacteria | 825 |
| 150 | Ga0207684_10407776 | 3300025910 | Bacteria | 1168 |
| 151 | Ga0207660_11059970 | 3300025917 | Bacteria | 661 |
| 152 | Ga0207662_10013691 | 3300025918 | Bacteria | 4539 |
| 153 | Ga0207662_10660665 | 3300025918 | Unclassified | 731 |
| 154 | Ga0207646_10297772 | 3300025922 | Bacteria | 1457 |
| 155 | Ga0207681_10106245 | 3300025923 | Bacteria | 2034 |
| 156 | Ga0207694_10466350 | 3300025924 | Bacteria | 1055 |
| 157 | Ga0207644_10093586 | 3300025931 | Bacteria | 2244 |
| 158 | Ga0207644_10696655 | 3300025931 | Bacteria | 847 |
| 159 | Ga0207670_10013540 | 3300025936 | Bacteria | 4815 |
| 160 | Ga0207670_10097529 | 3300025936 | Bacteria | 2093 |
| 161 | Ga0207670_10102476 | 3300025936 | Unclassified | 2047 |
| 162 | Ga0207670_10698899 | 3300025936 | Bacteria | 839 |
| 163 | Ga0207670_11709235 | 3300025936 | Bacteria | 535 |
| 164 | Ga0207669_10622185 | 3300025937 | Bacteria | 880 |
| 165 | Ga0207691_10016482 | 3300025940 | Bacteria | 7014 |
| 166 | Ga0207691_10406624 | 3300025940 | Unclassified | 1161 |
| 167 | Ga0207711_10004125 | 3300025941 | Bacteria | 12453 |
| 168 | Ga0207711_10068051 | 3300025941 | Bacteria | 3084 |
| 169 | Ga0207711_10549986 | 3300025941 | Bacteria | 1077 |
| 170 | Ga0207689_10109991 | 3300025942 | Bacteria | 2264 |
| 171 | Ga0207689_10128196 | 3300025942 | Bacteria | 2087 |
| 172 | Ga0207689_10168736 | 3300025942 | Bacteria | 1803 |
| 173 | Ga0207679_10311597 | 3300025945 | Bacteria | 1360 |
| 174 | Ga0207651_10191368 | 3300025960 | Bacteria | 1632 |
| 175 | Ga0207651_10418084 | 3300025960 | Bacteria | 1144 |
| 176 | Ga0207651_10463348 | 3300025960 | Bacteria | 1089 |
| 177 | Ga0207651_10623280 | 3300025960 | Bacteria | 945 |
| 178 | Ga0207677_10172285 | 3300026023 | Bacteria | 1694 |
| 179 | Ga0207703_10056777 | 3300026035 | Bacteria | 3190 |
| 180 | Ga0207639_10002611 | 3300026041 | Bacteria | 12088 |
| 181 | Ga0207639_11404969 | 3300026041 | Unclassified | 655 |
| 182 | Ga0207678_10900621 | 3300026067 | Bacteria | 782 |
| 183 | Ga0207708_11220812 | 3300026075 | Unclassified | 658 |
| 184 | Ga0207708_11261066 | 3300026075 | Bacteria | 647 |
| 185 | Ga0207702_10565809 | 3300026078 | Bacteria | 1113 |
| 186 | Ga0207641_10603437 | 3300026088 | Unclassified | 1075 |
| 187 | Ga0207676_10129984 | 3300026095 | Bacteria | 2140 |
| 188 | Ga0207676_11415460 | 3300026095 | Bacteria | 691 |
| 189 | Ga0207674_10919112 | 3300026116 | Bacteria | 843 |
| 190 | Ga0207675_100063516 | 3300026118 | Bacteria | 3450 |
| 191 | Ga0207675_100077242 | 3300026118 | Bacteria | 3119 |
| 192 | Ga0207675_100944187 | 3300026118 | Bacteria | 880 |
| 193 | Ga0207675_102008045 | 3300026118 | Bacteria | 596 |
| 194 | Ga0207683_10663820 | 3300026121 | Bacteria | 966 |
| 195 | Ga0207698_10244523 | 3300026142 | Bacteria | 1638 |
| 196 | Ga0207698_11644582 | 3300026142 | Unclassified | 658 |
| 197 | Ga0209588_1232916 | 3300027671 | Bacteria | 567 |
| 198 | Ga0207428_10111177 | 3300027907 | Bacteria | 2108 |
| 199 | Ga0268265_10034008 | 3300028380 | Bacteria | 3712 |
| 200 | Ga0268265_10412150 | 3300028380 | Bacteria | 1252 |
| 201 | Ga0268265_10859886 | 3300028380 | Bacteria | 888 |
| 202 | Ga0307410_10679316 | 3300031852 | Bacteria | 866 |
| 203 | Ga0307406_10035562 | 3300031901 | Bacteria | 3065 |
| 204 | Ga0307407_10503408 | 3300031903 | Bacteria | 888 |
| 205 | Ga0307412_10011096 | 3300031911 | Bacteria | 5210 |
| 206 | Ga0307412_11156370 | 3300031911 | Unclassified | 691 |
| 207 | Ga0307409_100577133 | 3300031995 | Bacteria | 1108 |
| 208 | Ga0307416_100139546 | 3300032002 | Bacteria | 2200 |
| 209 | Ga0307414_11958156 | 3300032004 | Bacteria | 547 |
| 210 | Ga0373929_0151530 | 3300035085 | Bacteria | 622 |
| 211 | Ga0373934_0155046 | 3300035086 | Bacteria | 939 |
| 212 | Ga0373956_0267251 | 3300035119 | Bacteria | 813 |
| 213 | Ga0373943_0020620 | 3300035170 | Bacteria | 3041 |
| 214 | Ga0373961_0355349 | 3300035241 | Unclassified | 553 |
| 215 | Ga0373962_0164514 | 3300035242 | Bacteria | 734 |
| 216 | Ga0373933_0110779 | 3300035724 | Bacteria | 1712 |
| 217 | Ga0373925_0016228 | 3300037068 | Bacteria | 5390 |
| 218 | Ga0436365_0858441 | 3300039437 | Bacteria | 2639 |
| 219 | Ga0436363_0436253 | 3300039450 | Bacteria | 2878 |
| 220 | Ga0436363_0552972 | 3300039450 | Bacteria | 848 |
| 221 | Ga0451577_0122205 | 3300042876 | Bacteria | 2333 |
| 222 | Ga0451577_0267816 | 3300042876 | Bacteria | 1547 |
| 223 | Ga0453683_0005042 | 3300044673 | Bacteria | 9278 |
| 224 | Ga0453683_0028088 | 3300044673 | Bacteria | 3564 |
| 225 | Ga0453683_0457288 | 3300044673 | Bacteria | 826 |
| 226 | Ga0453684_0000159 | 3300044712 | Bacteria | 300297 |
| 227 | Ga0451576_0000120 | 3300045051 | Bacteria | 199365 |
| 228 | Ga0451576_0004731 | 3300045051 | Bacteria | 17495 |
| 229 | Ga0451576_0183851 | 3300045051 | Bacteria | 2182 |
| 230 | Ga0451576_0667258 | 3300045051 | Bacteria | 1092 |
| 231 | Ga0451576_0887916 | 3300045051 | Bacteria | 935 |
| 232 | Ga0451576_2246775 | 3300045051 | Bacteria | 560 |
| 233 | Ga0495592_0032454 | 3300046454 | Bacteria | 3939 |
| 234 | Ga0495629_0000004 | 3300046459 | Bacteria | 433516 |
| 235 | Ga0495582_0045386 | 3300046473 | Bacteria | 2420 |
| 236 | Ga0495639_0000964 | 3300046475 | Bacteria | 12948 |
| 237 | Ga0495639_0039610 | 3300046475 | Unclassified | 2119 |
| 238 | Ga0495662_0064368 | 3300046476 | Bacteria | 1772 |
| 239 | Ga0495662_0300322 | 3300046476 | Unclassified | 790 |
| 240 | Ga0495594_0134087 | 3300046499 | Bacteria | 1403 |
| 241 | Ga0495630_0267201 | 3300046517 | Bacteria | 1307 |
| 242 | Ga0495630_0404300 | 3300046517 | Bacteria | 1046 |
| 243 | Ga0495666_0007646 | 3300046526 | Bacteria | 5407 |
| 244 | Ga0495586_0001253 | 3300046535 | Bacteria | 14237 |
| 245 | Ga0495667_0494970 | 3300046559 | Unclassified | 766 |
| 246 | Ga0495656_0553759 | 3300046615 | Bacteria | 613 |
| 247 | Ga0495588_0080848 | 3300046674 | Bacteria | 1696 |
| 248 | Ga0495647_0034716 | 3300046681 | Bacteria | 1890 |
| 249 | Ga0495658_0014081 | 3300046683 | Bacteria | 4078 |
| 250 | Ga0495658_0289979 | 3300046683 | Bacteria | 1034 |
| 251 | Ga0495613_0199101 | 3300046689 | Bacteria | 1413 |
| 252 | Ga0495670_0460047 | 3300046691 | Bacteria | 690 |
| 253 | Ga0495581_0098484 | 3300047315 | Bacteria | 1698 |
| 254 | Ga0495636_0283507 | 3300047318 | Bacteria | 772 |
| 255 | Ga0495676_0128145 | 3300047321 | Unclassified | 1836 |
| 256 | Ga0495680_0049389 | 3300047322 | Bacteria | 3295 |
| 257 | Ga0495680_0865507 | 3300047322 | Unclassified | 586 |
| 258 | Ga0495593_0262046 | 3300047673 | Bacteria | 865 |
| 259 | Ga0495593_0302155 | 3300047673 | Bacteria | 800 |
| 260 | Ga0496108_0165183 | 3300048911 | Bacteria | 1914 |
| 261 | Ga0496109_0285608 | 3300048912 | Bacteria | 1555 |
| 262 | Ga0501033_0468436 | 3300049570 | Bacteria | 874 |
| 263 | Ga0501034_0497964 | 3300049571 | Bacteria | 1132 |
| 264 | Ga0501034_0676813 | 3300049571 | Bacteria | 932 |
| 265 | Ga0501036_1446672 | 3300049572 | Bacteria | 557 |
| 266 | Ga0501039_0025679 | 3300049575 | Bacteria | 4528 |
| 267 | Ga0501042_0821628 | 3300049578 | Bacteria | 676 |
| 268 | Ga0501048_0240968 | 3300049582 | Bacteria | 1283 |
| 269 | Ga0501068_0106823 | 3300049584 | Bacteria | 1738 |
| 270 | Ga0501068_0341757 | 3300049584 | Bacteria | 961 |
| 271 | Ga0501069_0011241 | 3300049585 | Bacteria | 4748 |
| 272 | Ga0501069_0047562 | 3300049585 | Unclassified | 2381 |
| 273 | Ga0501070_0000021 | 3300049586 | Bacteria | 168438 |
| 274 | Ga0501070_0013331 | 3300049586 | Bacteria | 6932 |
| 275 | Ga0501070_0482989 | 3300049586 | Bacteria | 996 |
| 276 | Ga0501071_0041684 | 3300049587 | Unclassified | 3288 |
| 277 | Ga0501072_0180903 | 3300049588 | Bacteria | 1682 |
| 278 | Ga0501072_0862626 | 3300049588 | Bacteria | 708 |
| 279 | Ga0501073_0036324 | 3300049589 | Bacteria | 3501 |
| 280 | Ga0501074_0019969 | 3300049590 | Bacteria | 4869 |
| 281 | Ga0501074_0058740 | 3300049590 | Bacteria | 2771 |
| 282 | Ga0501074_0202997 | 3300049590 | Bacteria | 1413 |
| 283 | Ga0501227_061922 | 3300049665 | Bacteria | 961 |
| 284 | Ga0501233_112196 | 3300049668 | Bacteria | 730 |
| 285 | Ga0501260_012076 | 3300049689 | Bacteria | 879 |
| 286 | Ga0501225_0132020 | 3300049705 | Bacteria | 749 |
| 287 | Ga0501080_0031185 | 3300049742 | Bacteria | 4967 |
| 288 | Ga0501080_0119982 | 3300049742 | Bacteria | 2437 |
| 289 | Ga0501080_0151993 | 3300049742 | Bacteria | 2139 |
| 290 | Ga0501081_0038486 | 3300049743 | Bacteria | 3268 |
| 291 | Ga0501081_0113312 | 3300049743 | Bacteria | 1926 |
| 292 | Ga0501083_0006812 | 3300049744 | Bacteria | 8111 |
| 293 | Ga0501083_0099832 | 3300049744 | Bacteria | 1914 |
| 294 | Ga0501083_0118324 | 3300049744 | Bacteria | 1738 |
| 295 | Ga0501045_0521798 | 3300049824 | Bacteria | 882 |
| 296 | nmdc:mga05p37_1753677_c1 | 3300050507 | Bacteria | 602 |
| 297 | nmdc:mga05p37_281535_c1 | 3300050507 | Bacteria | 1983 |
| 298 | nmdc:mga05p37_36098_c1 | 3300050507 | Bacteria | 6064 |
| 299 | nmdc:mga05p37_84176_c1 | 3300050507 | Bacteria | 3918 |
| 300 | nmdc:mga09592_25036_c1 | 3300050508 | Bacteria | 4937 |
| 301 | nmdc:mga09592_396475_c1 | 3300050508 | Bacteria | 840 |
| 302 | nmdc:mga09592_423394_c1 | 3300050508 | Bacteria | 1150 |
| 303 | nmdc:mga09592_929399_c1 | 3300050508 | Bacteria | 730 |
| 304 | nmdc:mga0qj67_1087674_c1 | 3300050509 | Bacteria | 625 |
| 305 | nmdc:mga0qj67_122880_c1 | 3300050509 | Bacteria | 2100 |
| 306 | nmdc:mga0qj67_168902_c1 | 3300050509 | Bacteria | 1776 |
| 307 | nmdc:mga0qj67_248645_c1 | 3300050509 | Bacteria | 1443 |
| 308 | nmdc:mga0qj67_73877_c1 | 3300050509 | Bacteria | 2724 |
| 309 | nmdc:mga0qj67_763716_c1 | 3300050509 | Bacteria | 766 |
| 310 | nmdc:mga06r32_1093841_c1 | 3300050510 | Bacteria | 746 |
| 311 | nmdc:mga06r32_144722_c1 | 3300050510 | Bacteria | 2354 |
| 312 | nmdc:mga06r32_158987_c1 | 3300050510 | Bacteria | 2241 |
| 313 | nmdc:mga06r32_56800_c1 | 3300050510 | Bacteria | 3758 |
| 314 | nmdc:mga08y16_1176183_c1 | 3300050511 | Bacteria | 739 |
| 315 | nmdc:mga08y16_189928_c1 | 3300050511 | Unclassified | 2131 |
| 316 | nmdc:mga08y16_56726_c1 | 3300050511 | Bacteria | 4093 |
| 317 | nmdc:mga08y16_785213_c1 | 3300050511 | Bacteria | 946 |
| 318 | nmdc:mga0n895_80531_c1 | 3300050512 | Bacteria | 3245 |
| 319 | nmdc:mga0rr50_128130_c1 | 3300050513 | Bacteria | 2029 |
| 320 | nmdc:mga0rr50_396742_c1 | 3300050513 | Bacteria | 1165 |
| 321 | nmdc:mga0rr50_818492_c1 | 3300050513 | Bacteria | 794 |
| 322 | nmdc:mga0a205_341276_c1 | 3300050515 | Bacteria | 1366 |
| 323 | nmdc:mga0a205_409426_c1 | 3300050515 | Bacteria | 1219 |
| 324 | Ga0495619_0509448 | 3300053085 | Bacteria | 827 |
| 325 | Ga0500566_0042855 | 3300053094 | Bacteria | 2609 |
| 326 | Ga0501084_0193435 | 3300054114 | Bacteria | 1716 |
| 327 | Ga0501082_0023748 | 3300060353 | Bacteria | 5286 |
| 328 | Ga0501082_0065250 | 3300060353 | Bacteria | 3135 |
| 329 | Ga0501082_0390440 | 3300060353 | Bacteria | 1214 |
| 330 | Ga0530510_0000561 | 3300061734 | Bacteria | 23933 |
| 331 | Ga0530510_0540022 | 3300061734 | Bacteria | 885 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100248663 | Ga0068868_1002486632 | 155 |
| 2 | 3300005340 | Ga0070689_100597923 | Ga0070689_1005979231 | 155 |
| 3 | 3300005344 | Ga0070661_100739607 | Ga0070661_1007396071 | 155 |
| 4 | 3300005364 | Ga0070673_100771890 | Ga0070673_1007718901 | 155 |
| 5 | 3300005543 | Ga0070672_100122773 | Ga0070672_1001227735 | 155 |
| 6 | 3300005548 | Ga0070665_100722424 | Ga0070665_1007224241 | 155 |
| 7 | 3300006237 | Ga0097621_101304902 | Ga0097621_1013049022 | 155 |
| 8 | 3300009177 | Ga0105248_10000978 | Ga0105248_100009783 | 155 |
| 9 | 3300013306 | Ga0163162_10022720 | Ga0163162_100227206 | 155 |
| 10 | 3300013308 | Ga0157375_10076678 | Ga0157375_100766782 | 155 |
| 11 | 3300014968 | Ga0157379_10192626 | Ga0157379_101926262 | 155 |
| 12 | 3300025940 | Ga0207691_10016482 | Ga0207691_100164823 | 155 |
| 13 | 3300025941 | Ga0207711_10004125 | Ga0207711_100041253 | 155 |
| 14 | 3300025960 | Ga0207651_10623280 | Ga0207651_106232802 | 155 |
| 15 | 3300026067 | Ga0207678_10900621 | Ga0207678_109006212 | 155 |
| 16 | 3300031852 | Ga0307410_10679316 | Ga0307410_106793162 | 155 |
| 17 | 3300031901 | Ga0307406_10035562 | Ga0307406_100355622 | 155 |
| 18 | 3300031903 | Ga0307407_10503408 | Ga0307407_105034081 | 155 |
| 19 | 3300031911 | Ga0307412_11156370 | Ga0307412_111563701 | 155 |
| 20 | 3300032002 | Ga0307416_100139546 | Ga0307416_1001395462 | 155 |
| 21 | 3300048911 | Ga0496108_0165183 | Ga0496108_0165183_695_1183 | 155 |
| 22 | 3300048912 | Ga0496109_0285608 | Ga0496109_0285608_1015_1503 | 155 |
| 23 | 3300009094 | Ga0111539_10240579 | Ga0111539_102405793 | 156 |
| 24 | 3300026116 | Ga0207674_10919112 | Ga0207674_109191121 | 156 |
| 25 | 3300032004 | Ga0307414_11958156 | Ga0307414_119581561 | 156 |
| 26 | 3300005334 | Ga0068869_100204021 | Ga0068869_1002040212 | 157 |
| 27 | 3300005334 | Ga0068869_100216889 | Ga0068869_1002168892 | 157 |
| 28 | 3300005340 | Ga0070689_100094593 | Ga0070689_1000945933 | 157 |
| 29 | 3300005355 | Ga0070671_100610083 | Ga0070671_1006100831 | 157 |
| 30 | 3300005364 | Ga0070673_100290306 | Ga0070673_1002903062 | 157 |
| 31 | 3300005365 | Ga0070688_100239514 | Ga0070688_1002395142 | 157 |
| 32 | 3300005365 | Ga0070688_100571394 | Ga0070688_1005713942 | 157 |
| 33 | 3300005367 | Ga0070667_100897210 | Ga0070667_1008972101 | 157 |
| 34 | 3300005543 | Ga0070672_100778274 | Ga0070672_1007782741 | 157 |
| 35 | 3300005544 | Ga0070686_100076310 | Ga0070686_1000763102 | 157 |
| 36 | 3300005617 | Ga0068859_100005427 | Ga0068859_1000054276 | 157 |
| 37 | 3300005617 | Ga0068859_100411947 | Ga0068859_1004119472 | 157 |
| 38 | 3300005719 | Ga0068861_100234633 | Ga0068861_1002346331 | 157 |
| 39 | 3300005719 | Ga0068861_100282394 | Ga0068861_1002823942 | 157 |
| 40 | 3300005844 | Ga0068862_100747045 | Ga0068862_1007470451 | 157 |
| 41 | 3300006931 | Ga0097620_100005427 | Ga0097620_1000054276 | 157 |
| 42 | 3300006931 | Ga0097620_100411952 | Ga0097620_1004119521 | 157 |
| 43 | 3300009094 | Ga0111539_10322578 | Ga0111539_103225782 | 157 |
| 44 | 3300009094 | Ga0111539_11450483 | Ga0111539_114504832 | 157 |
| 45 | 3300009148 | Ga0105243_11384487 | Ga0105243_113844872 | 157 |
| 46 | 3300014325 | Ga0163163_11917518 | Ga0163163_119175181 | 157 |
| 47 | 3300025923 | Ga0207681_10106245 | Ga0207681_101062451 | 157 |
| 48 | 3300025931 | Ga0207644_10696655 | Ga0207644_106966552 | 157 |
| 49 | 3300025936 | Ga0207670_11709235 | Ga0207670_117092351 | 157 |
| 50 | 3300025942 | Ga0207689_10109991 | Ga0207689_101099912 | 157 |
| 51 | 3300025942 | Ga0207689_10168736 | Ga0207689_101687363 | 157 |
| 52 | 3300025960 | Ga0207651_10463348 | Ga0207651_104633482 | 157 |
| 53 | 3300026078 | Ga0207702_10565809 | Ga0207702_105658092 | 157 |
| 54 | 3300026118 | Ga0207675_100063516 | Ga0207675_1000635162 | 157 |
| 55 | 3300026118 | Ga0207675_100077242 | Ga0207675_1000772422 | 157 |
| 56 | 3300026121 | Ga0207683_10663820 | Ga0207683_106638202 | 157 |
| 57 | 3300026142 | Ga0207698_11644582 | Ga0207698_116445821 | 157 |
| 58 | 3300028380 | Ga0268265_10412150 | Ga0268265_104121501 | 157 |
| 59 | 3300035086 | Ga0373934_0155046 | Ga0373934_0155046_418_900 | 157 |
| 60 | 3300035724 | Ga0373933_0110779 | Ga0373933_0110779_734_1216 | 157 |
| 61 | 3300039437 | Ga0436365_0858441 | Ga0436365_0858441_698_1183 | 157 |
| 62 | 3300039450 | Ga0436363_0552972 | Ga0436363_0552972_218_703 | 157 |
| 63 | 3300044673 | Ga0453683_0028088 | Ga0453683_0028088_2117_2599 | 157 |
| 64 | 3300045051 | Ga0451576_0183851 | Ga0451576_0183851_575_1057 | 157 |
| 65 | 3300049665 | Ga0501227_061922 | Ga0501227_061922_201_683 | 157 |
| 66 | 3300049689 | Ga0501260_012076 | Ga0501260_012076_273_755 | 157 |
| 67 | 3300050511 | nmdc:mga08y16_1176183_c1 | nmdc:mga08y16_1176183_c1_133_615 | 157 |
| 68 | 3300050513 | nmdc:mga0rr50_818492_c1 | nmdc:mga0rr50_818492_c1_159_641 | 157 |
| 69 | 3300049571 | Ga0501034_0497964 | Ga0501034_0497964_526_1014 | 158 |
| 70 | 3300049575 | Ga0501039_0025679 | Ga0501039_0025679_3430_3915 | 158 |
| 71 | 3300005330 | Ga0070690_100368467 | Ga0070690_1003684672 | 159 |
| 72 | 3300005334 | Ga0068869_100556365 | Ga0068869_1005563652 | 159 |
| 73 | 3300005343 | Ga0070687_100205091 | Ga0070687_1002050912 | 159 |
| 74 | 3300005365 | Ga0070688_101202590 | Ga0070688_1012025901 | 159 |
| 75 | 3300005438 | Ga0070701_10892550 | Ga0070701_108925501 | 159 |
| 76 | 3300005544 | Ga0070686_100567126 | Ga0070686_1005671261 | 159 |
| 77 | 3300005549 | Ga0070704_100221176 | Ga0070704_1002211762 | 159 |
| 78 | 3300005614 | Ga0068856_100851088 | Ga0068856_1008510882 | 159 |
| 79 | 3300005718 | Ga0068866_10492828 | Ga0068866_104928282 | 159 |
| 80 | 3300005844 | Ga0068862_100320474 | Ga0068862_1003204741 | 159 |
| 81 | 3300006358 | Ga0068871_100156021 | Ga0068871_1001560213 | 159 |
| 82 | 3300006844 | Ga0075428_100003491 | Ga0075428_1000034914 | 159 |
| 83 | 3300006844 | Ga0075428_100142987 | Ga0075428_1001429874 | 159 |
| 84 | 3300006846 | Ga0075430_100134196 | Ga0075430_1001341962 | 159 |
| 85 | 3300006880 | Ga0075429_100704025 | Ga0075429_1007040251 | 159 |
| 86 | 3300009094 | Ga0111539_10714610 | Ga0111539_107146102 | 159 |
| 87 | 3300009147 | Ga0114129_10076452 | Ga0114129_100764524 | 159 |
| 88 | 3300009177 | Ga0105248_11158809 | Ga0105248_111588091 | 159 |
| 89 | 3300009553 | Ga0105249_11440879 | Ga0105249_114408791 | 159 |
| 90 | 3300025899 | Ga0207642_10396124 | Ga0207642_103961241 | 159 |
| 91 | 3300025942 | Ga0207689_10128196 | Ga0207689_101281962 | 159 |
| 92 | 3300026035 | Ga0207703_10056777 | Ga0207703_100567773 | 159 |
| 93 | 3300026118 | Ga0207675_100944187 | Ga0207675_1009441872 | 159 |
| 94 | 3300028380 | Ga0268265_10034008 | Ga0268265_100340083 | 159 |
| 95 | 3300046475 | Ga0495639_0039610 | Ga0495639_0039610_376_864 | 159 |
| 96 | 3300046499 | Ga0495594_0134087 | Ga0495594_0134087_266_754 | 159 |
| 97 | 3300046683 | Ga0495658_0289979 | Ga0495658_0289979_420_908 | 159 |
| 98 | 3300047318 | Ga0495636_0283507 | Ga0495636_0283507_239_727 | 159 |
| 99 | 3300047321 | Ga0495676_0128145 | Ga0495676_0128145_844_1332 | 159 |
| 100 | 3300049590 | Ga0501074_0058740 | Ga0501074_0058740_1521_2018 | 159 |
| 101 | 3300049742 | Ga0501080_0119982 | Ga0501080_0119982_1695_2192 | 159 |
| 102 | 3300049743 | Ga0501081_0038486 | Ga0501081_0038486_2704_3192 | 159 |
| 103 | 3300050508 | nmdc:mga09592_929399_c1 | nmdc:mga09592_929399_c1_184_672 | 159 |
| 104 | 3300050509 | nmdc:mga0qj67_122880_c1 | nmdc:mga0qj67_122880_c1_592_1104 | 159 |
| 105 | 3300050511 | nmdc:mga08y16_785213_c1 | nmdc:mga08y16_785213_c1_109_594 | 159 |
| 106 | 3300005293 | Ga0065715_10475256 | Ga0065715_104752562 | 160 |
| 107 | 3300005329 | Ga0070683_100686537 | Ga0070683_1006865371 | 160 |
| 108 | 3300005330 | Ga0070690_100472400 | Ga0070690_1004724001 | 160 |
| 109 | 3300005331 | Ga0070670_100090466 | Ga0070670_1000904664 | 160 |
| 110 | 3300005333 | Ga0070677_10415161 | Ga0070677_104151612 | 160 |
| 111 | 3300005334 | Ga0068869_100030606 | Ga0068869_1000306061 | 160 |
| 112 | 3300005338 | Ga0068868_100068435 | Ga0068868_1000684352 | 160 |
| 113 | 3300005340 | Ga0070689_100219194 | Ga0070689_1002191942 | 160 |
| 114 | 3300005340 | Ga0070689_100241344 | Ga0070689_1002413443 | 160 |
| 115 | 3300005340 | Ga0070689_100585950 | Ga0070689_1005859502 | 160 |
| 116 | 3300005343 | Ga0070687_100045136 | Ga0070687_1000451362 | 160 |
| 117 | 3300005343 | Ga0070687_100147979 | Ga0070687_1001479792 | 160 |
| 118 | 3300005343 | Ga0070687_100295099 | Ga0070687_1002950991 | 160 |
| 119 | 3300005345 | Ga0070692_10003273 | Ga0070692_100032735 | 160 |
| 120 | 3300005354 | Ga0070675_100083855 | Ga0070675_1000838552 | 160 |
| 121 | 3300005356 | Ga0070674_101072094 | Ga0070674_1010720941 | 160 |
| 122 | 3300005364 | Ga0070673_100114656 | Ga0070673_1001146563 | 160 |
| 123 | 3300005365 | Ga0070688_100051918 | Ga0070688_1000519183 | 160 |
| 124 | 3300005367 | Ga0070667_100324438 | Ga0070667_1003244382 | 160 |
| 125 | 3300005406 | Ga0070703_10073858 | Ga0070703_100738582 | 160 |
| 126 | 3300005438 | Ga0070701_10335149 | Ga0070701_103351491 | 160 |
| 127 | 3300005441 | Ga0070700_100679120 | Ga0070700_1006791201 | 160 |
| 128 | 3300005441 | Ga0070700_101305729 | Ga0070700_1013057291 | 160 |
| 129 | 3300005444 | Ga0070694_100000132 | Ga0070694_1000001323 | 160 |
| 130 | 3300005444 | Ga0070694_100018009 | Ga0070694_1000180094 | 160 |
| 131 | 3300005444 | Ga0070694_100271900 | Ga0070694_1002719002 | 160 |
| 132 | 3300005445 | Ga0070708_100024284 | Ga0070708_1000242844 | 160 |
| 133 | 3300005445 | Ga0070708_100054741 | Ga0070708_1000547414 | 160 |
| 134 | 3300005445 | Ga0070708_100926633 | Ga0070708_1009266332 | 160 |
| 135 | 3300005466 | Ga0070685_10004309 | Ga0070685_100043097 | 160 |
| 136 | 3300005466 | Ga0070685_10004448 | Ga0070685_100044488 | 160 |
| 137 | 3300005466 | Ga0070685_10833378 | Ga0070685_108333781 | 160 |
| 138 | 3300005468 | Ga0070707_100355799 | Ga0070707_1003557991 | 160 |
| 139 | 3300005471 | Ga0070698_100113069 | Ga0070698_1001130693 | 160 |
| 140 | 3300005518 | Ga0070699_100889375 | Ga0070699_1008893751 | 160 |
| 141 | 3300005518 | Ga0070699_101674632 | Ga0070699_1016746321 | 160 |
| 142 | 3300005535 | Ga0070684_100626158 | Ga0070684_1006261582 | 160 |
| 143 | 3300005539 | Ga0068853_100006311 | Ga0068853_1000063118 | 160 |
| 144 | 3300005539 | Ga0068853_101089665 | Ga0068853_1010896651 | 160 |
| 145 | 3300005543 | Ga0070672_100613630 | Ga0070672_1006136303 | 160 |
| 146 | 3300005544 | Ga0070686_100396447 | Ga0070686_1003964472 | 160 |
| 147 | 3300005545 | Ga0070695_100335846 | Ga0070695_1003358462 | 160 |
| 148 | 3300005546 | Ga0070696_100035215 | Ga0070696_1000352151 | 160 |
| 149 | 3300005549 | Ga0070704_100193612 | Ga0070704_1001936122 | 160 |
| 150 | 3300005549 | Ga0070704_100515366 | Ga0070704_1005153662 | 160 |
| 151 | 3300005549 | Ga0070704_100629452 | Ga0070704_1006294521 | 160 |
| 152 | 3300005615 | Ga0070702_101045603 | Ga0070702_1010456031 | 160 |
| 153 | 3300005618 | Ga0068864_100071631 | Ga0068864_1000716313 | 160 |
| 154 | 3300005618 | Ga0068864_101068438 | Ga0068864_1010684382 | 160 |
| 155 | 3300005618 | Ga0068864_101815355 | Ga0068864_1018153551 | 160 |
| 156 | 3300005719 | Ga0068861_100994881 | Ga0068861_1009948812 | 160 |
| 157 | 3300005834 | Ga0068851_10872923 | Ga0068851_108729231 | 160 |
| 158 | 3300005841 | Ga0068863_100616015 | Ga0068863_1006160152 | 160 |
| 159 | 3300005844 | Ga0068862_100223861 | Ga0068862_1002238611 | 160 |
| 160 | 3300005937 | Ga0081455_10067355 | Ga0081455_100673552 | 160 |
| 161 | 3300006844 | Ga0075428_100347938 | Ga0075428_1003479382 | 160 |
| 162 | 3300006844 | Ga0075428_101111209 | Ga0075428_1011112092 | 160 |
| 163 | 3300006844 | Ga0075428_101126210 | Ga0075428_1011262101 | 160 |
| 164 | 3300006844 | Ga0075428_102017391 | Ga0075428_1020173911 | 160 |
| 165 | 3300006844 | Ga0075428_102089812 | Ga0075428_1020898121 | 160 |
| 166 | 3300006846 | Ga0075430_100115629 | Ga0075430_1001156292 | 160 |
| 167 | 3300006846 | Ga0075430_100511312 | Ga0075430_1005113121 | 160 |
| 168 | 3300006846 | Ga0075430_101249538 | Ga0075430_1012495381 | 160 |
| 169 | 3300006847 | Ga0075431_100019662 | Ga0075431_1000196622 | 160 |
| 170 | 3300006847 | Ga0075431_100304508 | Ga0075431_1003045082 | 160 |
| 171 | 3300006847 | Ga0075431_100653556 | Ga0075431_1006535562 | 160 |
| 172 | 3300006852 | Ga0075433_10212570 | Ga0075433_102125703 | 160 |
| 173 | 3300006852 | Ga0075433_10250434 | Ga0075433_102504342 | 160 |
| 174 | 3300006852 | Ga0075433_10341299 | Ga0075433_103412992 | 160 |
| 175 | 3300006871 | Ga0075434_100030747 | Ga0075434_1000307472 | 160 |
| 176 | 3300006880 | Ga0075429_100032626 | Ga0075429_1000326264 | 160 |
| 177 | 3300006880 | Ga0075429_100358855 | Ga0075429_1003588552 | 160 |
| 178 | 3300006880 | Ga0075429_100439572 | Ga0075429_1004395722 | 160 |
| 179 | 3300007076 | Ga0075435_100056214 | Ga0075435_1000562145 | 160 |
| 180 | 3300007265 | Ga0099794_10061369 | Ga0099794_100613692 | 160 |
| 181 | 3300007265 | Ga0099794_10305486 | Ga0099794_103054861 | 160 |
| 182 | 3300009094 | Ga0111539_10177879 | Ga0111539_101778792 | 160 |
| 183 | 3300009094 | Ga0111539_10178155 | Ga0111539_101781552 | 160 |
| 184 | 3300009094 | Ga0111539_10524632 | Ga0111539_105246322 | 160 |
| 185 | 3300009101 | Ga0105247_10490694 | Ga0105247_104906941 | 160 |
| 186 | 3300009147 | Ga0114129_10015076 | Ga0114129_100150767 | 160 |
| 187 | 3300009147 | Ga0114129_10068208 | Ga0114129_100682083 | 160 |
| 188 | 3300009147 | Ga0114129_10093636 | Ga0114129_100936363 | 160 |
| 189 | 3300009147 | Ga0114129_10614341 | Ga0114129_106143412 | 160 |
| 190 | 3300009147 | Ga0114129_10704109 | Ga0114129_107041092 | 160 |
| 191 | 3300009177 | Ga0105248_10053033 | Ga0105248_100530332 | 160 |
| 192 | 3300009177 | Ga0105248_10143001 | Ga0105248_101430011 | 160 |
| 193 | 3300009553 | Ga0105249_10156197 | Ga0105249_101561972 | 160 |
| 194 | 3300010159 | Ga0099796_10279875 | Ga0099796_102798751 | 160 |
| 195 | 3300013308 | Ga0157375_10349024 | Ga0157375_103490243 | 160 |
| 196 | 3300014325 | Ga0163163_10061912 | Ga0163163_100619124 | 160 |
| 197 | 3300014325 | Ga0163163_10077930 | Ga0163163_100779303 | 160 |
| 198 | 3300014326 | Ga0157380_10195056 | Ga0157380_101950563 | 160 |
| 199 | 3300014969 | Ga0157376_10180063 | Ga0157376_101800633 | 160 |
| 200 | 3300014969 | Ga0157376_11648094 | Ga0157376_116480941 | 160 |
| 201 | 3300025321 | Ga0207656_10563506 | Ga0207656_105635061 | 160 |
| 202 | 3300025910 | Ga0207684_10407776 | Ga0207684_104077762 | 160 |
| 203 | 3300025917 | Ga0207660_11059970 | Ga0207660_110599702 | 160 |
| 204 | 3300025918 | Ga0207662_10013691 | Ga0207662_100136914 | 160 |
| 205 | 3300025918 | Ga0207662_10660665 | Ga0207662_106606651 | 160 |
| 206 | 3300025922 | Ga0207646_10297772 | Ga0207646_102977722 | 160 |
| 207 | 3300025924 | Ga0207694_10466350 | Ga0207694_104663501 | 160 |
| 208 | 3300025931 | Ga0207644_10093586 | Ga0207644_100935863 | 160 |
| 209 | 3300025936 | Ga0207670_10013540 | Ga0207670_100135403 | 160 |
| 210 | 3300025936 | Ga0207670_10097529 | Ga0207670_100975293 | 160 |
| 211 | 3300025936 | Ga0207670_10102476 | Ga0207670_101024762 | 160 |
| 212 | 3300025936 | Ga0207670_10698899 | Ga0207670_106988992 | 160 |
| 213 | 3300025937 | Ga0207669_10622185 | Ga0207669_106221852 | 160 |
| 214 | 3300025940 | Ga0207691_10406624 | Ga0207691_104066241 | 160 |
| 215 | 3300025941 | Ga0207711_10068051 | Ga0207711_100680512 | 160 |
| 216 | 3300025941 | Ga0207711_10549986 | Ga0207711_105499862 | 160 |
| 217 | 3300025945 | Ga0207679_10311597 | Ga0207679_103115972 | 160 |
| 218 | 3300025960 | Ga0207651_10191368 | Ga0207651_101913682 | 160 |
| 219 | 3300025960 | Ga0207651_10418084 | Ga0207651_104180841 | 160 |
| 220 | 3300026023 | Ga0207677_10172285 | Ga0207677_101722852 | 160 |
| 221 | 3300026041 | Ga0207639_10002611 | Ga0207639_100026114 | 160 |
| 222 | 3300026041 | Ga0207639_11404969 | Ga0207639_114049691 | 160 |
| 223 | 3300026075 | Ga0207708_11220812 | Ga0207708_112208122 | 160 |
| 224 | 3300026075 | Ga0207708_11261066 | Ga0207708_112610661 | 160 |
| 225 | 3300026088 | Ga0207641_10603437 | Ga0207641_106034371 | 160 |
| 226 | 3300026095 | Ga0207676_10129984 | Ga0207676_101299841 | 160 |
| 227 | 3300026095 | Ga0207676_11415460 | Ga0207676_114154601 | 160 |
| 228 | 3300026118 | Ga0207675_102008045 | Ga0207675_1020080451 | 160 |
| 229 | 3300026142 | Ga0207698_10244523 | Ga0207698_102445232 | 160 |
| 230 | 3300027671 | Ga0209588_1232916 | Ga0209588_12329161 | 160 |
| 231 | 3300027907 | Ga0207428_10111177 | Ga0207428_101111773 | 160 |
| 232 | 3300028380 | Ga0268265_10859886 | Ga0268265_108598862 | 160 |
| 233 | 3300031911 | Ga0307412_10011096 | Ga0307412_100110962 | 160 |
| 234 | 3300031995 | Ga0307409_100577133 | Ga0307409_1005771332 | 160 |
| 235 | 3300035085 | Ga0373929_0151530 | Ga0373929_0151530_91_588 | 160 |
| 236 | 3300035119 | Ga0373956_0267251 | Ga0373956_0267251_249_740 | 160 |
| 237 | 3300035170 | Ga0373943_0020620 | Ga0373943_0020620_477_968 | 160 |
| 238 | 3300035241 | Ga0373961_0355349 | Ga0373961_0355349_30_527 | 160 |
| 239 | 3300035242 | Ga0373962_0164514 | Ga0373962_0164514_71_565 | 160 |
| 240 | 3300037068 | Ga0373925_0016228 | Ga0373925_0016228_3475_3966 | 160 |
| 241 | 3300039450 | Ga0436363_0436253 | Ga0436363_0436253_1307_1801 | 160 |
| 242 | 3300042876 | Ga0451577_0122205 | Ga0451577_0122205_1633_2124 | 160 |
| 243 | 3300042876 | Ga0451577_0267816 | Ga0451577_0267816_954_1523 | 160 |
| 244 | 3300044673 | Ga0453683_0005042 | Ga0453683_0005042_7370_7861 | 160 |
| 245 | 3300044673 | Ga0453683_0457288 | Ga0453683_0457288_254_751 | 160 |
| 246 | 3300044712 | Ga0453684_0000159 | Ga0453684_0000159_130325_130816 | 160 |
| 247 | 3300045051 | Ga0451576_0000120 | Ga0451576_0000120_130325_130816 | 160 |
| 248 | 3300045051 | Ga0451576_0004731 | Ga0451576_0004731_13384_13875 | 160 |
| 249 | 3300045051 | Ga0451576_0667258 | Ga0451576_0667258_375_872 | 160 |
| 250 | 3300045051 | Ga0451576_0887916 | Ga0451576_0887916_84_575 | 160 |
| 251 | 3300045051 | Ga0451576_2246775 | Ga0451576_2246775_23_514 | 160 |
| 252 | 3300046454 | Ga0495592_0032454 | Ga0495592_0032454_2965_3447 | 160 |
| 253 | 3300046459 | Ga0495629_0000004 | Ga0495629_0000004_214114_214605 | 160 |
| 254 | 3300046473 | Ga0495582_0045386 | Ga0495582_0045386_44_535 | 160 |
| 255 | 3300046475 | Ga0495639_0000964 | Ga0495639_0000964_4204_4695 | 160 |
| 256 | 3300046476 | Ga0495662_0064368 | Ga0495662_0064368_459_950 | 160 |
| 257 | 3300046476 | Ga0495662_0300322 | Ga0495662_0300322_79_570 | 160 |
| 258 | 3300046517 | Ga0495630_0267201 | Ga0495630_0267201_301_783 | 160 |
| 259 | 3300046517 | Ga0495630_0404300 | Ga0495630_0404300_441_932 | 160 |
| 260 | 3300046526 | Ga0495666_0007646 | Ga0495666_0007646_863_1354 | 160 |
| 261 | 3300046535 | Ga0495586_0001253 | Ga0495586_0001253_436_927 | 160 |
| 262 | 3300046559 | Ga0495667_0494970 | Ga0495667_0494970_247_738 | 160 |
| 263 | 3300046615 | Ga0495656_0553759 | Ga0495656_0553759_67_558 | 160 |
| 264 | 3300046674 | Ga0495588_0080848 | Ga0495588_0080848_840_1331 | 160 |
| 265 | 3300046681 | Ga0495647_0034716 | Ga0495647_0034716_793_1284 | 160 |
| 266 | 3300046683 | Ga0495658_0014081 | Ga0495658_0014081_2696_3187 | 160 |
| 267 | 3300046689 | Ga0495613_0199101 | Ga0495613_0199101_438_929 | 160 |
| 268 | 3300046691 | Ga0495670_0460047 | Ga0495670_0460047_89_583 | 160 |
| 269 | 3300047315 | Ga0495581_0098484 | Ga0495581_0098484_226_717 | 160 |
| 270 | 3300047322 | Ga0495680_0049389 | Ga0495680_0049389_2650_3141 | 160 |
| 271 | 3300047322 | Ga0495680_0865507 | Ga0495680_0865507_43_534 | 160 |
| 272 | 3300047673 | Ga0495593_0262046 | Ga0495593_0262046_200_691 | 160 |
| 273 | 3300047673 | Ga0495593_0302155 | Ga0495593_0302155_25_516 | 160 |
| 274 | 3300049570 | Ga0501033_0468436 | Ga0501033_0468436_296_811 | 160 |
| 275 | 3300049571 | Ga0501034_0676813 | Ga0501034_0676813_355_849 | 160 |
| 276 | 3300049572 | Ga0501036_1446672 | Ga0501036_1446672_30_527 | 160 |
| 277 | 3300049578 | Ga0501042_0821628 | Ga0501042_0821628_82_597 | 160 |
| 278 | 3300049582 | Ga0501048_0240968 | Ga0501048_0240968_740_1255 | 160 |
| 279 | 3300049584 | Ga0501068_0106823 | Ga0501068_0106823_645_1142 | 160 |
| 280 | 3300049584 | Ga0501068_0341757 | Ga0501068_0341757_269_766 | 160 |
| 281 | 3300049585 | Ga0501069_0011241 | Ga0501069_0011241_2422_2919 | 160 |
| 282 | 3300049585 | Ga0501069_0047562 | Ga0501069_0047562_13_507 | 160 |
| 283 | 3300049586 | Ga0501070_0000021 | Ga0501070_0000021_127160_127657 | 160 |
| 284 | 3300049586 | Ga0501070_0013331 | Ga0501070_0013331_1740_2234 | 160 |
| 285 | 3300049586 | Ga0501070_0482989 | Ga0501070_0482989_449_946 | 160 |
| 286 | 3300049587 | Ga0501071_0041684 | Ga0501071_0041684_1739_2233 | 160 |
| 287 | 3300049588 | Ga0501072_0180903 | Ga0501072_0180903_132_629 | 160 |
| 288 | 3300049588 | Ga0501072_0862626 | Ga0501072_0862626_157_654 | 160 |
| 289 | 3300049589 | Ga0501073_0036324 | Ga0501073_0036324_258_755 | 160 |
| 290 | 3300049590 | Ga0501074_0019969 | Ga0501074_0019969_1653_2150 | 160 |
| 291 | 3300049590 | Ga0501074_0202997 | Ga0501074_0202997_622_1125 | 160 |
| 292 | 3300049668 | Ga0501233_112196 | Ga0501233_112196_186_677 | 160 |
| 293 | 3300049705 | Ga0501225_0132020 | Ga0501225_0132020_190_681 | 160 |
| 294 | 3300049742 | Ga0501080_0031185 | Ga0501080_0031185_4392_4889 | 160 |
| 295 | 3300049742 | Ga0501080_0151993 | Ga0501080_0151993_481_978 | 160 |
| 296 | 3300049743 | Ga0501081_0113312 | Ga0501081_0113312_397_894 | 160 |
| 297 | 3300049744 | Ga0501083_0006812 | Ga0501083_0006812_7019_7516 | 160 |
| 298 | 3300049744 | Ga0501083_0099832 | Ga0501083_0099832_54_548 | 160 |
| 299 | 3300049744 | Ga0501083_0118324 | Ga0501083_0118324_814_1311 | 160 |
| 300 | 3300049824 | Ga0501045_0521798 | Ga0501045_0521798_352_867 | 160 |
| 301 | 3300050507 | nmdc:mga05p37_1753677_c1 | nmdc:mga05p37_1753677_c1_41_538 | 160 |
| 302 | 3300050507 | nmdc:mga05p37_281535_c1 | nmdc:mga05p37_281535_c1_1029_1571 | 160 |
| 303 | 3300050507 | nmdc:mga05p37_36098_c1 | nmdc:mga05p37_36098_c1_3293_3784 | 160 |
| 304 | 3300050507 | nmdc:mga05p37_84176_c1 | nmdc:mga05p37_84176_c1_166_675 | 160 |
| 305 | 3300050508 | nmdc:mga09592_25036_c1 | nmdc:mga09592_25036_c1_2230_2721 | 160 |
| 306 | 3300050508 | nmdc:mga09592_396475_c1 | nmdc:mga09592_396475_c1_140_631 | 160 |
| 307 | 3300050508 | nmdc:mga09592_423394_c1 | nmdc:mga09592_423394_c1_136_627 | 160 |
| 308 | 3300050509 | nmdc:mga0qj67_1087674_c1 | nmdc:mga0qj67_1087674_c1_18_509 | 160 |
| 309 | 3300050509 | nmdc:mga0qj67_168902_c1 | nmdc:mga0qj67_168902_c1_889_1389 | 160 |
| 310 | 3300050509 | nmdc:mga0qj67_248645_c1 | nmdc:mga0qj67_248645_c1_101_592 | 160 |
| 311 | 3300050509 | nmdc:mga0qj67_73877_c1 | nmdc:mga0qj67_73877_c1_1475_1966 | 160 |
| 312 | 3300050509 | nmdc:mga0qj67_763716_c1 | nmdc:mga0qj67_763716_c1_206_697 | 160 |
| 313 | 3300050510 | nmdc:mga06r32_1093841_c1 | nmdc:mga06r32_1093841_c1_114_605 | 160 |
| 314 | 3300050510 | nmdc:mga06r32_144722_c1 | nmdc:mga06r32_144722_c1_765_1265 | 160 |
| 315 | 3300050510 | nmdc:mga06r32_158987_c1 | nmdc:mga06r32_158987_c1_88_579 | 160 |
| 316 | 3300050510 | nmdc:mga06r32_56800_c1 | nmdc:mga06r32_56800_c1_1872_2363 | 160 |
| 317 | 3300050511 | nmdc:mga08y16_189928_c1 | nmdc:mga08y16_189928_c1_305_796 | 160 |
| 318 | 3300050511 | nmdc:mga08y16_56726_c1 | nmdc:mga08y16_56726_c1_2125_2619 | 160 |
| 319 | 3300050512 | nmdc:mga0n895_80531_c1 | nmdc:mga0n895_80531_c1_533_1030 | 160 |
| 320 | 3300050513 | nmdc:mga0rr50_128130_c1 | nmdc:mga0rr50_128130_c1_1183_1680 | 160 |
| 321 | 3300050513 | nmdc:mga0rr50_396742_c1 | nmdc:mga0rr50_396742_c1_616_1110 | 160 |
| 322 | 3300050515 | nmdc:mga0a205_341276_c1 | nmdc:mga0a205_341276_c1_22_516 | 160 |
| 323 | 3300050515 | nmdc:mga0a205_409426_c1 | nmdc:mga0a205_409426_c1_119_628 | 160 |
| 324 | 3300053085 | Ga0495619_0509448 | Ga0495619_0509448_233_724 | 160 |
| 325 | 3300053094 | Ga0500566_0042855 | Ga0500566_0042855_194_685 | 160 |
| 326 | 3300054114 | Ga0501084_0193435 | Ga0501084_0193435_191_682 | 160 |
| 327 | 3300060353 | Ga0501082_0023748 | Ga0501082_0023748_2090_2587 | 160 |
| 328 | 3300060353 | Ga0501082_0065250 | Ga0501082_0065250_2431_2925 | 160 |
| 329 | 3300060353 | Ga0501082_0390440 | Ga0501082_0390440_599_1096 | 160 |
| 330 | 3300061734 | Ga0530510_0000561 | Ga0530510_0000561_94_588 | 160 |
| 331 | 3300061734 | Ga0530510_0540022 | Ga0530510_0540022_98_595 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tsj-assembly1.cif.gz_A | crystal structure of protein from staphylococcus aureus | 0.7697 | 7 | 122 |
| 7zmg-assembly1.cif.gz_G | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) | 0.7238 | 34 | 71 |
| 1tsj-assembly1.cif.gz_A | crystal structure of protein from staphylococcus aureus | 0.721 | 7 | 122 |
| 6bz0-assembly2.cif.gz_C | 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. | 0.7042 | 33 | 71 |
| 4qsh-assembly1.cif.gz_D | crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp | 0.6939 | 33 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLN7_64_211_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7741 | 104 | 125 | 3.50.50.60 |
| af_Q9UM44_30_139_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.748 | 53 | 68 | 2.60.40.10 |
| af_K7M4I7_93_208_2.40.330.10 | Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain | 0.7468 | 53 | 68 | 2.40.330.10 |
| 1tsjA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7195 | 7 | 122 | 3.10.180.10 |
| 4hnvB02 | Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain | 0.7023 | 33 | 74 | 3.10.600.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0WRQ8-F1-model_v4 | VOC family protein | 0.9807 | 88 | 159 |
|
| AF-A0A2V6CT88-F1-model_v4 | PhnB-like domain-containing protein | 0.9788 | 103 | 159 |
|
| AF-A0A4Q3P670-F1-model_v4 | deleted | 0.9727 | 87 | 159 |
|
| AF-A0A7U7I4I4-F1-model_v4 | deleted | 0.9703 | 83 | 159 |
|
| AF-A0A7Y2AEA9-F1-model_v4 | VOC family protein | 0.9696 | 91 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar